Citrus Sinensis ID: 041208
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 89 | ||||||
| 224122316 | 775 | predicted protein [Populus trichocarpa] | 0.449 | 0.051 | 0.707 | 1e-10 | |
| 255568094 | 745 | Xylem serine proteinase 1 precursor, put | 0.314 | 0.037 | 0.682 | 3e-10 | |
| 255568082 | 766 | Xylem serine proteinase 1 precursor, put | 0.426 | 0.049 | 0.731 | 4e-10 | |
| 224056865 | 772 | predicted protein [Populus trichocarpa] | 0.460 | 0.053 | 0.707 | 4e-10 | |
| 227053577 | 771 | subtilisin-like serine protease [Carica | 0.460 | 0.053 | 0.658 | 8e-10 | |
| 297744931 | 772 | unnamed protein product [Vitis vinifera] | 0.449 | 0.051 | 0.658 | 2e-09 | |
| 255567212 | 771 | Xylem serine proteinase 1 precursor, put | 0.393 | 0.045 | 0.634 | 2e-09 | |
| 359496840 | 767 | PREDICTED: subtilisin-like protease-like | 0.449 | 0.052 | 0.658 | 2e-09 | |
| 86439745 | 722 | subtilisin-like protease [Triticum aesti | 0.449 | 0.055 | 0.707 | 2e-09 | |
| 225447456 | 769 | PREDICTED: subtilisin-like protease [Vit | 0.359 | 0.041 | 0.682 | 3e-09 |
| >gi|224122316|ref|XP_002330593.1| predicted protein [Populus trichocarpa] gi|222872151|gb|EEF09282.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 70.5 bits (171), Expect = 1e-10, Method: Composition-based stats.
Identities = 29/41 (70%), Positives = 36/41 (87%)
Query: 2 ELLTTRSWDFLGMEKDNIMPPNSLWNKARFGEDVIIGNIDT 42
+L TT SW FLG+EKD ++PP+SLW KAR+GEDVIIGN+DT
Sbjct: 113 KLHTTHSWSFLGLEKDGVVPPSSLWKKARYGEDVIIGNLDT 153
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255568094|ref|XP_002525023.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis] gi|223535685|gb|EEF37350.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255568082|ref|XP_002525017.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis] gi|223535679|gb|EEF37344.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224056865|ref|XP_002299062.1| predicted protein [Populus trichocarpa] gi|222846320|gb|EEE83867.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|227053577|gb|ACP18876.1| subtilisin-like serine protease [Carica papaya] | Back alignment and taxonomy information |
|---|
| >gi|297744931|emb|CBI38462.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255567212|ref|XP_002524587.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis] gi|223536140|gb|EEF37795.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359496840|ref|XP_002269259.2| PREDICTED: subtilisin-like protease-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|86439745|emb|CAJ75644.1| subtilisin-like protease [Triticum aestivum] | Back alignment and taxonomy information |
|---|
| >gi|225447456|ref|XP_002266728.1| PREDICTED: subtilisin-like protease [Vitis vinifera] gi|296085071|emb|CBI28486.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 89 | ||||||
| TAIR|locus:2050215 | 772 | AIR3 "AT2G04160" [Arabidopsis | 0.471 | 0.054 | 0.619 | 2.4e-17 | |
| UNIPROTKB|Q8H4X8 | 762 | OJ1136_A10.113 "Putative subti | 0.471 | 0.055 | 0.547 | 3.5e-16 | |
| UNIPROTKB|Q6H733 | 799 | P0026H03.20-1 "Putative subtil | 0.460 | 0.051 | 0.585 | 8e-14 | |
| UNIPROTKB|Q0JIK4 | 375 | Os01g0795400 "Os01g0795400 pro | 0.426 | 0.101 | 0.658 | 2.2e-13 | |
| TAIR|locus:2168057 | 778 | SBT5.4 "AT5G59810" [Arabidopsi | 0.460 | 0.052 | 0.512 | 3.2e-13 | |
| UNIPROTKB|Q0JK21 | 741 | Os01g0702300 "Os01g0702300 pro | 0.404 | 0.048 | 0.605 | 2e-12 | |
| TAIR|locus:2037895 | 774 | SBT3.5 "AT1G32940" [Arabidopsi | 0.426 | 0.049 | 0.536 | 3.7e-12 | |
| TAIR|locus:2127706 | 756 | AT4G10520 "AT4G10520" [Arabido | 0.483 | 0.056 | 0.5 | 2.4e-11 | |
| TAIR|locus:2136824 | 746 | UNE17 "AT4G26330" [Arabidopsis | 0.415 | 0.049 | 0.552 | 3.8e-11 | |
| TAIR|locus:2037935 | 777 | SBT3.3 "AT1G32960" [Arabidopsi | 0.426 | 0.048 | 0.487 | 6.7e-11 |
| TAIR|locus:2050215 AIR3 "AT2G04160" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 152 (58.6 bits), Expect = 2.4e-17, Sum P(2) = 2.4e-17
Identities = 26/42 (61%), Positives = 35/42 (83%)
Query: 1 MELLTTRSWDFLGMEKDNIMPPNSLWNKARFGEDVIIGNIDT 42
++L TTRSWDFLG+E ++ +P +S+W KARFGED II N+DT
Sbjct: 113 LKLHTTRSWDFLGLEHNSYVPSSSIWRKARFGEDTIIANLDT 154
|
|
