Citrus Sinensis ID: 041246

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------

MDFPKKTVSRENDENLGGSELSDDNKNEEMGQRRPGTLNLNLNNPPDERHSKLGFQSGANFPEEQTENEEKDYAVHCVEAYFKGMETLSDEESEEGSGSSSKRKRYSTEEKGEAKIENESSPTEIIFDIEDDLALLNLTTLSLVATNEESDSNLQKEGTQMNEFQRAREWRERRLAHPQEDDSFNKGNKKGVLKEAEDESQDFGGGPFYEAMVMIKKRNLVQELKWMPAKNKVEVRQCGVPSLMDLSLKILARNAEAIVSLELVPDFLRHKLSQIVRKKRKMNARFLELLASGSPTEIRLNDCSEINTDDFTRIFGACDKKNLIVLQLDLCGRILTENVIINTIVTQNFSLPALTTISLTGAYQLTDFGLSKLARSASALQSVNLSQCSLLTNEGINLLVKHLKSTLRVLYIDHCQNIDAVSMLPALRKLNCLEVLSVAGIETVDDYFVTEIVRAHCLNMRQLVLANCGQLTDRALKFVGKKCSRLCALDLSHLDNLTDATVQYLADGCRSICSLKLCRNNFSDEALAAFLEVSGDSLTELSLNHVRGVGLNTALSLAKCSRNLLSLDLSWCRFIKDEALGFIVDNCSLLRLLKLFGCSQITNVFLNGHSNSMVQIIGLPLTPALKHIQVLEPQHTP

ccccccccccHHHHcccccccccccccHHHccccccccccccccccccccccccccccccccHHHHHHHccccccccHHccccccccccccccccccccccccccccHHHHHcccccccccccccccccHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHcHHHHHHHHHHcccccccEEEccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccHHHHHHHHcccccEEEEcccccccHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHccccccEEEccccccccHHHHHHHHcccccccEEEccccccccHHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEcccccccHHHHHHHHHHccccccEEEccccccccHHHHHHHHcccccccEEEccccccccHHHHHHHHHccccccEEEEEccccccHHHHHHHHHcccEEEEccccccccccccccccccc

cccccccEcccccccccccccccccccHHcccccccEEEEccccccHHcHHHccccccccccHHEEccccccccEEEEEHHccccccccccccccccccccccEEEccccccccEEccccccEEEEEEcccccccccccHHHHHHccccccccccccccccccHHHHHHHHHHHHHccHHHcHHHcccccccccccHHcccccccccHHHHHHHHHHHHHHHHHHHcccccEEEccccccccccHHHHHHHHHHcHcHcccccccHHHHHHHHHHHHccccccHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccccEEEcccccccccHHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccHcEEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHcccccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEccccHHccHHHHHHHHHccccccEEEcHHHHHHHccccccccc

mdfpkktvsrendenlggselsddnkneemgqrrpgtlnlnlnnppderhsklgfqsganfpeeqteneeKDYAVHCVEAYFKGmetlsdeeseegsgssskrkrysteekgeakienesspteiiFDIEDDLALLNLTTLSLvatneesdsnlqkeGTQMNEFQRAREWRERrlahpqeddsfnkgnkkgvlkeaedesqdfgggpFYEAMVMIKKRNLVQELkwmpaknkvevrqcgvpslMDLSLKILARNAEAIVSLELVPDFLRHKLSQIVRKKRKMNARFLELLasgspteirlndcseintddftrifgacdkknLIVLQLDLCGRILTENVIINTIVtqnfslpalttisltgayqltdfGLSKLARSASALQSVNLSQCSLLTNEGINLLVKHLKSTLRVLYIDHCQNIDAVSMLPALRKLNCLEVLsvagietvddYFVTEIVRAHCLNMRQLVLANCGQLTDRALKFVGKKCSRLcaldlshldnltDATVQYLADGCRSICSLKLCRNNFSDEALAAFLEVSGDSLTELSLNHVRGVGLNTALSLAKCSRNLLSLDLSWCRFIKDEALGFIVDNCSLLRLLKLFGCSQITNVFLNGHSNSMVQIIglpltpalkhiqvlepqhtp

mdfpkktvsrendenlggselsddnkneemgqrrpgtlnlnlnnpPDERHSKLGFQSGANFPEEQTENEEKDYAVHCVEAYFKGmetlsdeeseegsgssskrkrysteekgeakienesspteIIFDIEDDLALLNLTTLSLVATneesdsnlqkegtqmnEFQRAREWRERRlahpqeddsfnkgnkkgvlkeaedesqdfggGPFYEAMVMIKKRNLVQELKWMPAKNKVEVRQCGVPSLMDLSLKILARNAEAIVSLELVPDFLRHKLSQIVRKKRKMNARFLELlasgspteirlndcSEINTDDFTRIFGACDKKNLIVLQLDLCGRILTENVIINTIVTQNFSLPALTTISLTGAYQLTDFGLSKLARSASALQSVNLSQCSLLTNEGINLLVKHLKSTLRVLYIDHCQNIDAVSMLPALRKLNCLEVLSVAGIETVDDYFVTEIVRAHCLNMRQLVLANCGQLTDRALKFVGKKCSRLCALDLSHLDNLTDATVQYLADGCRSICSLKLCRNNFSDEALAAFLEVSGDSLTELSLNHVRGVGLNTALSLAKCSRNLLSLDLSWCRFIKDEALGFIVDNCSLLRLLKLFGCSQITNVFLNGHSNSMVQIIGLPLTPALKHIQVLEPQHTP

MDFPKKTVSRENDENLGGSELSDDNKNEEMGQRRPGTlnlnlnnPPDERHSKLGFQSGANFPEEQTENEEKDYAVHCVEAYFKGMETLSDeeseegsgsssKRKRYSTEEKGEAKIENESSPTEIIFDIEDDlallnlttlslvatnEESDSNLQKEGTQMNEFQRAREWRERRLAHPQEDDSFNKGNKKGVLKEAEDESQDFGGGPFYEAMVMIKKRNLVQELKWMPAKNKVEVRQCGVPSLMDLSLKILARNAEAIVSLELVPDFLRHKLSQIVRKKRKMNARFLELLASGSPTEIRLNDCSEINTDDFTRIFGACDKKNLIVLQLDLCGRILTENVIINTIVTQNFSLPALTTISLTGAYQLTDFGLSKLARSASALQSVNLSQCSLLTNEGINLLVKHLKSTLRVLYIDHCQNIDAVSMLPALRKLNCLEVLSVAGIETVDDYFVTEIVRAHCLNMRQLVLANCGQLTDRALKFVGKKCSRLCALDLSHLDNLTDATVQYLADGCRSICSLKLCRNNFSDEALAAFLEVSGDSLTELSLNHVRGVGLNTALSLAKCSRNLLSLDLSWCRFIKDEALGFIVDNCSLLRLLKLFGCSQITNVFLNGHSNSMVQIIGLPLTPALKHIQVLEPQHTP

************************************************************************YAVHCVEAYFKG***************************************EIIFDIEDDLALLNLTTLSLVA***********************************************************GGPFYEAMVMIKKRNLVQELKWMPAKNKVEVRQCGVPSLMDLSLKILARNAEAIVSLELVPDFLRHKLSQIVRKKRKMNARFLELLASGSPTEIRLNDCSEINTDDFTRIFGACDKKNLIVLQLDLCGRILTENVIINTIVTQNFSLPALTTISLTGAYQLTDFGLSKLARSASALQSVNLSQCSLLTNEGINLLVKHLKSTLRVLYIDHCQNIDAVSMLPALRKLNCLEVLSVAGIETVDDYFVTEIVRAHCLNMRQLVLANCGQLTDRALKFVGKKCSRLCALDLSHLDNLTDATVQYLADGCRSICSLKLCRNNFSDEALAAFLEVSGDSLTELSLNHVRGVGLNTALSLAKCSRNLLSLDLSWCRFIKDEALGFIVDNCSLLRLLKLFGCSQITNVFLNGHSNSMVQIIGLPLTPALKHIQV*******