| UNIPROTKB|Q8H4X8 OJ1136_A10.113 "Putative subtilisin-like serine protease AIR3" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6H733 P0026H03.20-1 "Putative subtilisin-like proteinase AIR3" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0JIK4 Os01g0795400 "Os01g0795400 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2168057 SBT5.4 "AT5G59810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0JK21 Os01g0702300 "Os01g0702300 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2037895 SBT3.5 "AT1G32940" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2127706 AT4G10520 "AT4G10520" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2136824 UNE17 "AT4G26330" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2037935 SBT3.3 "AT1G32960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 89 | |||
| cd04852 | 307 | cd04852, Peptidases_S8_3, Peptidase S8 family doma | 1e-09 | |
| cd04852 | 307 | cd04852, Peptidases_S8_3, Peptidase S8 family doma | 1e-06 | |
| cd04077 | 255 | cd04077, Peptidases_S8_PCSK9_ProteinaseK_like, Pep | 9e-05 |
| >gnl|CDD|173795 cd04852, Peptidases_S8_3, Peptidase S8 family domain, uncharacterized subfamily 3 | Back alignment and domain information |
|---|
Score = 52.2 bits (126), Expect = 1e-09
Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 3/41 (7%)
Query: 2 ELLTTRSWDFLGMEKDNIMPPNSLWNKARFGEDVIIGNIDT 42
+L TTRS DFLG+ SL A GE +IIG +DT
Sbjct: 2 QLHTTRSPDFLGLPGAW---GGSLLGAANAGEGIIIGVLDT 39
|
This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values. Length = 307 |
| >gnl|CDD|173795 cd04852, Peptidases_S8_3, Peptidase S8 family domain, uncharacterized subfamily 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173790 cd04077, Peptidases_S8_PCSK9_ProteinaseK_like, Peptidase S8 family domain in ProteinaseK-like proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 89 | |||
| cd04852 | 307 | Peptidases_S8_3 Peptidase S8 family domain, unchar | 99.81 | |
| cd07497 | 311 | Peptidases_S8_14 Peptidase S8 family domain, uncha | 99.41 | |
| cd07479 | 255 | Peptidases_S8_SKI-1_like Peptidase S8 family domai | 99.26 | |
| cd07478 | 455 | Peptidases_S8_CspA-like Peptidase S8 family domain | 99.19 | |
| cd04059 | 297 | Peptidases_S8_Protein_convertases_Kexins_Furin-lik | 99.16 | |
| cd07485 | 273 | Peptidases_S8_Fervidolysin_like Peptidase S8 famil | 99.14 | |
| cd07489 | 312 | Peptidases_S8_5 Peptidase S8 family domain, unchar | 99.12 | |
| cd04842 | 293 | Peptidases_S8_Kp43_protease Peptidase S8 family do | 99.09 | |
| cd07480 | 297 | Peptidases_S8_12 Peptidase S8 family domain, uncha | 99.08 | |
| cd07476 | 267 | Peptidases_S8_thiazoline_oxidase_subtilisin-like_p | 99.08 | |
| cd07481 | 264 | Peptidases_S8_BacillopeptidaseF-like Peptidase S8 | 99.07 | |
| cd07487 | 264 | Peptidases_S8_1 Peptidase S8 family domain, unchar | 99.07 | |
| cd04843 | 277 | Peptidases_S8_11 Peptidase S8 family domain, uncha | 99.05 | |
| cd07475 | 346 | Peptidases_S8_C5a_Peptidase Peptidase S8 family do | 99.05 | |
| cd07484 | 260 | Peptidases_S8_Thermitase_like Peptidase S8 family | 99.04 | |
| cd04848 | 267 | Peptidases_S8_Autotransporter_serine_protease_like | 99.01 | |
| cd04077 | 255 | Peptidases_S8_PCSK9_ProteinaseK_like Peptidase S8 | 98.98 | |
| cd07494 | 298 | Peptidases_S8_10 Peptidase S8 family domain, uncha | 98.94 | |
| PTZ00262 | 639 | subtilisin-like protease; Provisional | 98.92 | |
| cd07490 | 254 | Peptidases_S8_6 Peptidase S8 family domain, unchar | 98.89 | |
| cd07493 | 261 | Peptidases_S8_9 Peptidase S8 family domain, unchar | 98.84 | |
| KOG1153 | 501 | consensus Subtilisin-related protease/Vacuolar pro | 98.84 | |
| cd07473 | 259 | Peptidases_S8_Subtilisin_like Peptidase S8 family | 98.8 | |
| cd07496 | 285 | Peptidases_S8_13 Peptidase S8 family domain, uncha | 98.79 | |
| cd07483 | 291 | Peptidases_S8_Subtilisin_Novo-like Peptidase S8 fa | 98.76 | |
| cd04857 | 412 | Peptidases_S8_Tripeptidyl_Aminopeptidase_II Peptid | 98.76 | |
| cd07482 | 294 | Peptidases_S8_Lantibiotic_specific_protease Peptid | 98.75 | |
| cd07477 | 229 | Peptidases_S8_Subtilisin_subset Peptidase S8 famil | 98.75 | |
| cd05562 | 275 | Peptidases_S53_like Peptidase domain in the S53 fa | 98.73 | |
| cd07474 | 295 | Peptidases_S8_subtilisin_Vpr-like Peptidase S8 fam | 98.72 | |
| cd05561 | 239 | Peptidases_S8_4 Peptidase S8 family domain, unchar | 98.72 | |
| cd07498 | 242 | Peptidases_S8_15 Peptidase S8 family domain, uncha | 98.72 | |
| cd07491 | 247 | Peptidases_S8_7 Peptidase S8 family domain, unchar | 98.7 | |
| cd04847 | 291 | Peptidases_S8_Subtilisin_like_2 Peptidase S8 famil | 98.68 | |