*****************************************************************************************************************************************************************************RLAHPQE*******************SQDFGGGPFYEAMVMIKKRNLVQELKWMPAKNKVEVRQCGVPSLMDLSLKILARNAEAIVSLELVPDFLRHKLSQIVRKKRKMNARFLELLASGSPTEIRLNDCSEINTDDFTRIFGACDKKNLIVLQLDLCGRILTENVIINTIVTQNFSLPALTTISLTGAYQLTDFGLSKLARSASALQSVNLSQCSLLTNEGINLLVKHLKSTLRVLYIDHCQNIDAVSMLPALRKLNCLEVLSVAGIETVDDYFVTEIVRAHCLNMRQLVLANCGQLTDRALKFVGKKCSRLCALDLSHLDNLTDATVQYLADGCRSICSLKLCRNNFSDEALAAFLEVSGDSLTELSLNHVRGVGLNTALSLAKCSRNLLSLDLSWCRFIKDEALGFIVDNCSLLRLLKLFGCSQITNVFLNGHSNSMVQIIGLPLTPALKHIQVLEPQHTP

****************GGSELSDDNKNEEMGQRRPGTLNLNLNNPPDERHSKLGFQSGAN**********KDYAVHCVEAYFKGMET*********************************SPTEIIFDIEDDLALLNLTTLSLVATNEESDSNLQKEGTQMNEFQRAREWRERRLAHPQEDDSFNKGNKKG*********QDFGGGPFYEAMVMIKKRNLVQELKWMPAKNKVEVRQCGVPSLMDLSLKILARNAEAIVSLELVPDFLRHKLSQIVRKKRKMNARFLELLASGSPTEIRLNDCSEINTDDFTRIFGACDKKNLIVLQLDLCGRILTENVIINTIVTQNFSLPALTTISLTGAYQLTDFGLSKLARSASALQSVNLSQCSLLTNEGINLLVKHLKSTLRVLYIDHCQNIDAVSMLPALRKLNCLEVLSVAGIETVDDYFVTEIVRAHCLNMRQLVLANCGQLTDRALKFVGKKCSRLCALDLSHLDNLTDATVQYLADGCRSICSLKLCRNNFSDEALAAFLEVSGDSLTELSLNHVRGVGLNTALSLAKCSRNLLSLDLSWCRFIKDEALGFIVDNCSLLRLLKLFGCSQITNVFLNGHSNSMVQIIGLPLTPALKHIQVLEPQHTP

********************L*********GQRRPGTLNLNLNNPPDERHSKLGFQSGANFPEEQTENEEKDYAVHCVEAYFKGME*****************KRY****KGEAKIENESSPTEIIFDIEDDLALLNLT***LV*T**************MNEFQRAREWRERRLAHPQEDDSFNK*****VLKEAEDESQDFGGGPFYEAMVMIKKRNLVQELKWMPAKNKVEVRQCGVPSLMDLSLKILARNAEAIVSLELVPDFLRHKLSQIVRKKRKMNARFLELLASGSPTEIRLNDCSEINTDDFTRIFGACDKKNLIVLQLDLCGRILTENVIINTIVTQNFSLPALTTISLTGAYQLTDFGLSKLARSASALQSVNLSQCSLLTNEGINLLVKHLKSTLRVLYIDHCQNIDAVSMLPALRKLNCLEVLSVAGIETVDDYFVTEIVRAHCLNMRQLVLANCGQLTDRALKFVGKKCSRLCALDLSHLDNLTDATVQYLADGCRSICSLKLCRNNFSDEALAAFLEVSGDSLTELSLNHVRGVGLNTALSLAKCSRNLLSLDLSWCRFIKDEALGFIVDNCSLLRLLKLFGCSQITNVFLNGHSNSMVQIIGLPLTPALKHIQVLE*****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		637	2.2.26 [Sep-21-2011]
O74999		563	DNA repair protein rhp7 O	yes	no	0.485	0.548	0.284	3e-20
Q8N1E6		418	F-box/LRR-repeat protein	yes	no	0.383	0.583	0.282	2e-13
C8V4D4		585	SCF E3 ubiquitin ligase c	no	no	0.397	0.432	0.281	4e-13
Q8BID8		400	F-box/LRR-repeat protein	yes	no	0.383	0.61	0.282	5e-13
Q17R01		400	F-box/LRR-repeat protein	yes	no	0.383	0.61	0.282	5e-13
Q5BJ29		491	F-box/LRR-repeat protein	no	no	0.568	0.737	0.235	2e-11
Q8BH16		423	F-box/LRR-repeat protein	no	no	0.386	0.581	0.269	3e-11
Q5R3Z8		423	F-box/LRR-repeat protein	yes	no	0.386	0.581	0.273	4e-11
Q9UF56		701	F-box/LRR-repeat protein	no	no	0.405	0.368	0.228	5e-11
Q9UKC9		423	F-box/LRR-repeat protein	no	no	0.386	0.581	0.273	5e-11

>sp\|O74999\|RAD7_SCHPO DNA repair protein rhp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp7 PE=3 SV=1	Back alignment and function desciption

 Score =  100 bits (249), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 101/355 (28%), Positives = 162/355 (45%), Gaps = 46/355 (12%)

Query: 240 VPSLMDLSLKILARNAEAIVSLELVPDFLRHKLSQIVRKKRKMNARFLELLASGSPTEIR 299
           VP L DL ++++A     I +   +      K+SQI+ K R +N   ++L  SG  TE++
Sbjct: 188 VPKLQDLCIRVIAEYINDIEAFGDIGQVNMDKISQIISKNRSLNDTTVKLFLSGGQTELK 247

Query: 300 LNDCSEINTDDFTRIFGACDKKNLIVLQLDLCGRILTENVIINTIVTQNFSLPALTTISL 359
           L DCS+I  D   +I   C   NL  L L  CG++  ++ +++        L  LT +S 
Sbjct: 248 LYDCSKITADSLFQIAQYC--PNLQTLHLTYCGQM--QDQVLHFYADH---LTELTDVSF 300

Query: 360 TGAYQLTDF-GLSKLARSASALQSVNLSQCSLLTNEGINLLVKHLKSTL-----RVLYID 413
            GA+ ++    ++   +  S L S+ L+  + +    IN +V    + +     R+ Y+D
Sbjct: 301 QGAFLVSSSEWINFFKKRGSKLISLELTDTARIHVSVINAIVDCCPNLISLNLSRIFYLD 360

Query: 414 HCQNIDAVSMLPALRKLNCLEVLSVAGIETVDDYFVTEIVRAHCLNMRQLVLANCGQLTD 473
                + V +L   R L  L++ S  GI  ++D  + +++      +  L L+ C +LTD
Sbjct: 361 D----ECVRLLAGCRNLVSLKIESPGGI--INDGSILDVLNQIGSGLHTLSLSGCTKLTD 414

Query: 474 RALK-FVGKKCSRLCALDLSHLDNLTDATVQYLADGCRSICSLKLCRNNFSDEALAAFLE 532
             LK  +G  C RL  L+LS L+ LTD                        DEA   F E
Sbjct: 415 EVLKQGIGPCCGRLKHLNLSGLELLTD------------------------DEASIVFGE 450

Query: 533 VSGDS-LTELSLNHVRGVGLNTALS-LAKCSRNLLSLDLSWCRFIKDEALGFIVD 585
               S L  LSL     +G  T  + L      L +LDL+   F+ DEAL +IV+
Sbjct: 451 WKIQSGLETLSLRRCLSLGDKTVRAVLVNSGHTLRTLDLNGMSFVTDEALQYIVN 505

Involved in global genome repair (GGR) via nucleotide excision repair (NER), in conjunction with rhp16, after UV irradiation.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)

>sp\|Q8N1E6\|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1	Back alignment and function description

>sp\|C8V4D4\|GRRA_EMENI SCF E3 ubiquitin ligase complex F-box protein grrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=grrA PE=2 SV=1	Back alignment and function description

>sp\|Q8BID8\|FXL14_MOUSE F-box/LRR-repeat protein 14 OS=Mus musculus GN=Fbxl14 PE=2 SV=1	Back alignment and function description

>sp\|Q17R01\|FXL14_BOVIN F-box/LRR-repeat protein 14 OS=Bos taurus GN=FBXL14 PE=2 SV=1	Back alignment and function description

>sp\|Q5BJ29\|FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl7 PE=1 SV=1	Back alignment and function description

>sp\|Q8BH16\|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1	Back alignment and function description

>sp\|Q5R3Z8\|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1	Back alignment and function description

>sp\|Q9UF56\|FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens GN=FBXL17 PE=2 SV=3	Back alignment and function description

>sp\|Q9UKC9\|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		637
343887331		655	DNA excision repair protein [Citrus unsh	1.0	0.972	0.949	0.0
255550179		694	rad7, putative [Ricinus communis] gi\|223	0.762	0.700	0.551	1e-142
296081719		957	unnamed protein product [Vitis vinifera]	0.720	0.479	0.548	1e-138
359475976		787	PREDICTED: uncharacterized protein LOC10	0.720	0.583	0.510	1e-133
297738570		832	unnamed protein product [Vitis vinifera]	0.891	0.682	0.456	1e-129
225444746		905	PREDICTED: uncharacterized protein LOC10	0.711	0.500	0.508	1e-123
356565796		675	PREDICTED: DNA repair protein rhp7-like	0.744	0.702	0.489	1e-119
356556384		541	PREDICTED: uncharacterized F-box/LRR-rep	0.686	0.807	0.515	1e-118
255550465		765	rad7, putative [Ricinus communis] gi\|223	0.800	0.666	0.452	1e-115
449500555		875	PREDICTED: uncharacterized LOC101209944	0.708	0.515	0.483	1e-112

>gi\|343887331\|dbj\|BAK61877.1\| DNA excision repair protein [Citrus unshiu]	Back alignment and taxonomy information

 Score = 1234 bits (3192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/655 (94%), Positives = 628/655 (95%), Gaps = 18/655 (2%)

Query: 1   MDFPKKTVSRENDENLGGSELSDDNKNEEMGQRRPGTLNLNLNNPPDERHSKLGFQSGAN 60
           MDFPKKTVSRENDENLGGSEL+DDNKNEEMGQRRPGTLNLNLNNPPDERHSKLGFQSGAN
Sbjct: 1   MDFPKKTVSRENDENLGGSELTDDNKNEEMGQRRPGTLNLNLNNPPDERHSKLGFQSGAN 60

Query: 61  FPEEQTENEEKDYAVHCVEAYFKGMETLSDEESEEGSGSSSKRKRYSTEEKGEAKIENES 120
           FPEEQTENEEKDYAVHCVEAYFKGMETLSDEESEEGSGSSSKRKRYSTEEKGEAKIENES
Sbjct: 61  FPEEQTENEEKDYAVHCVEAYFKGMETLSDEESEEGSGSSSKRKRYSTEEKGEAKIENES 120

Query: 121 SPTEIIFDIEDDLALLNLTTLSLVATNEESDSNLQKEGTQMNEFQ-------------RA 167
           SPTEIIFDIEDDLALLN TTLSL+ATNEESDSNL+KEGTQMNEFQ             + 
Sbjct: 121 SPTEIIFDIEDDLALLNWTTLSLIATNEESDSNLEKEGTQMNEFQRTREWRERRFREAKR 180

Query: 168 REWR-----ERRLAHPQEDDSFNKGNKKGVLKEAEDESQDFGGGPFYEAMVMIKKRNLVQ 222
           R +       RRLAHPQEDDSFNKGNKKGVLKEAEDESQDFGGGPFYEAMVMIKKRNLVQ
Sbjct: 181 RHYEVARYCARRLAHPQEDDSFNKGNKKGVLKEAEDESQDFGGGPFYEAMVMIKKRNLVQ 240

Query: 223 ELKWMPAKNKVEVRQCGVPSLMDLSLKILARNAEAIVSLELVPDFLRHKLSQIVRKKRKM 282
           ELKWMPAKNKVEVRQC VPSLMDLSLKILARNAEAIVSLELVPDFLRHKLSQIVRKKRKM
Sbjct: 241 ELKWMPAKNKVEVRQCCVPSLMDLSLKILARNAEAIVSLELVPDFLRHKLSQIVRKKRKM 300

Query: 283 NARFLELLASGSPTEIRLNDCSEINTDDFTRIFGACDKKNLIVLQLDLCGRILTENVIIN 342
           NARFLELLASGSPTEIRLNDCSEINTDDFTRIFGACDKKNLIVLQLDLCGRILTEN I N
Sbjct: 301 NARFLELLASGSPTEIRLNDCSEINTDDFTRIFGACDKKNLIVLQLDLCGRILTENDITN 360

Query: 343 TIVTQNFSLPALTTISLTGAYQLTDFGLSKLARSASALQSVNLSQCSLLTNEGINLLVKH 402
           TIVTQNFSLPALTTISLTGAYQLTDFGLSKLAR ASALQSVNLSQCSLLTNEGINLLVKH
Sbjct: 361 TIVTQNFSLPALTTISLTGAYQLTDFGLSKLARCASALQSVNLSQCSLLTNEGINLLVKH 420

Query: 403 LKSTLRVLYIDHCQNIDAVSMLPALRKLNCLEVLSVAGIETVDDYFVTEIVRAHCLNMRQ 462
           LKSTLRVLYIDHCQNIDAVSMLPALRKLNCLEVLSVAGIETVDDYFVTEIVRAHCLNMRQ
Sbjct: 421 LKSTLRVLYIDHCQNIDAVSMLPALRKLNCLEVLSVAGIETVDDYFVTEIVRAHCLNMRQ 480

Query: 463 LVLANCGQLTDRALKFVGKKCSRLCALDLSHLDNLTDATVQYLADGCRSICSLKLCRNNF 522
           LVLANCGQLTDRALKFVGKKCSRLCALDLSHLDNLTDAT+QYLADGCRSICSLKLCRNNF
Sbjct: 481 LVLANCGQLTDRALKFVGKKCSRLCALDLSHLDNLTDATMQYLADGCRSICSLKLCRNNF 540

Query: 523 SDEALAAFLEVSGDSLTELSLNHVRGVGLNTALSLAKCSRNLLSLDLSWCRFIKDEALGF 582
           SDEALAAFLEVSGDSLTELSLNHVRGVGLNTALSLAKCSRNLLSLDLSWCRFIKDEALGF
Sbjct: 541 SDEALAAFLEVSGDSLTELSLNHVRGVGLNTALSLAKCSRNLLSLDLSWCRFIKDEALGF 600

Query: 583 IVDNCSLLRLLKLFGCSQITNVFLNGHSNSMVQIIGLPLTPALKHIQVLEPQHTP 637
           IVDNCSLLRLLKLFGCSQITNVFLNGHSNSMVQIIGLPLTPALKHIQVLEPQHTP
Sbjct: 601 IVDNCSLLRLLKLFGCSQITNVFLNGHSNSMVQIIGLPLTPALKHIQVLEPQHTP 655