| cd07492 | 222 | Peptidases_S8_8 Peptidase S8 family domain, unchar | 98.37 | |
| PF00082 | 282 | Peptidase_S8: Subtilase family This is family S8 i | 98.32 | |
| cd00306 | 241 | Peptidases_S8_S53 Peptidase domain in the S8 and S | 98.15 | |
| COG1404 | 508 | AprE Subtilisin-like serine proteases [Posttransla | 97.77 | |
| KOG1114 | 1304 | consensus Tripeptidyl peptidase II [Posttranslatio | 97.73 | |
| KOG4266 | 1033 | consensus Subtilisin kexin isozyme-1/site 1 protea | 97.66 | |
| cd07488 | 247 | Peptidases_S8_2 Peptidase S8 family domain, unchar | 97.41 | |
| KOG3526 | 629 | consensus Subtilisin-like proprotein convertase [P | 87.75 |
| >cd04852 Peptidases_S8_3 Peptidase S8 family domain, uncharacterized subfamily 3 | Back alignment and domain information |
|---|
Probab=99.81 E-value=3.7e-20 Score=138.95 Aligned_cols=84 Identities=39% Similarity=0.500 Sum_probs=71.8
Q ss_pred CCCCCCCCCCccccccCCCCCCCCCcccccCCCCeEEEEecC-------C------------------------------
Q 041208 1 MELLTTRSWDFLGMEKDNIMPPNSLWNKARFGEDVIIGNIDT-------D------------------------------ 43 (89)
Q Consensus 1 ~~l~TTrSw~flgl~~~~~~~~~~~w~~~~~G~gviIgVlDT-------D------------------------------ 43 (89)
|+|||||+|+|||++.-- ...+|.....|+||+|+|||| |
T Consensus 1 ~~~~~~~~~~~~~~~~~~---~~~~~~~~~~G~gv~VaViDtGid~~hp~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 77 (307)
T cd04852 1 YQLHTTRSPDFLGLPGAW---GGSLLGAANAGEGIIIGVLDTGIWPEHPSFADVGGGPYPHTWPGDCVTGEDFNPFSCNN 77 (307)
T ss_pred CCccccCCHHHcCCCCCC---CcccccccCCCCccEEEEEeCCCCCCCcCcccCCCCCCCCCCCCcccCCCCcCccCcCC
Confidence 689999999999998542 122677788999999999999 1
Q ss_pred -----------------------------CCCCCcceeccccCccccccceecccCCceeeecCCCCcEEEEEc
Q 041208 44 -----------------------------FHGHGTHTLSTVGGSFVKNVSAFGNVGDGQRKEGPLKPEWHLIEY 88 (89)
Q Consensus 44 -----------------------------~~GHGTH~a~taaG~~v~~a~~~G~~~~G~a~G~AP~aria~yKv 88 (89)
..|||||||++++|+...+..+.| ...+.+.|+||.|+|++||+
T Consensus 78 ki~g~~~~~~~~~~~~~~~~~~~~~~~~d~~gHGT~VAgiiag~~~~~~~~~~-~~~~~~~GvAP~a~l~~~kv 150 (307)
T cd04852 78 KLIGARYFSDGYDAYGGFNSDGEYRSPRDYDGHGTHTASTAAGNVVVNASVGG-FAFGTASGVAPRARIAVYKV 150 (307)
T ss_pred eEEEEEEcccchhhccCcccccCCCCCccCCCCchhhhhhhcCCCcccccccc-cccccEEEECCCCeEEEEEE
Confidence 147999999999999988877777 77778899999999999997
|
This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values. |
| >cd07497 Peptidases_S8_14 Peptidase S8 family domain, uncharacterized subfamily 14 | Back alignment and domain information |
|---|
| >cd07479 Peptidases_S8_SKI-1_like Peptidase S8 family domain in SKI-1-like proteins | Back alignment and domain information |
|---|
| >cd07478 Peptidases_S8_CspA-like Peptidase S8 family domain in CspA-like proteins | Back alignment and domain information |
|---|
| >cd04059 Peptidases_S8_Protein_convertases_Kexins_Furin-like Peptidase S8 family domain in Protein convertases | Back alignment and domain information |
|---|
| >cd07485 Peptidases_S8_Fervidolysin_like Peptidase S8 family domain in Fervidolysin | Back alignment and domain information |
|---|
| >cd07489 Peptidases_S8_5 Peptidase S8 family domain, uncharacterized subfamily 5 | Back alignment and domain information |
|---|
| >cd04842 Peptidases_S8_Kp43_protease Peptidase S8 family domain in Kp43 proteases | Back alignment and domain information |
|---|
| >cd07480 Peptidases_S8_12 Peptidase S8 family domain, uncharacterized subfamily 12 | Back alignment and domain information |
|---|
| >cd07476 Peptidases_S8_thiazoline_oxidase_subtilisin-like_protease Peptidase S8 family domain in Thiazoline oxidase/subtilisin-like proteases | Back alignment and domain information |
|---|
| >cd07481 Peptidases_S8_BacillopeptidaseF-like Peptidase S8 family domain in BacillopeptidaseF-like proteins | Back alignment and domain information |
|---|
| >cd07487 Peptidases_S8_1 Peptidase S8 family domain, uncharacterized subfamily 1 | Back alignment and domain information |
|---|
| >cd04843 Peptidases_S8_11 Peptidase S8 family domain, uncharacterized subfamily 11 | Back alignment and domain information |
|---|
| >cd07475 Peptidases_S8_C5a_Peptidase Peptidase S8 family domain in Streptococcal C5a peptidases | Back alignment and domain information |
|---|
| >cd07484 Peptidases_S8_Thermitase_like Peptidase S8 family domain in Thermitase-like proteins | Back alignment and domain information |
|---|
| >cd04848 Peptidases_S8_Autotransporter_serine_protease_like Peptidase S8 family domain in Autotransporter serine proteases | Back alignment and domain information |
|---|
| >cd04077 Peptidases_S8_PCSK9_ProteinaseK_like Peptidase S8 family domain in ProteinaseK-like proteins | Back alignment and domain information |
|---|
| >cd07494 Peptidases_S8_10 Peptidase S8 family domain, uncharacterized subfamily 10 | Back alignment and domain information |
|---|
| >PTZ00262 subtilisin-like protease; Provisional | Back alignment and domain information |
|---|
| >cd07490 Peptidases_S8_6 Peptidase S8 family domain, uncharacterized subfamily 6 | Back alignment and domain information |
|---|
| >cd07493 Peptidases_S8_9 Peptidase S8 family domain, uncharacterized subfamily 9 | Back alignment and domain information |
|---|
| >KOG1153 consensus Subtilisin-related protease/Vacuolar protease B [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd07473 Peptidases_S8_Subtilisin_like Peptidase S8 family domain in Subtilisin-like proteins | Back alignment and domain information |
|---|
| >cd07496 Peptidases_S8_13 Peptidase S8 family domain, uncharacterized subfamily 13 | Back alignment and domain information |
|---|
| >cd07483 Peptidases_S8_Subtilisin_Novo-like Peptidase S8 family domain in Subtilisin_Novo-like proteins | Back alignment and domain information |
|---|
| >cd04857 Peptidases_S8_Tripeptidyl_Aminopeptidase_II Peptidase S8 family domain in Tripeptidyl aminopeptidases_II | Back alignment and domain information |
|---|
| >cd07482 Peptidases_S8_Lantibiotic_specific_protease Peptidase S8 family domain in Lantiobiotic (lanthionine-containing antibiotics) specific proteases | Back alignment and domain information |
|---|
| >cd07477 Peptidases_S8_Subtilisin_subset Peptidase S8 family domain in Subtilisin proteins | Back alignment and domain information |
|---|
| >cd05562 Peptidases_S53_like Peptidase domain in the S53 family | Back alignment and domain information |
|---|
| >cd07474 Peptidases_S8_subtilisin_Vpr-like Peptidase S8 family domain in Vpr-like proteins | Back alignment and domain information |
|---|
| >cd05561 Peptidases_S8_4 Peptidase S8 family domain, uncharacterized subfamily 4 | Back alignment and domain information |
|---|
| >cd07498 Peptidases_S8_15 Peptidase S8 family domain, uncharacterized subfamily 15 | Back alignment and domain information |
|---|
| >cd07491 Peptidases_S8_7 Peptidase S8 family domain, uncharacterized subfamily 7 | Back alignment and domain information |
|---|
| >cd04847 Peptidases_S8_Subtilisin_like_2 Peptidase S8 family domain in Subtilisin-like proteins | Back alignment and domain information |
|---|
| >cd07492 Peptidases_S8_8 Peptidase S8 family domain, uncharacterized subfamily 8 | Back alignment and domain information |
|---|
| >PF00082 Peptidase_S8: Subtilase family This is family S8 in the peptidase classification | Back alignment and domain information |
|---|
| >cd00306 Peptidases_S8_S53 Peptidase domain in the S8 and S53 families | Back alignment and domain information |
|---|
| >COG1404 AprE Subtilisin-like serine proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1114 consensus Tripeptidyl peptidase II [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4266 consensus Subtilisin kexin isozyme-1/site 1 protease, subtilase superfamily [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd07488 Peptidases_S8_2 Peptidase S8 family domain, uncharacterized subfamily 2 | Back alignment and domain information |
|---|
| >KOG3526 consensus Subtilisin-like proprotein convertase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 89 | |||
| 3vta_A | 621 | Cucumisin; subtilisin-like fold, serine protease, | 6e-13 | |
| 3i6s_A | 649 | Subtilisin-like protease; PA-domain, FN3-domain, h | 3e-11 | |
| 1xf1_A | 926 | C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St | 1e-05 | |
| 1xf1_A | 926 | C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St | 1e-04 | |
| 4dzt_A | 276 | Aqualysin-1, aqualysin-I; serine protease, calcium | 7e-05 | |
| 3afg_A | 539 | Subtilisin-like serine protease; propeptide, therm | 2e-04 | |
| 2b6n_A | 278 | Proteinase K; S binding, substrate specificity, pr | 2e-04 | |
| 1sh7_A | 284 | Extracellular subtilisin-like serine proteinase; c | 3e-04 | |
| 2pwa_A | 279 | Proteinase K; structure, alanine boronic acid, hyd | 5e-04 | |