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255550179\|ref\|XP_002516140.1\| rad7, putative [Ricinus communis] gi\|223544626\|gb\|EEF46142.1\| rad7, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|296081719\|emb\|CBI20724.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359475976\|ref\|XP_002280002.2\| PREDICTED: uncharacterized protein LOC100252702 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297738570\|emb\|CBI27815.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225444746\|ref\|XP_002278147.1\| PREDICTED: uncharacterized protein LOC100244043 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356565796\|ref\|XP_003551123.1\| PREDICTED: DNA repair protein rhp7-like [Glycine max]	Back alignment and taxonomy information

>gi\|356556384\|ref\|XP_003546506.1\| PREDICTED: uncharacterized F-box/LRR-repeat protein C02F5.7-like [Glycine max]	Back alignment and taxonomy information

>gi\|255550465\|ref\|XP_002516283.1\| rad7, putative [Ricinus communis] gi\|223544769\|gb\|EEF46285.1\| rad7, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|449500555\|ref\|XP_004161129.1\| PREDICTED: uncharacterized LOC101209944 [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		637
TAIR\|locus:2051542		762	AT2G06040 "AT2G06040" [Arabido	0.799	0.667	0.409	7.4e-98
TAIR\|locus:504956457		544	AT5G21900 [Arabidopsis thalian	0.686	0.803	0.428	1.4e-78
POMBASE\|SPCC330.02		563	rhp7 "Rad7 homolog Rhp7" [Schi	0.541	0.612	0.275	3.2e-22
UNIPROTKB\|F1NMM1		345	FBXL14 "Uncharacterized protei	0.412	0.762	0.288	1.2e-18
MGI\|MGI:1919429		423	Fbxl2 "F-box and leucine-rich	0.463	0.697	0.264	1e-17
RGD\|1562243		422	Fbxl2 "F-box and leucine-rich	0.463	0.699	0.264	1.3e-17
UNIPROTKB\|Q5R3Z8		423	FBXL2 "F-box/LRR-repeat protei	0.464	0.699	0.265	1.7e-17
UNIPROTKB\|Q9UKC9		423	FBXL2 "F-box/LRR-repeat protei	0.464	0.699	0.265	1.7e-17
TAIR\|locus:2166978		405	AT5G23340 [Arabidopsis thalian	0.353	0.555	0.296	3.1e-17
UNIPROTKB\|F1PWK1		422	FBXL2 "Uncharacterized protein	0.464	0.701	0.265	6.3e-17

TAIR\|locus:2051542 AT2G06040 "AT2G06040" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 972 (347.2 bits), Expect = 7.4e-98, P = 7.4e-98
 Identities = 218/533 (40%), Positives = 326/533 (61%)

Query:   115 KIENESSPTEIIFDIEDDXXXXXXXXXXXXXXXEESDSNLQKEGTQMNEFQRAREWRE-- 172
             +++ E    E + + E                 E++ +  ++   ++    R + +R+  
Sbjct:   232 EVDEEEMEIESLVNSEKPPDVSVTELAATMANVEQAQN--RENSNEIGNDSRTQHFRDIA 289

Query:   173 RRLAHPQEDDSFNKGNKKGVL-KEAEDESQDFGGGPFYEAMVMIKKRNLV---------- 221
              R+AH           ++ +  KE E + +D+ G PF  AM +IK R             
Sbjct:   290 ERIAHRFAHFDAQVEEEEDLSDKEGEQQVEDWPG-PFSTAMKIIKDREEYTTPHVGIGVS 348

Query:   222 -QELK----WMPAKN-KVEVRQCGVPSLMDLSLKILARNAEAIVSLELVPDFLRHKLSQI 275
              +E      W+P  N     R+   PSL +LSL++L +NA+AI SL+ VPD LR KL Q+
Sbjct:   349 NKERSSPTIWVPRSNFSFPPRKA--PSLQELSLRVLVKNADAITSLDYVPDTLRVKLCQL 406

Query:   276 VRKKRKMNARFLELLASGSPTEIRLNDCSEINTDDFTRIFGACDKKNLIVLQLDLCGRIL 335
             +   R+M+  FL+LL  GSPTEI + DCS +  ++FT  F  CD  NL+VLQLD CGR +
Sbjct:   407 LCDSRRMDLHFLDLLVQGSPTEICVPDCSWLTEEEFTECFKNCDTSNLMVLQLDQCGRCM 466

Query:   336 TENVIINTIVTQNFSLPALTTISLTGAYQLTDFGLSKLARSASALQSVNLSQCSLLTNEG 395
              + ++  T+      LP L+T+S++GA +L+D GL +L  SA A+ S+NL+QCSLLT+  
Sbjct:   467 PDYILPFTLARSPKVLPMLSTLSISGACRLSDVGLRQLVSSAPAITSINLNQCSLLTSSS 526

Query:   396 INLLVKHLKSTLRVLYIDHCQNIDAVSMLPALRKLNCLEVLSVAGIETVDDYFVTEIVRA 455
             I++L   L S LR LYI+ CQNID   +L AL+K   LEVLS+A + +V   F+ E V A
Sbjct:   527 IDMLSDSLGSVLRELYINECQNIDMKHILAALKKFEKLEVLSLADLPSVKGRFLKEFVTA 586

Query:   456 HCLNMRQLVLANCGQLTDRALKFVGKKCSRLCALDLSHLDNLTDATVQYLADGCRSICSL 515
                 ++QL+L N  +L+D ++K + + C  L  LDL+++  LTD+++ YLA+GC+++  L
Sbjct:   587 RGQTLKQLILTNSRKLSDSSIKVISENCPNLSVLDLANVCKLTDSSLGYLANGCQALEKL 646

Query:   516 KLCRNNFSDEALAAFLEVSGDSLTELSLNHVRGVGLNTALSLAKCSRNLLSLDLSWCRFI 575
               CRN FSDEA+AAF+E +G SL ELSLN+V+ VG NTAL+LAK S  L  LD+SWCR +
Sbjct:   647 IFCRNPFSDEAVAAFVETAGGSLKELSLNNVKKVGHNTALALAKHSDKLQILDISWCREM 706

Query:   576 KDEALGFIVDNCSLLRLLKLFGCSQITNVFLNGHSNSMVQIIGLPLTPALKHI 628
              ++ LG+IVDN S L++LK+FGCSQ+T+VF+ GHSN  V+I+G+ + P L H+
Sbjct:   707 SNDLLGYIVDNSSSLKVLKVFGCSQVTDVFVKGHSNPNVKILGVKMDPFLGHL 759

GO:0003674 "molecular_function" evidence=ND

GO:0005634 "nucleus" evidence=ISM

GO:0008150 "biological_process" evidence=ND

TAIR\|locus:504956457 AT5G21900 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

POMBASE\|SPCC330.02 rhp7 "Rad7 homolog Rhp7" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NMM1 FBXL14 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

MGI\|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5R3Z8 FBXL2 "F-box/LRR-repeat protein 2" [Pongo abelii (taxid:9601)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

TAIR\|locus:2166978 AT5G23340 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00016452001	SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (905 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		637
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	3e-12
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	8e-12

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

 Score = 66.6 bits (163), Expect = 3e-12
 Identities = 41/164 (25%), Positives = 70/164 (42%), Gaps = 5/164 (3%)

Query: 340 IINTIVTQNFSLPALTTISLTGAYQLTDFGLSKLARSASALQSVNLSQCSLLTNEGINLL 399
           I +  + Q  +   L  + L G+  + D GL  LA+S   LQ ++L  C  +T+ GI  L
Sbjct: 40  ISDPPLDQLSNCNKLKKLILPGSKLIDDEGLIALAQSCPNLQVLDLRACENITDSGIVAL 99