| 3f7m_A | 279 | Alkaline serine protease VER112; verticillium psal | 7e-04 |
| >3vta_A Cucumisin; subtilisin-like fold, serine protease, hydrolase; HET: DFP NAG FUC BMA MAN; 2.75A {Cucumis melo} Length = 621 | Back alignment and structure |
|---|
Score = 61.2 bits (148), Expect = 6e-13
Identities = 25/132 (18%), Positives = 37/132 (28%), Gaps = 65/132 (49%)
Query: 5 TTRSWDFLGMEKDNIMPPNSLWNKARFGEDVIIGNIDT-------DFHGHG--------- 48
TTRSWDFLG P ++ +++ ++++G +DT F G
Sbjct: 1 TTRSWDFLGF-------PLTVPRRSQVESNIVVGVLDTGIWPESPSFDDEGFSPPPPKWK 53
Query: 49 ------------------------------------------THTLSTVGGSFVKNVSAF 66
THT ST G V + +
Sbjct: 54 GTCETSNNFRCNRKIIGARSYHIGRPISPGDVNGPRDTNGHGTHTASTAAGGLVSQANLY 113
Query: 67 GNVGDGQRKEGP 78
G R P
Sbjct: 114 GLGLGTARGGVP 125
|
| >3i6s_A Subtilisin-like protease; PA-domain, FN3-domain, hydrolase; HET: NAG FUC; 2.50A {Solanum lycopersicum} PDB: 3i74_A* Length = 649 | Back alignment and structure |
|---|
| >1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Length = 926 | Back alignment and structure |
|---|
| >1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Length = 926 | Back alignment and structure |
|---|
| >4dzt_A Aqualysin-1, aqualysin-I; serine protease, calcium binding, inhibitor, hydrolase-hydro inhibitor complex; HET: PMS; 1.95A {Thermus aquaticus} Length = 276 | Back alignment and structure |
|---|
| >3afg_A Subtilisin-like serine protease; propeptide, thermococcus kodakaraensis, hydrolas protease; 2.00A {Thermococcus kodakarensis} Length = 539 | Back alignment and structure |
|---|
| >2b6n_A Proteinase K; S binding, substrate specificity, proteinase K, subtilase, psychrotrophic, psychrophilic, hydrolase; 1.80A {Serratia SP} Length = 278 | Back alignment and structure |
|---|
| >1sh7_A Extracellular subtilisin-like serine proteinase; cold adaptation, psychrotrophic, subtilisin-like proteinase, depentent, hydrolase; HET: PMS; 1.84A {Vibrio SP} PDB: 1s2n_A* Length = 284 | Back alignment and structure |
|---|
| >2pwa_A Proteinase K; structure, alanine boronic acid, hydrolase; 0.83A {Engyodontium album} SCOP: c.41.1.1 PDB: 1p7v_A 1p7w_A 2dqk_A 2duj_A 2g4v_A 2hd4_A 2hpz_A 2id8_A 2pq2_A 1ic6_A 2pwb_A* 2pyz_A* 2v8b_A 3aj8_A 3aj9_A 3dyb_A* 3gt3_A* 3gt4_A* 3l1k_A 3osz_A ... Length = 279 | Back alignment and structure |
|---|
| >3f7m_A Alkaline serine protease VER112; verticillium psalliotae, cuticle- degrading protease, nematodes, hydrolase, secreted, zymogen; 1.60A {Lecanicillium psalliotae} PDB: 3f7o_A Length = 279 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 89 | |||
| 3vta_A | 621 | Cucumisin; subtilisin-like fold, serine protease, | 99.92 | |
| 3i6s_A | 649 | Subtilisin-like protease; PA-domain, FN3-domain, h | 99.87 | |
| 4h6w_A | 306 | N-terminal cyanobactin protease; hydrolase; 2.45A | 99.4 | |
| 1xf1_A | 926 | C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St | 99.39 | |
| 3afg_A | 539 | Subtilisin-like serine protease; propeptide, therm | 99.37 | |
| 3t41_A | 471 | Epidermin leader peptide processing serine protea; | 99.32 | |
| 3hjr_A | 600 | Extracellular serine protease; kexin, hydrolase; 1 | 99.3 | |
| 2oxa_A | 600 | Extracellular serine protease; kexin, hydrolase; 1 | 99.29 | |
| 2ixt_A | 310 | 36KDA protease; serine protease, sphericase, subti | 99.23 | |
| 4h6x_A | 357 | Thiazoline oxidase/subtilisin-like protease; hydro | 99.21 | |
| 1r0r_E | 274 | Subtilisin carlsberg; high resolution, serine prot | 99.2 | |
| 2z30_A | 320 | TK-subtilisin; thermococcus kodakaraensis, hydrola | 99.19 | |
| 1dbi_A | 280 | AK.1 serine protease; hydrolase; 1.80A {Bacillus S | 99.19 | |
| 1gci_A | 269 | Subtilisin; hydrolase, serine protease; 0.78A {Bac | 99.19 | |
| 1to2_E | 281 | Subtilisin BPN'; serine protease, hydrolase; HET: | 99.19 | |
| 4dzt_A | 276 | Aqualysin-1, aqualysin-I; serine protease, calcium | 99.18 | |
| 2x8j_A | 327 | Intracellular subtilisin protease; hydrolase, seri | 99.18 | |
| 1sh7_A | 284 | Extracellular subtilisin-like serine proteinase; c | 99.17 | |
| 2b6n_A | 278 | Proteinase K; S binding, substrate specificity, pr | 99.17 | |
| 3f7m_A | 279 | Alkaline serine protease VER112; verticillium psal | 99.16 | |
| 2z2z_A | 395 | TK-subtilisin precursor; thermococcus kodakaraensi | 99.16 | |
| 3zxy_A | 282 | Subtilisin-like protein; hydrolase; 1.58A {Prochlo | 99.15 | |
| 1thm_A | 279 | Thermitase; hydrolase(serine protease); 1.37A {The | 99.14 | |