Query: 400 VKHLK--STLRVLYIDHCQNIDAVSMLPALRKLNCLEVLSVAGIETVDDYFVTEIVRAHC 457
             +     T+ +    +   I  VS+    +    L+ +  AG + V D  V E+     
Sbjct: 100 ATNCPKLQTINLGRHRNGHLITDVSLSALGKNCTFLQTVGFAGCD-VTDKGVWELASGCS 158

Query: 458 LNMRQLVLANCGQLTDRALK--FVGKKCSRLCALDLSHLDNLTD 499
            ++ +L L NC  LTD+++           L  L+      +TD
Sbjct: 159 KSLERLSLNNCRNLTDQSIPAILASNYFPNLSVLEFRGCPLITD 202

Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		637
KOG4341		483	consensus F-box protein containing LRR [General fu	99.94
KOG4341		483	consensus F-box protein containing LRR [General fu	99.94
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.66
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.61
KOG1947		482	consensus Leucine rich repeat proteins, some prote	99.6
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	99.59
KOG1947		482	consensus Leucine rich repeat proteins, some prote	99.58
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	99.57
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.38
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.32
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.2
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.15
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.15
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.15
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.11
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.1
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.91
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.84
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.77
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.69
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.54
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.39
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.26
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	98.25
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	98.12
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.05
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.97
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	97.94
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.9
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	97.86
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	97.77
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.73
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.7
KOG4237		498	consensus Extracellular matrix protein slit, conta	97.59
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	97.58
KOG3864		221	consensus Uncharacterized conserved protein [Funct	97.58
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	97.56
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	97.42
KOG3864		221	consensus Uncharacterized conserved protein [Funct	97.3
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	97.15
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	97.08
KOG0472		565	consensus Leucine-rich repeat protein [Function un	96.65
KOG4308		478	consensus LRR-containing protein [Function unknown	96.58
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	96.53
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	96.23
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.18
KOG4237		498	consensus Extracellular matrix protein slit, conta	96.17
PRK15386		426	type III secretion protein GogB; Provisional	96.13
PRK15386		426	type III secretion protein GogB; Provisional	96.12
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	95.91
KOG0472		565	consensus Leucine-rich repeat protein [Function un	95.81
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.48
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	95.12
KOG4308		478	consensus LRR-containing protein [Function unknown	94.93
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	94.61
KOG2123		388	consensus Uncharacterized conserved protein [Funct	94.25
KOG0617		264	consensus Ras suppressor protein (contains leucine	93.8
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	93.57
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	93.48
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	92.73
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	92.69
PLN03150		623	hypothetical protein; Provisional	92.66
PLN03150		623	hypothetical protein; Provisional	92.6
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	92.29
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	91.23
KOG0617		264	consensus Ras suppressor protein (contains leucine	91.21
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	88.85
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	88.82
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	88.54
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	88.51
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	85.38
smart00368		28	LRR_RI Leucine rich repeat, ribonuclease inhibitor	80.79

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

Probab=99.94  E-value=4.8e-27  Score=241.95  Aligned_cols=325  Identities=23%  Similarity=0.375  Sum_probs=240.1

Q ss_pred             CCCcEEEEcCCCCCCHHHHHHHHhhCCCCCeeEEEeecCCCCCChHHHHHHHHHhccCCCCccEEEecCCCCCCHHHHHH
Q 041246          293 GSPTEIRLNDCSEINTDDFTRIFGACDKKNLIVLQLDLCGRILTENVIINTIVTQNFSLPALTTISLTGAYQLTDFGLSK  372 (637)
Q Consensus       293 ~~l~~L~Ls~c~~l~~~~l~~l~~~c~~~nL~~L~Ls~~~~~l~d~~l~~il~~~~~~l~~L~~L~Ls~~~~isd~~l~~  372 (637)
                      +.+++|.+.+|-.+.+..+..+...|  ||+.+|+|.+|.. ++|..+..+.    ..|+.|++|+|..|..+++..+..
T Consensus       138 g~lk~LSlrG~r~v~~sslrt~~~~C--pnIehL~l~gc~~-iTd~s~~sla----~~C~~l~~l~L~~c~~iT~~~Lk~  210 (483)
T KOG4341|consen  138 GFLKELSLRGCRAVGDSSLRTFASNC--PNIEHLALYGCKK-ITDSSLLSLA----RYCRKLRHLNLHSCSSITDVSLKY  210 (483)
T ss_pred             cccccccccccccCCcchhhHHhhhC--Cchhhhhhhccee-ccHHHHHHHH----HhcchhhhhhhcccchhHHHHHHH
Confidence            35677777777777777777777777  7777777777774 6666655443    377777777777777777777777


Q ss_pred             HHHhCCCCCEEEecCCCCCChhHHHHHHHhhcccceEEeccCCCccchhcHHHHHhcCCCCcEEeccCCcCCCHHHHHHH
Q 041246          373 LARSASALQSVNLSQCSLLTNEGINLLVKHLKSTLRVLYIDHCQNIDAVSMLPALRKLNCLEVLSVAGIETVDDYFVTEI  452 (637)
Q Consensus       373 L~~~~~~L~~L~Ls~c~~ls~~~l~~L~~~~~~~L~~L~Ls~c~~i~~~~l~~~l~~l~~L~~L~Ls~~~~l~~~~l~~l  452 (637)
                      ++..|++|++|++++|+.++..++..+...|. .++.+.+.+|.......+...-..++-+..+++-.|..++|..+..+
T Consensus       211 la~gC~kL~~lNlSwc~qi~~~gv~~~~rG~~-~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i  289 (483)
T KOG4341|consen  211 LAEGCRKLKYLNLSWCPQISGNGVQALQRGCK-ELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLI  289 (483)
T ss_pred             HHHhhhhHHHhhhccCchhhcCcchHHhccch-hhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccchHHHHH
Confidence            77777777777777777777777777777776 57777667777666666565556666677777777777777776553


Q ss_pred             HHHcCCCccEEEecCCCCCCHHHHHHHHhcCCCCCEEEEcCCCCCCHHHHHHHHhcCCCCCEEEeccCC-CCHHHHHHHH
Q 041246          453 VRAHCLNMRQLVLANCGQLTDRALKFVGKKCSRLCALDLSHLDNLTDATVQYLADGCRSICSLKLCRNN-FSDEALAAFL  531 (637)
Q Consensus       453 l~~~~~~L~~L~Ls~c~~ltd~~l~~l~~~c~~L~~L~L~~c~~itd~~l~~L~~~~~~L~~L~Ls~~~-ltd~~l~~l~  531 (637)
                       ...+..|+.|..++|..++|..+.++.++|++|+.|.+.+|..+++.++..+..+++.|+.|++..+. ++|..+..+ 
T Consensus       290 -~~~c~~lq~l~~s~~t~~~d~~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~rn~~~Le~l~~e~~~~~~d~tL~sl-  367 (483)
T KOG4341|consen  290 -ACGCHALQVLCYSSCTDITDEVLWALGQHCHNLQVLELSGCQQFSDRGFTMLGRNCPHLERLDLEECGLITDGTLASL-  367 (483)
T ss_pred             -hhhhhHhhhhcccCCCCCchHHHHHHhcCCCceEEEeccccchhhhhhhhhhhcCChhhhhhcccccceehhhhHhhh-
Confidence             34477888888888888888888888888888888888888888888888888888888888887765 444445544 