| 2id4_A | 503 | Kexin; KEX2, kexin, furin, proprotein, prohormone, | 99.1 | |
| 1p8j_A | 471 | Furin precursor; prohormone convertase, SPC1, PACE | 99.1 | |
| 2pwa_A | 279 | Proteinase K; structure, alanine boronic acid, hyd | 99.06 | |
| 2iy9_A | 347 | SUBA; toxin, shiga, plasmid; 1.8A {Escherichia col | 99.04 | |
| 1y9z_A | 441 | Alkaline serine protease; subtilisin-like alpha/be | 99.02 | |
| 1wmd_A | 434 | Protease; alpha-beta hydrolase fold, jelly-roll be | 99.01 | |
| 2p4e_P | 692 | Proprotein convertase subtilisin/kexin type 9; pro | 99.01 | |
| 3lpc_A | 340 | APRB2; protease, subtilase, virulence factor, hydr | 99.0 | |
| 1r6v_A | 671 | Subtilisin-like serine protease; sandwich domain, | 98.99 | |
| 2qtw_B | 546 | Proprotein convertase subtilisin/kexin type 9; cor | 98.92 | |
| 3lxu_X | 1354 | Tripeptidyl-peptidase 2; spindle complex, aminopep | 98.46 |
| >3vta_A Cucumisin; subtilisin-like fold, serine protease, hydrolase; HET: DFP NAG FUC BMA MAN; 2.75A {Cucumis melo} | Back alignment and structure |
|---|
Probab=99.92 E-value=7.2e-27 Score=189.54 Aligned_cols=76 Identities=36% Similarity=0.651 Sum_probs=71.2
Q ss_pred CCCCCCccccccCCCCCCCCCcccccCCCCeEEEEecC------------------------------------------
Q 041208 5 TTRSWDFLGMEKDNIMPPNSLWNKARFGEDVIIGNIDT------------------------------------------ 42 (89)
Q Consensus 5 TTrSw~flgl~~~~~~~~~~~w~~~~~G~gviIgVlDT------------------------------------------ 42 (89)
||||||||||+. .+|.++..|+|||||||||
T Consensus 1 tt~s~~flGl~~-------~~~~~~~~G~gViVgViDTGId~~Hp~f~d~g~~~~~~~w~g~~~~~~~~~~n~k~ig~~~ 73 (621)
T 3vta_A 1 TTRSWDFLGFPL-------TVPRRSQVESNIVVGVLDTGIWPESPSFDDEGFSPPPPKWKGTCETSNNFRCNRKIIGARS 73 (621)
T ss_dssp CCSHHHHTTCCT-------TCCCCHHHHTTCEEEEEESCBCTTSGGGCCTTCCCCCTTCCCCBCCSSSCCCCSSEEEEEE
T ss_pred CCCChhHcCCCc-------cccccCCCCCCCEEEEEecCCCCCChhhcCCCCCCcccccccccccCCCcccCcceeeeee
Confidence 899999999983 5788888999999999999
Q ss_pred ----------------CCCCCCcceeccccCccccccceecccCCceeeecCCCCcEEEEEc
Q 041208 43 ----------------DFHGHGTHTLSTVGGSFVKNVSAFGNVGDGQRKEGPLKPEWHLIEY 88 (89)
Q Consensus 43 ----------------D~~GHGTH~a~taaG~~v~~a~~~G~~~~G~a~G~AP~aria~yKv 88 (89)
|++|||||||||+||+.+.+++++| ++.|+++|+||+|+|++|||
T Consensus 74 ~~~~~~~~~~~~~~p~D~~GHGTHvAgi~AG~~~~~~~~~g-~~~g~~~GvAP~A~l~~~kv 134 (621)
T 3vta_A 74 YHIGRPISPGDVNGPRDTNGHGTHTASTAAGGLVSQANLYG-LGLGTARGGVPLARIAAYKV 134 (621)
T ss_dssp CCCSSSCCTTCCSSSBCSSSHHHHHHHHHHCCCEEEEEETT-EEEEEECCSCTTSEEEEEEC
T ss_pred cccCCccCCCCCCCCCCCCcCHHHHHHHHhCcCCCCccccc-cccccEEEECCCCEEEEEEe
Confidence 5679999999999999999999999 89999999999999999997
|
| >3i6s_A Subtilisin-like protease; PA-domain, FN3-domain, hydrolase; HET: NAG FUC; 2.50A {Solanum lycopersicum} PDB: 3i74_A* | Back alignment and structure |
|---|
| >4h6w_A N-terminal cyanobactin protease; hydrolase; 2.45A {Planktothrix agardhii nies-596} | Back alignment and structure |
|---|
| >1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* | Back alignment and structure |
|---|
| >3afg_A Subtilisin-like serine protease; propeptide, thermococcus kodakaraensis, hydrolas protease; 2.00A {Thermococcus kodakarensis} | Back alignment and structure |
|---|
| >3t41_A Epidermin leader peptide processing serine protea; structural genomics, center for structural genomics of infec diseases, csgid; 1.95A {Staphylococcus aureus} PDB: 3qfh_A | Back alignment and structure |
|---|
| >3hjr_A Extracellular serine protease; kexin, hydrolase; 1.65A {Aeromonas sobria} | Back alignment and structure |
|---|
| >2ixt_A 36KDA protease; serine protease, sphericase, subtilisin like protease, hydrolase; 0.8A {Bacillus sphaericus} SCOP: c.41.1.1 PDB: 3d43_A 1ea7_A* 2gko_A* | Back alignment and structure |
|---|
| >4h6x_A Thiazoline oxidase/subtilisin-like protease; hydrolase; 2.00A {Prochloron didemni} PDB: 4aks_A 4akt_A | Back alignment and structure |
|---|
| >1r0r_E Subtilisin carlsberg; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Bacillus licheniformis} SCOP: c.41.1.1 PDB: 1af4_A* 1be8_A* 1bfk_A 1bfu_A 1be6_A 1oyv_A 1cse_E 1sbc_A 1sca_A 1scb_A 1scd_A 2sec_E 2wuv_A 2wuw_E 1yu6_A 1scn_E* 1c3l_A 1avt_A* 1av7_A* 1sel_A ... | Back alignment and structure |
|---|
| >2z30_A TK-subtilisin; thermococcus kodakaraensis, hydrolase; 1.65A {Thermococcus kodakarensis} PDB: 3a3o_A 3a3n_A 2zrq_A 2z57_A 2z56_A 2z58_A 3a3p_A 2z2x_A* 2z2y_A | Back alignment and structure |