Q ss_pred             HhcCCCccEEEcCCCCCCCHHHHHHHHh---CCCCcceEeeecCCCCCHHHHHHHHhcCCCcCEEEeecCCCCChhhhhc
Q 041246          532 EVSGDSLTELSLNHVRGVGLNTALSLAK---CSRNLLSLDLSWCRFIKDEALGFIVDNCSLLRLLKLFGCSQITNVFLNG  608 (637)
Q Consensus       532 ~~~~~~L~~L~Ls~c~~l~~~~l~~l~~---~~~~L~~L~Ls~c~~ltd~~l~~l~~~cp~L~~L~L~~C~~ltd~~l~~  608 (637)
                      ...|+.|+.|+|+.|..++|.++..+..   ....|+.|.|++|+.+++..++.+. .|+.|+++++.+|..++...+..
T Consensus       368 s~~C~~lr~lslshce~itD~gi~~l~~~~c~~~~l~~lEL~n~p~i~d~~Le~l~-~c~~Leri~l~~~q~vtk~~i~~  446 (483)
T KOG4341|consen  368 SRNCPRLRVLSLSHCELITDEGIRHLSSSSCSLEGLEVLELDNCPLITDATLEHLS-ICRNLERIELIDCQDVTKEAISR  446 (483)
T ss_pred             ccCCchhccCChhhhhhhhhhhhhhhhhccccccccceeeecCCCCchHHHHHHHh-hCcccceeeeechhhhhhhhhHH
Confidence            4567888888888888888887766543   4467888888888888888887764 68888888888888888887764


Q ss_pred             ccccceeeecCCCCCCCCeeeccCCCCCC
Q 041246          609 HSNSMVQIIGLPLTPALKHIQVLEPQHTP  637 (637)
Q Consensus       609 ls~~~l~i~g~~~lp~L~~L~l~~~~~~~  637 (637)
                      +         ..++|+++...+..|-..|
T Consensus       447 ~---------~~~lp~i~v~a~~a~~t~p  466 (483)
T KOG4341|consen  447 F---------ATHLPNIKVHAYFAPVTPP  466 (483)
T ss_pred             H---------HhhCccceehhhccCCCCc
Confidence            2         3456777776666665554

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		637
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	4e-34
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	3e-31
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	7e-28
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-19
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	8e-13
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-30
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	6e-30
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-29
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-27
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	4e-17
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	2e-27
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	3e-25
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	5e-24
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	6e-16
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	3e-15
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	9e-14
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	4e-11
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	2e-12
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	5e-11
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	5e-07
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	1e-10
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	5e-06
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	2e-09
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	4e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-09
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	6e-09
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	2e-08
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	7e-07
3lvg_D		190	LCB, clathrin light chain B; SELF assembly, coated	1e-05
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	2e-05
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-04
1qzv_F		154	Plant photosystem I: subunit PSAF; photosynthesis,	7e-04

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

 Score =  136 bits (344), Expect = 4e-34
 Identities = 59/383 (15%), Positives = 123/383 (32%), Gaps = 46/383 (12%)

Query: 235 VRQCGVPSLMDLSLKILARNAEAIVSLELVPDFLRHKLSQIVRKKRKMNARFLELLASGS 294
           +R+  V  +    L        ++VSL +                 +++   LE L +  
Sbjct: 163 LRESDVDDVSGHWLSHFPDTYTSLVSLNISCL------------ASEVSFSALERLVTRC 210

Query: 295 P--TEIRLNDCSEINTDDFTRIFGACDKKNLIVLQLDLCGRILTENVIINTIVTQNFSLP 352
           P    ++LN    +  +    +        L  L        +  +V          +L 
Sbjct: 211 PNLKSLKLNRA--VPLEKLATLLQRA--PQLEELGTGGYTAEVRPDVYSGLS----VALS 262

Query: 353 ALTTI-SLTGAYQLTDFGLSKLARSASALQSVNLSQCSLLTNEGINLLVKHLKSTLRVLY 411
               +  L+G +      L  +    S L ++NLS  ++  +  +  L+      L+ L+
Sbjct: 263 GCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATV-QSYDLVKLLCQCPK-LQRLW 320

Query: 412 IDHCQNIDAVSML----PALRKLN--CLEVLSVAGIETVDDYFVTEIVRAHCLNMRQLVL 465
           +        + +L      LR+L     E   +     + +  +  +  +      + VL
Sbjct: 321 VLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSV--SMGCPKLESVL 378

Query: 466 ANCGQLTDRALKFVGKKCSRLCALDLSHLD---------NLTDATVQYLADGCRSICSLK 516
             C Q+T+ AL  + +    +    L  ++            D     + + C+ +  L 
Sbjct: 379 YFCRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLS 438

Query: 517 LCRNNFSDEALAAFLEVSGDSLTELSLNHVRGVGLNTALSLAKCSRNLLSLDLSWCRFIK 576
           L     +D+            +  LS+    G        +     +L  L++  C F  
Sbjct: 439 LS-GLLTDKVFEYIGT-YAKKMEMLSVAFA-GDSDLGMHHVLSGCDSLRKLEIRDCPFG- 494

Query: 577 DEALGFIVDNCSLLRLLKLFGCS 599
           D+AL         +R L +  CS
Sbjct: 495 DKALLANASKLETMRSLWMSSCS 517

PyMOL of 2p1m

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185	Back alignment and structure

>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		637
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.93
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.93
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.91
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.91
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.87
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.87
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.84
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.77
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.76
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.75
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.64
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.62
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.56
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.54
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.5
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.49
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.45
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.43
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.43
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.42
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.42
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.4
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.38
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.35
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.35
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.35
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.34
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.33
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.33
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.32
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.32
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.32
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.3
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.3
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.29
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.28
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.28
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	99.28
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.27
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.26
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.26
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.25
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.24
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.24
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.24
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.24
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.23
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.22
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.21
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.21
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.2
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.19
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.19
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	99.18
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.18
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.17
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.17
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.13
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.13
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.11
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.11
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.1
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.08
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.07
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.05
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.04
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.04
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.03
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.03
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.02
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.02
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.02
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.01
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.01
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.01
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.01
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.0
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	98.96
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.95
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	98.95
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.95
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	98.92
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.82
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.81
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.8
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.77
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	98.76
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.74
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	98.71
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.7
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.69
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.68
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.67
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.66
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	98.65
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.63
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.62
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	98.62
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	98.61
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.5
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.48
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.48
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.47
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.38
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.32
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	98.31
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.29
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.26
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.24
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.24
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	98.21
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.18
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	98.16
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.16
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	98.16
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.06
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.03
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.02
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.0
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	97.98
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	97.96
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	97.84
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	97.81
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	97.8
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	97.8
3e6j_A		229	Variable lymphocyte receptor diversity region; var	97.78
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	97.75
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	97.7
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	97.69
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	97.65
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	97.61
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	97.59
3e6j_A		229	Variable lymphocyte receptor diversity region; var	97.59
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	97.57
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	97.53
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	97.11
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	97.07
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	96.98
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	96.71
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	96.65
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	96.64
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	96.6
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	96.44
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	96.24
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	95.81
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	95.7
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	95.67
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	94.26
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	94.05
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	93.87
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	93.64
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	93.43
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	93.12
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	90.79
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	90.58

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

Probab=99.93  E-value=2.5e-24  Score=243.48  Aligned_cols=297  Identities=17%  Similarity=0.310  Sum_probs=185.3