|---|
| >1dbi_A AK.1 serine protease; hydrolase; 1.80A {Bacillus SP} SCOP: c.41.1.1 | Back alignment and structure |
|---|
| >1gci_A Subtilisin; hydrolase, serine protease; 0.78A {Bacillus lentus} SCOP: c.41.1.1 PDB: 1jea_A 1ndq_A 1svn_A 1tk2_A* 3bx1_A 1ah2_A 1iav_A* 1c9m_A* 1wsd_A 1mpt_A 1ndu_A 1c9j_A 1q5p_A* 1st3_A 1c9n_A* | Back alignment and structure |
|---|
| >1to2_E Subtilisin BPN'; serine protease, hydrolase; HET: CIT 15P; 1.30A {Bacillus amyloliquefaciens} SCOP: c.41.1.1 PDB: 1tm1_E* 1tm3_E* 1tm4_E* 1lw6_E* 1tm7_E* 1tmg_E* 1to1_E* 1tm5_E* 1y1k_E* 1y33_E* 1y34_E* 1y3b_E* 1y3c_E* 1y3d_E* 1y3f_E* 1y48_E* 1y4a_E* 1y4d_E 1sup_A* 1sib_E ... | Back alignment and structure |
|---|
| >4dzt_A Aqualysin-1, aqualysin-I; serine protease, calcium binding, inhibitor, hydrolase-hydro inhibitor complex; HET: PMS; 1.95A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2x8j_A Intracellular subtilisin protease; hydrolase, serine protease, intracellular proteinase regulat; HET: CSX 1PE; 1.56A {Bacillus clausii} PDB: 2wv7_A 2wwt_A 2xrm_A* | Back alignment and structure |
|---|
| >1sh7_A Extracellular subtilisin-like serine proteinase; cold adaptation, psychrotrophic, subtilisin-like proteinase, depentent, hydrolase; HET: PMS; 1.84A {Vibrio SP} PDB: 1s2n_A* | Back alignment and structure |
|---|
| >2b6n_A Proteinase K; S binding, substrate specificity, proteinase K, subtilase, psychrotrophic, psychrophilic, hydrolase; 1.80A {Serratia SP} | Back alignment and structure |
|---|
| >3f7m_A Alkaline serine protease VER112; verticillium psalliotae, cuticle- degrading protease, nematodes, hydrolase, secreted, zymogen; 1.60A {Lecanicillium psalliotae} SCOP: c.41.1.1 PDB: 3f7o_A | Back alignment and structure |
|---|
| >2z2z_A TK-subtilisin precursor; thermococcus kodakaraensis, hydrolase; 1.87A {Thermococcus kodakarensis} PDB: 2e1p_A 2zwp_A 2zwo_A | Back alignment and structure |
|---|
| >3zxy_A Subtilisin-like protein; hydrolase; 1.58A {Prochloron didemni} PDB: 3zxx_A | Back alignment and structure |
|---|
| >1thm_A Thermitase; hydrolase(serine protease); 1.37A {Thermoactinomyces vulgaris} SCOP: c.41.1.1 PDB: 2tec_E 1tec_E 3tec_E | Back alignment and structure |
|---|
| >2id4_A Kexin; KEX2, kexin, furin, proprotein, prohormone, convertase, SUBT like protease, serine protease; HET: NDG; 1.90A {Saccharomyces cerevisiae} SCOP: b.18.1.20 c.41.1.1 PDB: 1r64_A* 1ot5_A* | Back alignment and structure |
|---|
| >1p8j_A Furin precursor; prohormone convertase, SPC1, PACE, P-domain; HET: DKA AR7 NAG FUL BMA MAN GAL FUC; 2.60A {Mus musculus} SCOP: b.18.1.20 c.41.1.1 | Back alignment and structure |
|---|
| >2pwa_A Proteinase K; structure, alanine boronic acid, hydrolase; 0.83A {Engyodontium album} SCOP: c.41.1.1 PDB: 1p7v_A 1p7w_A 2dqk_A 2duj_A 2g4v_A 2hd4_A 2hpz_A 2id8_A 2pq2_A 1ic6_A 2pwb_A* 2pyz_A* 2v8b_A 3aj8_A 3aj9_A 3dyb_A* 3gt3_A* 3gt4_A* 3l1k_A 3osz_A ... | Back alignment and structure |
|---|
| >2iy9_A SUBA; toxin, shiga, plasmid; 1.8A {Escherichia coli} | Back alignment and structure |
|---|
| >1y9z_A Alkaline serine protease; subtilisin-like alpha/beta domain, insert beta barrel domain hydrolase; HET: PMS; 1.40A {Pseudoalteromonas SP} PDB: 1v6c_A* 1wvm_A* | Back alignment and structure |
|---|
| >1wmd_A Protease; alpha-beta hydrolase fold, jelly-roll beta-barrel, hydrolase; 1.30A {Bacillus SP} SCOP: b.18.1.20 c.41.1.1 PDB: 1wme_A 1wmf_A | Back alignment and structure |
|---|
| >2p4e_P Proprotein convertase subtilisin/kexin type 9; protease, LDL receptor, LDL, endocytosis, hydrol; 1.98A {Homo sapiens} | Back alignment and structure |
|---|
| >3lpc_A APRB2; protease, subtilase, virulence factor, hydrolase; 1.70A {Dichelobacter nodosus} PDB: 3lpa_A 3lpd_A 3ti9_A 3ti7_A | Back alignment and structure |
|---|
| >1r6v_A Subtilisin-like serine protease; sandwich domain, propeptide, hydrolase; 1.70A {Fervidobacterium pennivorans} SCOP: c.41.1.1 | Back alignment and structure |
|---|
| >2qtw_B Proprotein convertase subtilisin/kexin type 9; coronary heart disease, hypercholest low density lipoprotein receptor, autocatalytic cleavage; HET: NAG; 1.90A {Homo sapiens} PDB: 3m0c_B 3bps_A 3gcw_A 3gcx_A 3p5b_A 3p5c_A 2pmw_B 3h42_B 2w2n_A 2w2m_A 2w2p_A 2w2q_A 2xtj_A 2w2o_A | Back alignment and structure |
|---|
| >3lxu_X Tripeptidyl-peptidase 2; spindle complex, aminopeptidase, hydrolase, phosphoprotein, protease; 3.14A {Drosophila melanogaster} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 89 | |||
| d2ixta1 | 309 | Sphericase {Bacillus sphaericus [TaxId: 1421]} | 99.31 | |
| d1dbia_ | 280 | Thermostable serine protease {Bacillus sp., AK.1 [ | 99.25 | |
| d1v6ca_ | 435 | Alkaline serine protease Apa1 {Pseudoalteromonas s | 99.2 | |
| d2pwaa1 | 279 | Proteinase K {Fungus (Tritirachium album), strain | 99.19 | |
| d1thma_ | 279 | Thermitase {Thermoactinomyces vulgaris [TaxId: 202 | 99.18 | |
| d1r0re_ | 274 | Subtilisin {Bacillus subtilis, carlsberg [TaxId: 1 | 99.17 | |
| d1to2e_ | 281 | Subtilisin {Bacillus amyloliquefaciens, Novo/BPN' | 99.14 | |
| d1gcia_ | 269 | Subtilisin {Bacillus lentus [TaxId: 1467]} | 99.13 | |
| d1p8ja2 | 334 | Furin, N-terminal domain {Mouse (Mus musculus) [Ta | 99.1 | |
| d1r6va_ | 671 | Fervidolysin {Fervidobacterium pennivorans [TaxId: | 99.07 | |
| d1wmda2 | 318 | Alkaline serine protease kp-43, N-terminal domain | 99.06 | |
| d2id4a2 | 339 | Kexin, N-terminal domain {Baker's yeast (Saccharom | 98.95 | |
| d1t1ga_ | 357 | Serine-carboxyl proteinase, SCP {Bacillus novosp. | 98.36 | |
| d1ga6a_ | 369 | Serine-carboxyl proteinase, SCP {Pseudomonas sp., | 97.18 |
| >d2ixta1 c.41.1.1 (A:1-309) Sphericase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Subtilisin-like superfamily: Subtilisin-like family: Subtilases domain: Sphericase species: Bacillus sphaericus [TaxId: 1421]
Probab=99.31 E-value=2.6e-13 Score=96.40 Aligned_cols=58 Identities=21% Similarity=0.176 Sum_probs=48.4
Q ss_pred CCCcccccCCCCeEEEEecC-------------------------------CCCCCCcceeccccCccccccceecccCC
Q 041208 23 NSLWNKARFGEDVIIGNIDT-------------------------------DFHGHGTHTLSTVGGSFVKNVSAFGNVGD 71 (89)
Q Consensus 23 ~~~w~~~~~G~gviIgVlDT-------------------------------D~~GHGTH~a~taaG~~v~~a~~~G~~~~ 71 (89)
+.+|.....|+||+|+|||| |.+|||||||++++|....+ .
T Consensus 16 ~~aw~~~~~G~gv~V~ViDsGv~~~Hp~~~~~~~~~~~~~~~~~~~~~~~~d~~gHGT~VAgiiaa~~~~~--------~ 87 (309)
T d2ixta1 16 NDTLTSTTGGSGINIAVLDTGVNTSHPDLVNNVEQCKDFTGATTPINNSCTDRNGHGTHVAGTALADGGSD--------Q 87 (309)
T ss_dssp CTTCCCCCCCTTCEEEEEESCCCTTCTTTTTTEEEEEESSSSSSCEETCCCCSSSHHHHHHHHHHCBCCTT--------S
T ss_pred hhhhccCCCCCCeEEEEEccCCCCCChhHhccccccccccCCCCCCCCCcccccccccccccccccccccc--------c
Confidence 57899888999999999999 67889999999999875322 2
Q ss_pred ceeeecCCCCcEEEEEc
Q 041208 72 GQRKEGPLKPEWHLIEY 88 (89)
Q Consensus 72 G~a~G~AP~aria~yKv 88 (89)
....|+||.|+|..+|+
T Consensus 88 ~~~~GvAp~a~l~~~~~ 104 (309)
T d2ixta1 88 AGIYGVAPDADLWAYKV 104 (309)
T ss_dssp CSCBCSCTTSEEEEEEC
T ss_pred hhhhhhhhhccceeeee
Confidence 22478999999999986
|
| >d1dbia_ c.41.1.1 (A:) Thermostable serine protease {Bacillus sp., AK.1 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1v6ca_ c.41.1.1 (A:) Alkaline serine protease Apa1 {Pseudoalteromonas sp. AS-11 [TaxId: 247492]} | Back information, alignment and structure |
|---|
| >d2pwaa1 c.41.1.1 (A:1-279) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]} | Back information, alignment and structure |
|---|
| >d1thma_ c.41.1.1 (A:) Thermitase {Thermoactinomyces vulgaris [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1r0re_ c.41.1.1 (E:) Subtilisin {Bacillus subtilis, carlsberg [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1to2e_ c.41.1.1 (E:) Subtilisin {Bacillus amyloliquefaciens, Novo/BPN' [TaxId: 1390]} | Back information, alignment and structure |
|---|
| >d1gcia_ c.41.1.1 (A:) Subtilisin {Bacillus lentus [TaxId: 1467]} | Back information, alignment and structure |
|---|
| >d1p8ja2 c.41.1.1 (A:109-442) Furin, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r6va_ c.41.1.1 (A:) Fervidolysin {Fervidobacterium pennivorans [TaxId: 93466]} | Back information, alignment and structure |
|---|
| >d1wmda2 c.41.1.1 (A:1-318) Alkaline serine protease kp-43, N-terminal domain {Bacillus sp. KSM-KP43 [TaxId: 109322]} | Back information, alignment and structure |
|---|
| >d2id4a2 c.41.1.1 (A:122-460) Kexin, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t1ga_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Bacillus novosp. MN-32, kumamolisin [TaxId: 198803]} | Back information, alignment and structure |
|---|
| >d1ga6a_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Pseudomonas sp., sedolisin [TaxId: 306]} | Back information, alignment and structure |
|---|