Q ss_pred             CCcEEEEcCCCCCCHHHHHHHHhhCCCCCeeEEEeecCCCCCChHH---HHHHHHHhccCCCCccEEEecCCCC--CCHH
Q 041246          294 SPTEIRLNDCSEINTDDFTRIFGACDKKNLIVLQLDLCGRILTENV---IINTIVTQNFSLPALTTISLTGAYQ--LTDF  368 (637)
Q Consensus       294 ~l~~L~Ls~c~~l~~~~l~~l~~~c~~~nL~~L~Ls~~~~~l~d~~---l~~il~~~~~~l~~L~~L~Ls~~~~--isd~  368 (637)
                      .+++|++++|..++...+..+...|  ++|++|+|++|.  +++..   +..    ....+++|++|+++++..  +...
T Consensus       139 ~L~~L~L~~~~~~~~~~l~~~~~~~--~~L~~L~L~~~~--~~~~~~~~l~~----~~~~~~~L~~L~L~~n~~~~~~~~  210 (592)
T 3ogk_B          139 DLETLKLDKCSGFTTDGLLSIVTHC--RKIKTLLMEESS--FSEKDGKWLHE----LAQHNTSLEVLNFYMTEFAKISPK  210 (592)
T ss_dssp             GCCEEEEESCEEEEHHHHHHHHHHC--TTCSEEECTTCE--EECCCSHHHHH----HHHHCCCCCEEECTTCCCSSCCHH
T ss_pred             cCcEEECcCCCCcCHHHHHHHHhhC--CCCCEEECcccc--ccCcchhHHHH----HHhcCCCccEEEeeccCCCccCHH
Confidence            4788888888777777777777777  888888888775  32221   222    233677777777776532  3456


Q ss_pred             HHHHHHHhCCCCCEEEecCCCCCC-----------------------------------------------hhHHHHHHH
Q 041246          369 GLSKLARSASALQSVNLSQCSLLT-----------------------------------------------NEGINLLVK  401 (637)
Q Consensus       369 ~l~~L~~~~~~L~~L~Ls~c~~ls-----------------------------------------------~~~l~~L~~  401 (637)
                      .+..+...|++|++|+|++|....                                               ...+..+..
T Consensus       211 ~l~~~~~~~~~L~~L~L~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~l~~~~~  290 (592)
T 3ogk_B          211 DLETIARNCRSLVSVKVGDFEILELVGFFKAAANLEEFCGGSLNEDIGMPEKYMNLVFPRKLCRLGLSYMGPNEMPILFP  290 (592)
T ss_dssp             HHHHHHHHCTTCCEEECSSCBGGGGHHHHHHCTTCCEEEECBCCCCTTCTTSSSCCCCCTTCCEEEETTCCTTTGGGGGG
T ss_pred             HHHHHHhhCCCCcEEeccCccHHHHHHHHhhhhHHHhhcccccccccchHHHHHHhhccccccccCccccchhHHHHHHh
Confidence            666666777777777777652100                                               111112222


Q ss_pred             hhcccceEEeccCCCccchhcHHHHHhcCCCCcEEeccCCcCCCHHHHHHHHHHcCCCccEEEecC----------CCCC
Q 041246          402 HLKSTLRVLYIDHCQNIDAVSMLPALRKLNCLEVLSVAGIETVDDYFVTEIVRAHCLNMRQLVLAN----------CGQL  471 (637)
Q Consensus       402 ~~~~~L~~L~Ls~c~~i~~~~l~~~l~~l~~L~~L~Ls~~~~l~~~~l~~ll~~~~~~L~~L~Ls~----------c~~l  471 (637)
                      .++ +|++|++++|. ++...+...+..+++|++|++++  .+.+..+..+.. .+++|++|+|++          |..+
T Consensus       291 ~~~-~L~~L~Ls~~~-l~~~~~~~~~~~~~~L~~L~L~~--~~~~~~l~~~~~-~~~~L~~L~L~~g~~~~~~~~~~~~~  365 (592)
T 3ogk_B          291 FAA-QIRKLDLLYAL-LETEDHCTLIQKCPNLEVLETRN--VIGDRGLEVLAQ-YCKQLKRLRIERGADEQGMEDEEGLV  365 (592)
T ss_dssp             GGG-GCCEEEETTCC-CCHHHHHHHHTTCTTCCEEEEEG--GGHHHHHHHHHH-HCTTCCEEEEECCCCSSTTSSTTCCC
T ss_pred             hcC-CCcEEecCCCc-CCHHHHHHHHHhCcCCCEEeccC--ccCHHHHHHHHH-hCCCCCEEEeecCccccccccccCcc
Confidence            333 67777777775 55555555566777777777763  345555555443 367777777774          6677


Q ss_pred             CHHHHHHHHhcCCCCCEEEEcCCCCCCHHHHHHHHhcCCCCCEEEec----cCCCCH----HHHHHHHHhcCCCccEEEc
Q 041246          472 TDRALKFVGKKCSRLCALDLSHLDNLTDATVQYLADGCRSICSLKLC----RNNFSD----EALAAFLEVSGDSLTELSL  543 (637)
Q Consensus       472 td~~l~~l~~~c~~L~~L~L~~c~~itd~~l~~L~~~~~~L~~L~Ls----~~~ltd----~~l~~l~~~~~~~L~~L~L  543 (637)
                      ++.++..+...|++|+.|++ +|+.+++.++..+...+++|+.|+|+    ++.+++    .++..+.. .+++|++|+|
T Consensus       366 ~~~~~~~l~~~~~~L~~L~l-~~~~l~~~~~~~l~~~~~~L~~L~l~~~~~~n~l~~~p~~~~~~~~~~-~~~~L~~L~L  443 (592)
T 3ogk_B          366 SQRGLIALAQGCQELEYMAV-YVSDITNESLESIGTYLKNLCDFRLVLLDREERITDLPLDNGVRSLLI-GCKKLRRFAF  443 (592)
T ss_dssp             CHHHHHHHHHHCTTCSEEEE-EESCCCHHHHHHHHHHCCSCCEEEEEECSCCSCCSSCCCHHHHHHHHH-HCTTCCEEEE
T ss_pred             CHHHHHHHHhhCccCeEEEe-ecCCccHHHHHHHHhhCCCCcEEEEeecCCCccccCchHHHHHHHHHH-hCCCCCEEEE
Confidence            77777776666777777777 33567777777666667777777775    445554    35554433 2466666666


Q ss_pred             CCCCC-CCHHHHHHHHhCCCCcceEeeecCCCCCHHHHHHHHhcCCCcCEEEeecCCCCChhhhh
Q 041246          544 NHVRG-VGLNTALSLAKCSRNLLSLDLSWCRFIKDEALGFIVDNCSLLRLLKLFGCSQITNVFLN  607 (637)
Q Consensus       544 s~c~~-l~~~~l~~l~~~~~~L~~L~Ls~c~~ltd~~l~~l~~~cp~L~~L~L~~C~~ltd~~l~  607 (637)
                      +.|.+ +++..+..+...+++|++|+|++|. +++.++..++.+|++|++|+|++|. +++.++.
T Consensus       444 ~~~~~~l~~~~~~~~~~~~~~L~~L~L~~n~-l~~~~~~~~~~~~~~L~~L~l~~n~-l~~~~~~  506 (592)
T 3ogk_B          444 YLRQGGLTDLGLSYIGQYSPNVRWMLLGYVG-ESDEGLMEFSRGCPNLQKLEMRGCC-FSERAIA  506 (592)
T ss_dssp             ECCGGGCCHHHHHHHHHSCTTCCEEEECSCC-SSHHHHHHHHTCCTTCCEEEEESCC-CBHHHHH
T ss_pred             ecCCCCccHHHHHHHHHhCccceEeeccCCC-CCHHHHHHHHhcCcccCeeeccCCC-CcHHHHH
Confidence            65543 5666666666666666666666665 6666666666666666666666665 5655443

PyMOL of 3ogk

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		637
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	4e-06
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	3e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	7e-05
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	9e-04

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: 28-residue LRR
domain: Ribonuclease inhibitor
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 47.3 bits (110), Expect = 4e-06
 Identities = 19/91 (20%), Positives = 33/91 (36%), Gaps = 6/91 (6%)

Query: 489 LDLSHLDNLTDATVQYLADGCRSICSLKLCRNNFSDEALAAFLEV--SGDSLTELSL--N 544
           LD+   + L+DA    L    +    ++L     ++              +L EL+L  N
Sbjct: 7   LDIQC-EELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSN 65

Query: 545 HVRGVGLNT-ALSLAKCSRNLLSLDLSWCRF 574
            +  VG++     L   S  +  L L  C  
Sbjct: 66  ELGDVGVHCVLQGLQTPSCKIQKLSLQNCCL 96

PyMOL of d1z7xw1

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		637
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.88
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.85
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.75
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.7
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.62
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.56
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.14
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.96
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.7
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.65
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.61
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.56
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.55
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	98.54
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.5
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	98.49
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.48
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.38
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.36
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	98.35
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.35
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	98.18
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.15
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	98.14
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	97.99
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	97.97
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	97.96
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	97.87
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	97.82
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	97.8
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	97.66
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	97.61
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	97.57
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	97.54
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	97.42
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	97.39
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	96.71
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	96.42
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	96.31
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	96.03
d2ifga3		156	High affinity nerve growth factor receptor, N-term	93.33
d2ifga3		156	High affinity nerve growth factor receptor, N-term	93.18

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.88  E-value=1.4e-22  Score=206.53  Aligned_cols=271  Identities=20%  Similarity=0.318  Sum_probs=164.9

Q ss_pred             cEEEEcCCCCCCHHHHHHHHhhCCCCCeeEEEeecCCCCCChHHHHHHHHHhccCCCCccEEEecCCCCCCHHHHHHHHH
Q 041246          296 TEIRLNDCSEINTDDFTRIFGACDKKNLIVLQLDLCGRILTENVIINTIVTQNFSLPALTTISLTGAYQLTDFGLSKLAR  375 (637)
Q Consensus       296 ~~L~Ls~c~~l~~~~l~~l~~~c~~~nL~~L~Ls~~~~~l~d~~l~~il~~~~~~l~~L~~L~Ls~~~~isd~~l~~L~~  375 (637)
                      ++|++++. .+.++.+..+..    ..+..+.+....  +.....      ......+|++|++++| .+++..+..++.
T Consensus         3 ~~lDLs~~-~l~~~~l~~l~~----~~~~~lrl~~~~--~~~~~~------~~~~~~~L~~LdLs~~-~i~~~~l~~l~~   68 (284)
T d2astb2           3 QTLDLTGK-NLHPDVTGRLLS----QGVIAFRCPRSF--MDQPLA------EHFSPFRVQHMDLSNS-VIEVSTLHGILS   68 (284)
T ss_dssp             SEEECTTC-BCCHHHHHHHHH----TTCSEEECTTCE--ECSCCC------SCCCCBCCCEEECTTC-EECHHHHHHHHT
T ss_pred             CEEECCCC-CCCchHHHHHHh----ccceEeeccccc--cccchh------hhccCCCCCEEECCCC-ccCHHHHHHHHH
Confidence            56788774 466677777665    334455544322  111000      1124456777887775 467777777777


Q ss_pred             hCCCCCEEEecCCCCCChhHHHHHHHhhcccceEEeccCCCccchhcHHHHHhcCCCCcEEeccCCcCCCHHHHHHHHHH
Q 041246          376 SASALQSVNLSQCSLLTNEGINLLVKHLKSTLRVLYIDHCQNIDAVSMLPALRKLNCLEVLSVAGIETVDDYFVTEIVRA  455 (637)
Q Consensus       376 ~~~~L~~L~Ls~c~~ls~~~l~~L~~~~~~~L~~L~Ls~c~~i~~~~l~~~l~~l~~L~~L~Ls~~~~l~~~~l~~ll~~  455 (637)
                      .|++|++|++++| .+++..+..++                            .+++|++|++++|..+++.++..++..
T Consensus        69 ~c~~L~~L~L~~~-~l~~~~~~~l~----------------------------~~~~L~~L~Ls~c~~itd~~l~~l~~~  119 (284)
T d2astb2          69 QCSKLQNLSLEGL-RLSDPIVNTLA----------------------------KNSNLVRLNLSGCSGFSEFALQTLLSS  119 (284)
T ss_dssp             TBCCCSEEECTTC-BCCHHHHHHHT----------------------------TCTTCSEEECTTCBSCCHHHHHHHHHH
T ss_pred             hCCCccccccccc-CCCcHHHHHHh----------------------------cCCCCcCccccccccccccccchhhHH
Confidence            7777777777776 56666555544                            344455555555555555555444322


Q ss_pred             cCCCccEEEecCCCCCCHHHHHH-HHhcCCCCCEEEEcCC-CCCCHHHHHHHHhcCCCCCEEEeccC-CCCHHHHHHHHH
Q 041246          456 HCLNMRQLVLANCGQLTDRALKF-VGKKCSRLCALDLSHL-DNLTDATVQYLADGCRSICSLKLCRN-NFSDEALAAFLE  532 (637)
Q Consensus       456 ~~~~L~~L~Ls~c~~ltd~~l~~-l~~~c~~L~~L~L~~c-~~itd~~l~~L~~~~~~L~~L~Ls~~-~ltd~~l~~l~~  532 (637)
                       +++|++|+|++|..+++.++.. +...|++|+.|++++| ..+++.++..++.+|++|++|+|++| .+++.++..+. 
T Consensus       120 -~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~-  197 (284)
T d2astb2         120 -CSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFF-  197 (284)
T ss_dssp             -CTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGG-
T ss_pred             -HHhccccccccccccccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhc-
Confidence             5566666666665555555433 3334456666666654 24566666666666666666666554 35665555543 


Q ss_pred             hcCCCccEEEcCCCCCCCHHHHHHHHhCCCCcceEeeecCCCCCHHHHHHHHhcCCCcCEEEeecCCCCChhhhhccccc
Q 041246          533 VSGDSLTELSLNHVRGVGLNTALSLAKCSRNLLSLDLSWCRFIKDEALGFIVDNCSLLRLLKLFGCSQITNVFLNGHSNS  612 (637)
Q Consensus       533 ~~~~~L~~L~Ls~c~~l~~~~l~~l~~~~~~L~~L~Ls~c~~ltd~~l~~l~~~cp~L~~L~L~~C~~ltd~~l~~ls~~  612 (637)
                       .+++|++|+|++|..+++.++..+. .+|+|+.|++++|  +++.++..+...||+|+.    +|..+++...+...+.
T Consensus       198 -~~~~L~~L~L~~C~~i~~~~l~~L~-~~~~L~~L~l~~~--~~d~~l~~l~~~lp~L~i----~~~~ls~~~~~~~~~~  269 (284)
T d2astb2         198 -QLNYLQHLSLSRCYDIIPETLLELG-EIPTLKTLQVFGI--VPDGTLQLLKEALPHLQI----NCSHFTTIARPTIGNK  269 (284)
T ss_dssp             -GCTTCCEEECTTCTTCCGGGGGGGG-GCTTCCEEECTTS--SCTTCHHHHHHHSTTSEE----SCCCSCCTTCSSCSST
T ss_pred             -ccCcCCEEECCCCCCCChHHHHHHh-cCCCCCEEeeeCC--CCHHHHHHHHHhCccccc----cCccCCCCCCCccCcc
Confidence             2467777777777777776665553 5889999999988  788899999888988873    6777877655443322


Q ss_pred             -ceeeecC
Q 041246          613 -MVQIIGL  619 (637)
Q Consensus       613 -~l~i~g~  619 (637)
                       ...+||+
T Consensus       270 ~~~~iw~~  277 (284)
T d2astb2         270 KNQEIWGI  277 (284)
T ss_dssp             TCCCBTTB
T ss_pred             ccchhccc
Confidence             2445665

PyMOL of d2astb2

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure