Citrus Sinensis ID: 041258

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510

MSSTILAPFQLLELNIISAQDLAPVSRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDEDFLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQVRRPSGRPQGILNIGVALLDSSMRSMPLYTQLSSALGYRHLMGEEDIFTKNTSTVASTNQHNISILLGKPDLRRTKSDSSSMIGSEIARKSRIRRENGNGKASSVVGGSELSGKGNNKGSSKGSSVFSGSDIFKKPNNKVANSTLSTFSGSDLRKDQPGREGAGKVRSLVNGIETVNQVGSPTKGKIGNPGSMNSGSDGSDPPRKVDPSPKAISPRKPFARDQGYEFVHPNKLKLYKNVQPVITESELGPSPSEVAAAKAKEKLLKQTNDEESSVMMAWDMDSSVEGLQSKLERWRAELPPLYDSSFPSSSAGGGGGGGTTARHSRRHTDGGSGPGLFSCFSNICGCECSIVCGSSSSSKTNKKKSGSSGRLIRSPSINNDSSFF

ccccccccccEEEEEEEEEccccccccccccEEEEEEEcccEEEcccccccccccccccEEEEEEccccccccccEEEEEEEEcccccccccEEEEEEcccccccccccccccccccccEEEEEEEEcccccccEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccccccccccccccccccccccccccccc

ccccccccccEEEEEEEEccccccccccccEEEEEEEccccccccccccccccccccccEEEEEccHHHHcccccEEEEEEEEccccccccEEEEEEEHHHHcccccccccccccccccEEEEEEEEcccccccEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccHcHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHcccccEccccccccccccccccccccccccccccccccccEEccccEcEEEEEEEEccccccccccccccccccEEEccccccccccc

msstilapfQLLELNIisaqdlapvsrsMRTYAVAwvhpnrklstrvdahgrnnptwndkfvfrvdedflhndtSAVMIEIFALHWFRDMHVGTVRVLVgnlippptrslhhshrsfGMRFVALQvrrpsgrpqgiLNIGVALLdssmrsmplytQLSSALgyrhlmgeediftkntstvastnqhnisillgkpdlrrtksdsssmigseiarksrirrengngkassvvggselsgkgnnkgsskgssvfsgsdifkkpnnkvanstlstfsgsdlrkdqpgregagkvRSLVNGIEtvnqvgsptkgkignpgsmnsgsdgsdpprkvdpspkaisprkpfardqgyefvhpnklklyknvqpviteselgpspsEVAAAKAKEKLLKQTNDEESSVMMAWDMDSSVEGLQSKLERWraelpplydssfpsssagggggggttarhsrrhtdggsgpglfscfsnicgcecsivcgsssssktnkkksgssgrlirspsinndssff

MSSTILAPFQLLELNIISAQDLAPVSRSMRTYAVawvhpnrklstrvdahgrnnptwndkfvFRVDEDFLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQVrrpsgrpqgILNIGVALLDSSMRSMPLYTQLSSALGYRHLMGEEDIFTKNTstvastnqhnisillgkpdlrrtksdsssmigseiarksrirrengngkassvvggselsgkgnnkgsskgssvfsgsdifkkpnnkvanstlstfsgsdlrkdqpgregagkvrslvngietvnqvgsptkgkignpgsmnsgsdgsdpprkvdpspkaisprkpfardqgyEFVHPNKLKLYKNVQPVITESELGPSPSEVAAAKAKEKLLKQTNDEESSVMMAWDMDSSVEGLQSKLERWRAELPPLYDSSFPSSSAGGGGGGGTTARHSRRHTDGGSGPGLFSCFSNICGCECSIvcgsssssktnkkksgssgrlirspsinndssff

MSSTILAPFQLLELNIISAQDLAPVSRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDEDFLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQVRRPSGRPQGILNIGVALLDSSMRSMPLYTQLSSALGYRHLMGEEDIFTKNTSTVASTNQHNISILLGKPDLRRTKSDSSSMIGSEIARKSRIRRENGNGKASSVVggselsgkgnnkgsskgssvfsgsDIFKKPNNKVANSTLSTFSGSDLRKDQPGREGAGKVRSLVNGIETVNQVGSPTKGKIGNPGSMNSGSDGSDPPRKVDPSPKAISPRKPFARDQGYEFVHPNKLKLYKNVQPVITESELGPSPSEVaaakakekllkQTNDEESSVMMAWDMDSSVEGLQSKLERWRAELPPLYDSSFPsssagggggggttarhsrrhtDGGSGPGLFSCFSNicgcecsivcgsssssktnkkksgssgRLIRSPSINNDSSFF

****ILAPFQLLELNIISAQDLAPVSRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDEDFLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQVRRPSGRPQGILNIGVALLDSSMRSMPLYTQLSSALGYRHLMGEEDIFTKNTSTVA****HNISILL*************************************************************************************************************************************************************YEFVHPNKLKLYKNVQPV*********************************************************************************************GLFSCFSNICGCECSIVCG*******************************

************ELNIISAQDLAPVSRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDEDFLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQVRRPSGRPQGILNIGVALLDS********************************************************************************************************************************************************************************************************************************************************************************RWRAELPPL***********************************FSCFSNICGCECSIVC****************************SSFF

MSSTILAPFQLLELNIISAQDLAPVSRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDEDFLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQVRRPSGRPQGILNIGVALLDSSMRSMPLYTQLSSALGYRHLMGEEDIFTKNTSTVASTNQHNISILLGKPDLR**********GSEIARKSRIRRE***********GSEL***************FSGSDIFKKPNNKVANSTLSTFS**************GKVRSLVNGIETVNQVGSPTKGKIGNPG********************AISPRKPFARDQGYEFVHPNKLKLYKNVQPVITESELGPSPSEVAAAKAKEKLLKQTNDEESSVMMAWDMDSSVEGLQSKLERWRAELPPLYDSSFP***********************GSGPGLFSCFSNICGCECSIVCG******************IRSPSINNDSSFF

****ILAPFQLLELNIISAQDLAPVSRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDEDFLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPP**********FGMRFVALQVRRPSGRPQGILNIGVALLDSSMRSMPLYTQLSSALGYRHLMG***********************************************************************************************************************************************************************KAISPRKPFARDQGYEFVHPNKLKLYKNVQPVITESELGPSPSEVAAAKAKEKL*********************EGLQSKLERWRAELPPLYDS*****************************PGLFSCFSNICGCECSIVCGSS*****************************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		510
449532463		533	PREDICTED: uncharacterized LOC101215059	0.933	0.893	0.525	1e-132
449458910		561	PREDICTED: uncharacterized protein LOC10	0.929	0.844	0.482	1e-126
255574881		472	hypothetical protein RCOM_1217340 [Ricin	0.841	0.908	0.518	1e-121
224099983		492	predicted protein [Populus trichocarpa]	0.919	0.953	0.521	1e-119
224107517		460	predicted protein [Populus trichocarpa]	0.870	0.965	0.496	1e-117
147859667		494	hypothetical protein VITISV_026570 [Viti	0.849	0.876	0.483	1e-105
225433273		494	PREDICTED: uncharacterized protein LOC10	0.849	0.876	0.479	1e-104
356577606		449	PREDICTED: uncharacterized protein LOC10	0.870	0.988	0.451	1e-103
357439831		459	hypothetical protein MTR_1g045780 [Medic	0.862	0.958	0.414	3e-90
357440915		682	RNA-binding protein 12B [Medicago trunca	0.445	0.332	0.665	5e-87

>gi\|449532463\|ref\|XP_004173200.1\| PREDICTED: uncharacterized LOC101215059 [Cucumis sativus]	Back alignment and taxonomy information

 Score =  478 bits (1230), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 293/558 (52%), Positives = 360/558 (64%), Gaps = 82/558 (14%)

Query: 4   TILAPFQLLELNIISAQDLAPVSRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVF 63
           TIL PFQLLELN+ISAQDLAPVSRSMRTYAVAWVHP+RKLSTRVD HG NNPTWNDKFVF
Sbjct: 2   TILNPFQLLELNVISAQDLAPVSRSMRTYAVAWVHPDRKLSTRVDTHGHNNPTWNDKFVF 61

Query: 64  RVDEDFLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHR-SFGMRFV 122
           RVD++FLH+DTSAVMIEI+ALHWF+D+HVGTVR+LVGNLIP P R    S +   GMRFV
Sbjct: 62  RVDDEFLHSDTSAVMIEIYALHWFKDIHVGTVRILVGNLIPTPPRLHQFSQQPQVGMRFV 121

Query: 123 ALQVRRPSGRPQGILNIGVALLDSSMRSMPLYTQLS-SALGYRHLMGEEDIFTKNTSTVA 181
           ALQVRRPSGRPQGILNIGVALL SSMRSMPLY+QLS SA+GYR+LMGEED F  + S   
Sbjct: 122 ALQVRRPSGRPQGILNIGVALLHSSMRSMPLYSQLSTSAIGYRNLMGEEDPFANHHSN-- 179

Query: 182 STNQ-HNISILLGKPDLRRTKSDSSSMIGSEIARKSRIRRENGNGKASSVVGGSELSGKG 240
           + NQ H    +L +P++RR+KSD+SSMIGSE+ R S +  +    KASS+V GSE+S K 
Sbjct: 180 TNNQSHGTPTVLTRPEMRRSKSDTSSMIGSEL-RGSEMMGKGMKSKASSMVNGSEVS-KQ 237

Query: 241 NNKGSSKGSSVFSGSDIFKKPNNKVANSTLSTFSGSD----LRKDQPGREGAGKV----- 291
             KG SK SS+ SGS + K+       S++ + SG +    ++  + G+   G V     
Sbjct: 238 KKKGRSKASSMISGSVVIKRKGKSRKASSMISGSGIEEGYAVKNGKNGKSNPGIVGKKDK 297

Query: 292 ---RSLVNGIET------------VNQVGSPTKGKIGN--PGS----------------- 317
               S+++G E+            V  V SP +GK G   P S                 
Sbjct: 298 VDQSSILSGSESWKKPPNEIPNSKVEVVDSP-RGKPGQETPNSRFDKMPYATPLRTPQRL 356

Query: 318 MNSGSDGSDPPRKVDPSPKAISP---RKPFARDQGYEFVHPNKLKLYKNVQPVITESELG 374
             SG+  + P      +P+  +P   +  + +   + +  P K  L       +TESELG
Sbjct: 357 AGSGTARATPMHDKFATPRRSTPLNGKSSYTKHNEFTYTTPRKSFLGG---AFLTESELG 413

Query: 375 PSPSEVAAAKAKEKLLKQTND-EESSVMMAWDMDSSVEGLQSKLERWRAELPPLYD---- 429
           PSPSEVAA  A++K    T D  ESS++    ++ SVEGLQSKLERWR ELPP+YD    
Sbjct: 414 PSPSEVAAQMARQK----TEDGNESSIVGGLSLNDSVEGLQSKLERWRTELPPVYDRGEL 469

Query: 430 SSFPSSSAGGGGGGGTTARHSRRHTDGGSGPGLFSCFSNICGCECSIVCGSSSSSKTNKK 489
           SSFPSS          T  H+RRH+DGG   GLFSCFSNICGCECSIVCG S  +     
Sbjct: 470 SSFPSSE---------TREHNRRHSDGG---GLFSCFSNICGCECSIVCGGSPKA----T 513

Query: 490 KSGSSGRLIRSPSINNDS 507
           K  +SGRL+RSPS++  S
Sbjct: 514 KKSASGRLVRSPSVDQVS 531

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449458910\|ref\|XP_004147189.1\| PREDICTED: uncharacterized protein LOC101215059 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255574881\|ref\|XP_002528347.1\| hypothetical protein RCOM_1217340 [Ricinus communis] gi\|223532215\|gb\|EEF34019.1\| hypothetical protein RCOM_1217340 [Ricinus communis]	Back alignment and taxonomy information

>gi\|224099983\|ref\|XP_002311697.1\| predicted protein [Populus trichocarpa] gi\|222851517\|gb\|EEE89064.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224107517\|ref\|XP_002314508.1\| predicted protein [Populus trichocarpa] gi\|222863548\|gb\|EEF00679.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|147859667\|emb\|CAN83108.1\| hypothetical protein VITISV_026570 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225433273\|ref\|XP_002282144.1\| PREDICTED: uncharacterized protein LOC100256206 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356577606\|ref\|XP_003556915.1\| PREDICTED: uncharacterized protein LOC100779058 [Glycine max]	Back alignment and taxonomy information

>gi\|357439831\|ref\|XP_003590193.1\| hypothetical protein MTR_1g045780 [Medicago truncatula] gi\|355479241\|gb\|AES60444.1\| hypothetical protein MTR_1g045780 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357440915\|ref\|XP_003590735.1\| RNA-binding protein 12B [Medicago truncatula] gi\|355479783\|gb\|AES60986.1\| RNA-binding protein 12B [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		510
TAIR\|locus:2197868		601	AT1G04540 "AT1G04540" [Arabido	0.331	0.281	0.711	3.5e-80
TAIR\|locus:2041654		401	AT2G13350 "AT2G13350" [Arabido	0.274	0.349	0.6	1.2e-62
TAIR\|locus:2102980		391	AT3G04360 "AT3G04360" [Arabido	0.388	0.506	0.450	1.1e-42
TAIR\|locus:2124933		250	AT4G01200 "AT4G01200" [Arabido	0.254	0.52	0.468	8.6e-30
TAIR\|locus:2088334		360	AT3G16510 "AT3G16510" [Arabido	0.247	0.35	0.345	1.5e-10
TAIR\|locus:2172828		219	AT5G23950 "AT5G23950" [Arabido	0.247	0.575	0.338	6.9e-09
TAIR\|locus:504955431		289	AT4G15755 "AT4G15755" [Arabido	0.249	0.439	0.283	7.6e-07
TAIR\|locus:5019474737		367	AT2G40815 "AT2G40815" [Arabido	0.256	0.356	0.244	0.00023
TAIR\|locus:2025002		352	AT1G07310 "AT1G07310" [Arabido	0.252	0.366	0.276	0.00036

TAIR\|locus:2197868 AT1G04540 "AT1G04540" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 620 (223.3 bits), Expect = 3.5e-80, Sum P(3) = 3.5e-80
 Identities = 126/177 (71%), Positives = 146/177 (82%)

Query:     3 STILAPFQLLELNIISAQDLAPVSRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFV 62
             S +   FQLLELNIISAQDLAPV+R  +TYAVAWVH  RKL+TRVD +G  NPTWNDKFV
Sbjct:     2 SMMFPSFQLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFV 61

Query:    63 FRVDEDFLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPP---PT-RSLHHSHRSF- 117
             FRV+E+FL+ DTSAV+IEI+ALHWFRD+HVGTVRVL+ NLIPP   P  R+ ++ +R   
Sbjct:    62 FRVNEEFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTP 121

Query:   118 --GMRFVALQVRRPSGRPQGILNIGVALLDSSMRSMPLYTQL-SSALGYRHLMGEED 171
               GMRFVALQVRR SGRPQGILNIGV L+D SMRSMPLYT + SSA+GYR L+GEED
Sbjct:   122 PPGMRFVALQVRRTSGRPQGILNIGVGLIDGSMRSMPLYTHMDSSAVGYRDLLGEED 178

GO:0008150 "biological_process" evidence=ND

GO:0016020 "membrane" evidence=IDA

TAIR\|locus:2041654 AT2G13350 "AT2G13350" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2102980 AT3G04360 "AT3G04360" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2124933 AT4G01200 "AT4G01200" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2088334 AT3G16510 "AT3G16510" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2172828 AT5G23950 "AT5G23950" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504955431 AT4G15755 "AT4G15755" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:5019474737 AT2G40815 "AT2G40815" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2025002 AT1G07310 "AT1G07310" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh4_pg.C_LG_VIII001516	hypothetical protein (492 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		510
cd04051		125	cd04051, C2_SRC2_like, C2 domain present in Soybea	2e-38
pfam00168		85	pfam00168, C2, C2 domain	5e-10
cd00030		102	cd00030, C2, C2 domain	4e-09
smart00239		101	smart00239, C2, Protein kinase C conserved region	2e-08
cd00276		134	cd00276, C2B_Synaptotagmin, C2 domain second repea	4e-04
cd04019		150	cd04019, C2C_MCTP_PRT_plant, C2 domain third repea	0.002

>gnl\|CDD\|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins	Back alignment and domain information

 Score =  136 bits (344), Expect = 2e-38
 Identities = 53/131 (40%), Positives = 75/131 (57%), Gaps = 10/131 (7%)

Query: 12  LELNIISAQDLAPVS--RSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDEDF 69
           LE+ IISA+DL  V+    M+ YAV W+ P+ K ST VD  G  NPTWN+   F +DE  
Sbjct: 2   LEITIISAEDLKNVNLFGKMKVYAVVWIDPSHKQSTPVDRDGGTNPTWNETLRFPLDERL 61

Query: 70  LHNDTSAVMIEIFAL-HWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQVRR 128
           L     A+ IE++       D  +G VRV + +L       L  +  +  +RF++ Q+RR
Sbjct: 62  LQQGRLALTIEVYCERPSLGDKLIGEVRVPLKDL-------LDGASPAGELRFLSYQLRR 114

Query: 129 PSGRPQGILNI 139
           PSG+PQG+LN 
Sbjct: 115 PSGKPQGVLNF 125

SRC2 production is a response to pathogen infiltration. The initial response of increased Ca2+ concentrations are coupled to downstream signal transduction pathways via calcium binding proteins. SRC2 contains a single C2 domain which localizes to the plasma membrane and is involved in Ca2+ dependent protein binding. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. Length = 125

>gnl\|CDD\|215765 pfam00168, C2, C2 domain	Back alignment and domain information

>gnl\|CDD\|175973 cd00030, C2, C2 domain	Back alignment and domain information

>gnl\|CDD\|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB)	Back alignment and domain information

>gnl\|CDD\|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin	Back alignment and domain information

>gnl\|CDD\|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		510
cd04016		121	C2_Tollip C2 domain present in Toll-interacting pr	99.88
cd04051		125	C2_SRC2_like C2 domain present in Soybean genes Re	99.88
cd08681		118	C2_fungal_Inn1p-like C2 domain found in fungal Ing	99.85
cd04019		150	C2C_MCTP_PRT_plant C2 domain third repeat found in	99.82
cd04042		121	C2A_MCTP_PRT C2 domain first repeat found in Multi	99.81
cd04044		124	C2A_Tricalbin-like C2 domain first repeat present	99.81
cd04022		127	C2A_MCTP_PRT_plant C2 domain first repeat found in	99.8
cd08379		126	C2D_MCTP_PRT_plant C2 domain fourth repeat found i	99.79
cd04015		158	C2_plant_PLD C2 domain present in plant phospholip	99.79
cd08682		126	C2_Rab11-FIP_classI C2 domain found in Rab11-famil	99.79
cd04046		126	C2_Calpain C2 domain present in Calpain proteins.	99.79
cd08400		126	C2_Ras_p21A1 C2 domain present in RAS p21 protein	99.79
cd04033		133	C2_NEDD4_NEDD4L C2 domain present in the Human neu	99.79
cd04036		119	C2_cPLA2 C2 domain present in cytosolic PhosphoLip	99.78
cd08378		121	C2B_MCTP_PRT_plant C2 domain second repeat found i	99.78
cd08678		126	C2_C21orf25-like C2 domain found in the Human chro	99.77
cd08375		136	C2_Intersectin C2 domain present in Intersectin. A	99.76
cd08401		121	C2A_RasA2_RasA3 C2 domain first repeat present in	99.76
cd08395		120	C2C_Munc13 C2 domain third repeat in Munc13 (mamma	99.75
cd08677		118	C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a	99.75
cd08377		119	C2C_MCTP_PRT C2 domain third repeat found in Multi	99.75
cd08391		121	C2A_C2C_Synaptotagmin_like C2 domain first and thi	99.75
cd08382		123	C2_Smurf-like C2 domain present in Smad ubiquitina	99.74
cd08376		116	C2B_MCTP_PRT C2 domain second repeat found in Mult	99.74
cd08373		127	C2A_Ferlin C2 domain first repeat in Ferlin. Ferli	99.73
cd04025		123	C2B_RasA1_RasA4 C2 domain second repeat present in	99.73
cd04014		132	C2_PKC_epsilon C2 domain in Protein Kinase C (PKC)	99.73
cd04054		121	C2A_Rasal1_RasA4 C2 domain first repeat present in	99.72
cd04029		125	C2A_SLP-4_5 C2 domain first repeat present in Syna	99.72
cd08381		122	C2B_PI3K_class_II C2 domain second repeat present	99.72
cd04049		124	C2_putative_Elicitor-responsive_gene C2 domain pre	99.71
cd04024		128	C2A_Synaptotagmin-like C2 domain first repeat pres	99.71
cd04040		115	C2D_Tricalbin-like C2 domain fourth repeat present	99.71
cd08392		128	C2A_SLP-3 C2 domain first repeat present in Synapt	99.7
cd04010		148	C2B_RasA3 C2 domain second repeat present in RAS p	99.7
KOG1030		168	consensus Predicted Ca2+-dependent phospholipid-bi	99.7
cd08387		124	C2A_Synaptotagmin-8 C2A domain first repeat presen	99.7
cd08393		125	C2A_SLP-1_2 C2 domain first repeat present in Syna	99.69
cd04039		108	C2_PSD C2 domain present in Phosphatidylserine dec	99.68
cd04030		127	C2C_KIAA1228 C2 domain third repeat present in unc	99.68
cd04050		105	C2B_Synaptotagmin-like C2 domain second repeat pre	99.68
cd04011		111	C2B_Ferlin C2 domain second repeat in Ferlin. Ferl	99.68
cd08385		124	C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe	99.68
cd04043		126	C2_Munc13_fungal C2 domain in Munc13 (mammalian un	99.68
cd04021		125	C2_E3_ubiquitin_ligase C2 domain present in E3 ubi	99.68
cd08388		128	C2A_Synaptotagmin-4-11 C2A domain first repeat pre	99.68
cd04041		111	C2A_fungal C2 domain first repeat; fungal group. C	99.68
cd00275		128	C2_PLC_like C2 domain present in Phosphoinositide-	99.68
cd08680		124	C2_Kibra C2 domain found in Human protein Kibra. K	99.67
cd08394		127	C2A_Munc13 C2 domain first repeat in Munc13 (mamma	99.67
cd08685		119	C2_RGS-like C2 domain of the Regulator Of G-Protei	99.67
cd08521		123	C2A_SLP C2 domain first repeat present in Synaptot	99.67
cd08389		124	C2A_Synaptotagmin-14_16 C2A domain first repeat pr	99.67
PLN03008		868	Phospholipase D delta	99.67
cd08383		117	C2A_RasGAP C2 domain (first repeat) of Ras GTPase	99.66
cd04028		146	C2B_RIM1alpha C2 domain second repeat contained in	99.66
cd04017		135	C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl	99.66
cd08688		110	C2_KIAA0528-like C2 domain found in the Human KIAA	99.66
cd08691		137	C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li	99.66
cd04045		120	C2C_Tricalbin-like C2 domain third repeat present	99.65
cd04027		127	C2B_Munc13 C2 domain second repeat in Munc13 (mamm	99.65
cd04031		125	C2A_RIM1alpha C2 domain first repeat contained in	99.65
cd04052		111	C2B_Tricalbin-like C2 domain second repeat present	99.64
cd08386		125	C2A_Synaptotagmin-7 C2A domain first repeat presen	99.64
cd04009		133	C2B_Munc13-like C2 domain second repeat in Munc13	99.62
cd04013		146	C2_SynGAP_like C2 domain present in Ras GTPase act	99.62
cd08690		155	C2_Freud-1 C2 domain found in 5' repressor element	99.61
cd08390		123	C2A_Synaptotagmin-15-17 C2A domain first repeat pr	99.61
cd04038		145	C2_ArfGAP C2 domain present in Arf GTPase Activati	99.61
cd08406		136	C2B_Synaptotagmin-12 C2 domain second repeat prese	99.59
cd04018		151	C2C_Ferlin C2 domain third repeat in Ferlin. Ferli	99.59
cd08676		153	C2A_Munc13-like C2 domain first repeat in Munc13 (	99.58
cd04032		127	C2_Perforin C2 domain of Perforin. Perforin contai	99.58
cd04035		123	C2A_Rabphilin_Doc2 C2 domain first repeat present	99.58
cd08384		133	C2B_Rabphilin_Doc2 C2 domain second repeat present	99.58
cd08402		136	C2B_Synaptotagmin-1 C2 domain second repeat presen	99.58
cd08407		138	C2B_Synaptotagmin-13 C2 domain second repeat prese	99.57
cd08675		137	C2B_RasGAP C2 domain second repeat of Ras GTPase a	99.57
cd08409		137	C2B_Synaptotagmin-15 C2 domain second repeat prese	99.57
cd04020		162	C2B_SLP_1-2-3-4 C2 domain second repeat present in	99.56
cd08403		134	C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe	99.56
cd08404		136	C2B_Synaptotagmin-4 C2 domain second repeat presen	99.56
cd08410		135	C2B_Synaptotagmin-17 C2 domain second repeat prese	99.56
cd08408		138	C2B_Synaptotagmin-14_16 C2 domain second repeat pr	99.55
cd04048		120	C2A_Copine C2 domain first repeat in Copine. There	99.55
cd08405		136	C2B_Synaptotagmin-7 C2 domain second repeat presen	99.55
cd00276		134	C2B_Synaptotagmin C2 domain second repeat present	99.54
cd04026		131	C2_PKC_alpha_gamma C2 domain in Protein Kinase C (	99.53
KOG1028		421	consensus Ca2+-dependent phospholipid-binding prot	99.53
cd04037		124	C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli	99.52
PLN03200		2102	cellulose synthase-interactive protein; Provisiona	99.51
cd08686		118	C2_ABR C2 domain in the Active BCR (Breakpoint clu	99.49
PF00168		85	C2: C2 domain; InterPro: IPR000008 The C2 domain i	99.48
cd08692		135	C2B_Tac2-N C2 domain second repeat found in Tac2-N	99.44
PLN02270		808	phospholipase D alpha	99.43
cd04047		110	C2B_Copine C2 domain second repeat in Copine. Ther	99.42
smart00239		101	C2 Protein kinase C conserved region 2 (CalB). Ca2	99.31
cd00030		102	C2 C2 domain. The C2 domain was first identified i	99.24
cd08374		133	C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli	99.23
PLN02223		537	phosphoinositide phospholipase C	99.21
KOG0696		683	consensus Serine/threonine protein kinase [Signal	99.2
PLN02952		599	phosphoinositide phospholipase C	99.19
COG5038		1227	Ca2+-dependent lipid-binding protein, contains C2	99.11
PLN02230		598	phosphoinositide phospholipase C 4	99.05
PLN02352		758	phospholipase D epsilon	99.02
COG5038		1227	Ca2+-dependent lipid-binding protein, contains C2	99.0
PLN02222		581	phosphoinositide phospholipase C 2	99.0
KOG1011		1283	consensus Neurotransmitter release regulator, UNC-	98.99
PLN02228		567	Phosphoinositide phospholipase C	98.97
cd08689		109	C2_fungal_Pkc1p C2 domain found in protein kinase	98.95
KOG0169		746	consensus Phosphoinositide-specific phospholipase	98.94
KOG1028		421	consensus Ca2+-dependent phospholipid-binding prot	98.94
KOG2059		800	consensus Ras GTPase-activating protein [Signal tr	98.79
KOG1264		1267	consensus Phospholipase C [Lipid transport and met	98.55
KOG1328		1103	consensus Synaptic vesicle protein BAIAP3, involve	98.47
KOG1031		1169	consensus Predicted Ca2+-dependent phospholipid-bi	98.29
KOG1328		1103	consensus Synaptic vesicle protein BAIAP3, involve	98.29
KOG2059		800	consensus Ras GTPase-activating protein [Signal tr	97.77
KOG1013		362	consensus Synaptic vesicle protein rabphilin-3A [I	97.71
KOG0905		1639	consensus Phosphoinositide 3-kinase [Signal transd	97.69
KOG1011		1283	consensus Neurotransmitter release regulator, UNC-	97.3
KOG1265		1189	consensus Phospholipase C [Lipid transport and met	97.23
PLN02964		644	phosphatidylserine decarboxylase	97.22
cd08684		103	C2A_Tac2-N C2 domain first repeat found in Tac2-N	97.2
PF10358		143	NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins;	97.16
KOG1326		1105	consensus Membrane-associated protein FER-1 and re	97.12
KOG1013		362	consensus Synaptic vesicle protein rabphilin-3A [I	96.66
cd08693		173	C2_PI3K_class_I_beta_delta C2 domain present in cl	96.57
cd08683		143	C2_C2cd3 C2 domain found in C2 calcium-dependent d	96.53
cd08380		156	C2_PI3K_like C2 domain present in phosphatidylinos	96.44
cd08398		158	C2_PI3K_class_I_alpha C2 domain present in class I	96.36
KOG3837		523	consensus Uncharacterized conserved protein, conta	95.83
KOG1326		1105	consensus Membrane-associated protein FER-1 and re	95.71
cd04012		171	C2A_PI3K_class_II C2 domain first repeat present i	95.44
PF11618		107	DUF3250: Protein of unknown function (DUF3250); In	95.24
cd08399		178	C2_PI3K_class_I_gamma C2 domain present in class I	95.02
KOG2060		405	consensus Rab3 effector RIM1 and related proteins,	94.81
cd08397		159	C2_PI3K_class_III C2 domain present in class III p	94.54
PF15627		156	CEP76-C2: CEP76 C2 domain	94.46
PF00792		142	PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I	93.82
KOG1452		442	consensus Predicted Rho GTPase-activating protein	93.03
PF14429		184	DOCK-C2: C2 domain in Dock180 and Zizimin proteins	91.99
cd08687		98	C2_PKN-like C2 domain in Protein kinase C-like (PK	91.38
KOG1327		529	consensus Copine [Signal transduction mechanisms]	90.11
cd08695		189	C2_Dock-B C2 domains found in Dedicator Of CytoKin	88.59
cd08679		178	C2_DOCK180_related C2 domains found in Dedicator O	88.48
cd08694		196	C2_Dock-A C2 domains found in Dedicator Of CytoKin	88.07
PF12416		340	DUF3668: Cep120 protein; InterPro: IPR022136 This	86.76
smart00142		100	PI3K_C2 Phosphoinositide 3-kinase, region postulat	86.61
PF15625		168	CC2D2AN-C2: CC2D2A N-terminal C2 domain	84.58

>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip)	Back alignment and domain information

Probab=99.88  E-value=6.1e-22  Score=175.53  Aligned_cols=117  Identities=19%  Similarity=0.288  Sum_probs=97.1

Q ss_pred             ceEEEEEEEEecCCCCC-CCCCCcEEEEEEcCCCeeEeeecCCCCCCceeceEEEEEecCCCCCCCCceEEEEEEeecCC
Q 041258            9 FQLLELNIISAQDLAPV-SRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDEDFLHNDTSAVMIEIFALHWF   87 (510)
Q Consensus         9 ~gtLEVTVISAqdLk~v-~GKmDPYVVV~I~pd~K~rTrVdr~Gg~NPvWNEkF~F~V~e~~L~~~~s~L~VEVyD~d~~   87 (510)
                      .|+|+|+|++|++|++. .+++||||+++++ .++++|+|+.+++.||+|||+|.|.|++.     ...|.|+|||++.+
T Consensus         1 ~g~L~v~v~~Ak~l~~~~~g~sDPYv~i~lg-~~~~kT~v~~~~~~nP~WNe~F~f~v~~~-----~~~l~~~V~d~d~~   74 (121)
T cd04016           1 VGRLSITVVQAKLVKNYGLTRMDPYCRIRVG-HAVYETPTAYNGAKNPRWNKTIQCTLPEG-----VDSIYIEIFDERAF   74 (121)
T ss_pred             CcEEEEEEEEccCCCcCCCCCCCceEEEEEC-CEEEEeEEccCCCCCCccCeEEEEEecCC-----CcEEEEEEEeCCCC
Confidence            37999999999999887 4999999999995 57889999988899999999999999864     35799999999966


Q ss_pred             -CCcceEEEEEeCcc-cCCCCCCCCCCCCCcccceEEEEEeeCCCC-CcceEEEEEEEE
Q 041258           88 -RDMHVGTVRVLVGN-LIPPPTRSLHHSHRSFGMRFVALQVRRPSG-RPQGILNIGVAL  143 (510)
Q Consensus        88 -gDdlIGeVrVPLsd-Ll~~~~R~~h~~~~~~~~r~vsyqLrrpSG-KpqG~LnLsV~f  143 (510)
                       +|++||++.|+|.+ +..+..            ...||+|....+ +..|.|+|.++|
T Consensus        75 ~~dd~iG~~~i~l~~~~~~g~~------------~~~W~~L~~~~~~~~~g~i~l~l~y  121 (121)
T cd04016          75 TMDERIAWTHITIPESVFNGET------------LDDWYSLSGKQGEDKEGMINLVFSY  121 (121)
T ss_pred             cCCceEEEEEEECchhccCCCC------------ccccEeCcCccCCCCceEEEEEEeC
Confidence             68999999999974 554331            234788865444 468999999985

Tollip is a part of the Interleukin-1 receptor (IL-1R) signaling pathway. Tollip is proposed to link serine/threonine kinase IRAK to IL-1Rs as well as inhibiting phosphorylation of IRAK. There is a single C2 domain present in Tollip. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice varian

>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins	Back alignment and domain information

>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins	Back alignment and domain information

>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset	Back alignment and domain information

>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP)	Back alignment and domain information

>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins	Back alignment and domain information

>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset	Back alignment and domain information

>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset	Back alignment and domain information

>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD)	Back alignment and domain information

>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I	Back alignment and domain information

>cd04046 C2_Calpain C2 domain present in Calpain proteins	Back alignment and domain information

>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1)	Back alignment and domain information

>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42)	Back alignment and domain information

>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2)	Back alignment and domain information

>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset	Back alignment and domain information

>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein	Back alignment and domain information

>cd08375 C2_Intersectin C2 domain present in Intersectin	Back alignment and domain information

>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3	Back alignment and domain information

>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins	Back alignment and domain information

>cd08677 C2A_Synaptotagmin-13 C2 domain	Back alignment and domain information

>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP)	Back alignment and domain information

>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins	Back alignment and domain information

>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins	Back alignment and domain information

>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP)	Back alignment and domain information

>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin	Back alignment and domain information

>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4	Back alignment and domain information

>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon	Back alignment and domain information

>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4	Back alignment and domain information

>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5	Back alignment and domain information

>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks)	Back alignment and domain information

>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene	Back alignment and domain information

>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins	Back alignment and domain information

>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins	Back alignment and domain information

>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3	Back alignment and domain information

>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3)	Back alignment and domain information

>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only]	Back alignment and domain information

>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8	Back alignment and domain information

>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2	Back alignment and domain information

>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD)	Back alignment and domain information

>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins	Back alignment and domain information

>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins	Back alignment and domain information

>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin	Back alignment and domain information

>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10	Back alignment and domain information

>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group	Back alignment and domain information

>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase	Back alignment and domain information

>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11	Back alignment and domain information

>cd04041 C2A_fungal C2 domain first repeat; fungal group	Back alignment and domain information

>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC)	Back alignment and domain information

>cd08680 C2_Kibra C2 domain found in Human protein Kibra	Back alignment and domain information

>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins	Back alignment and domain information

>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family	Back alignment and domain information

>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins	Back alignment and domain information

>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16	Back alignment and domain information

>PLN03008 Phospholipase D delta	Back alignment and domain information

>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs)	Back alignment and domain information

>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins	Back alignment and domain information

>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin	Back alignment and domain information

>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone	Back alignment and domain information

>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1)	Back alignment and domain information

>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins	Back alignment and domain information

>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins	Back alignment and domain information

>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins	Back alignment and domain information

>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins	Back alignment and domain information

>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7	Back alignment and domain information

>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins	Back alignment and domain information

>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family	Back alignment and domain information

>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1)	Back alignment and domain information

>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17	Back alignment and domain information

>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP)	Back alignment and domain information

>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12	Back alignment and domain information

>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin	Back alignment and domain information

>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins	Back alignment and domain information

>cd04032 C2_Perforin C2 domain of Perforin	Back alignment and domain information

>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain	Back alignment and domain information

>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain	Back alignment and domain information

>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1	Back alignment and domain information

>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13	Back alignment and domain information

>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs)	Back alignment and domain information

>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15	Back alignment and domain information

>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4	Back alignment and domain information

>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10	Back alignment and domain information

>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4	Back alignment and domain information

>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17	Back alignment and domain information

>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16	Back alignment and domain information

>cd04048 C2A_Copine C2 domain first repeat in Copine	Back alignment and domain information

>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7	Back alignment and domain information

>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin	Back alignment and domain information

>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma	Back alignment and domain information

>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin	Back alignment and domain information

>PLN03200 cellulose synthase-interactive protein; Provisional	Back alignment and domain information

>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein	Back alignment and domain information

>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking	Back alignment and domain information

>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus)	Back alignment and domain information

>PLN02270 phospholipase D alpha	Back alignment and domain information

>cd04047 C2B_Copine C2 domain second repeat in Copine	Back alignment and domain information

>smart00239 C2 Protein kinase C conserved region 2 (CalB)	Back alignment and domain information

>cd00030 C2 C2 domain	Back alignment and domain information

>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin	Back alignment and domain information

>PLN02223 phosphoinositide phospholipase C	Back alignment and domain information

>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PLN02952 phosphoinositide phospholipase C	Back alignment and domain information

>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only]	Back alignment and domain information

>PLN02230 phosphoinositide phospholipase C 4	Back alignment and domain information

>PLN02352 phospholipase D epsilon	Back alignment and domain information

>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only]	Back alignment and domain information

>PLN02222 phosphoinositide phospholipase C 2	Back alignment and domain information

>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PLN02228 Phosphoinositide phospholipase C	Back alignment and domain information

>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae	Back alignment and domain information

>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms]	Back alignment and domain information

>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG1264 consensus Phospholipase C [Lipid transport and metabolism]	Back alignment and domain information

>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms]	Back alignment and domain information

>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only]	Back alignment and domain information

>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms]	Back alignment and domain information

>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1265 consensus Phospholipase C [Lipid transport and metabolism]	Back alignment and domain information

>PLN02964 phosphatidylserine decarboxylase	Back alignment and domain information

>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus)	Back alignment and domain information

>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen []	Back alignment and domain information

>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks)	Back alignment and domain information

>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins	Back alignment and domain information

>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks)	Back alignment and domain information

>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks)	Back alignment and domain information

>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only]	Back alignment and domain information

>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks)	Back alignment and domain information

>PF11618 DUF3250: Protein of unknown function (DUF3250); InterPro: IPR021656 This family of proteins represents a protein with unknown function	Back alignment and domain information

>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks)	Back alignment and domain information

>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks)	Back alignment and domain information

>PF15627 CEP76-C2: CEP76 C2 domain	Back alignment and domain information

>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2	Back alignment and domain information

>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms]	Back alignment and domain information

>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A	Back alignment and domain information

>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins	Back alignment and domain information

>KOG1327 consensus Copine [Signal transduction mechanisms]	Back alignment and domain information

>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins	Back alignment and domain information

>cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins	Back alignment and domain information

>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins	Back alignment and domain information

>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length	Back alignment and domain information

>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain	Back alignment and domain information

>PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		510
1wfj_A		136	Putative elicitor-responsive gene; C2 domain, rike	3e-06
2fk9_A		157	Protein kinase C, ETA type; ATP-binding, metal-bin	4e-06
1gmi_A		136	Protein kinase C, epsilon type; PKC, C2 domain, X-	7e-06
2r83_A		284	Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel	4e-05
1rlw_A		126	Phospholipase A2, CALB domain; hydrolase, C2 domai	4e-05
2nq3_A		173	Itchy homolog E3 ubiquitin protein ligase; C2 doma	2e-04
3b7y_A		153	E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-	4e-04
1rsy_A		152	Synaptotagmin I; calcium/phospholipid binding prot	8e-04
3f04_A		143	Synaptotagmin-1; C2A, calcium, cell junction, cyto	8e-04
2dmh_A		140	Myoferlin; beta-sandwich, FER-1-like protein 3, mu	9e-04

>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136	Back alignment and structure

 Score = 45.8 bits (109), Expect = 3e-06
 Identities = 20/98 (20%), Positives = 35/98 (35%), Gaps = 9/98 (9%)

Query: 11  LLELNIISAQDLAP--VSRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDED 68
            LE+ ++SA+ L       +M  Y        +   + V       P WN+ F+F V   
Sbjct: 11  TLEVVLVSAKGLEDADFLNNMDPYVQLTCR-TQDQKSNVAEGMGTTPEWNETFIFTV--- 66

Query: 69  FLHNDTSAVMIEIFALHWF-RDMHVGTVRVLVGNLIPP 105
                T+ +  +IF       D  VG   + +  +   
Sbjct: 67  --SEGTTELKAKIFDKDVGTEDDAVGEATIPLEPVFVE 102

PyMOL of 1wfj

>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157	Back alignment and structure

>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136	Back alignment and structure

>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284	Back alignment and structure

>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126	Back alignment and structure

>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173	Back alignment and structure

>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153	Back alignment and structure

>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152	Back alignment and structure

>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143	Back alignment and structure

>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		510
1wfj_A		136	Putative elicitor-responsive gene; C2 domain, rike	99.85
2dmh_A		140	Myoferlin; beta-sandwich, FER-1-like protein 3, mu	99.83
3b7y_A		153	E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-	99.82
2ep6_A		133	MCTP2 protein; beta sandwich, Ca2+ binding, membra	99.82
1gmi_A		136	Protein kinase C, epsilon type; PKC, C2 domain, X-	99.81
1rlw_A		126	Phospholipase A2, CALB domain; hydrolase, C2 domai	99.81
3m7f_B		176	E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1	99.81
2fk9_A		157	Protein kinase C, ETA type; ATP-binding, metal-bin	99.8
3kwu_A		148	MUNC13-1; calcium binding protein, phospholipid bi	99.8
2nq3_A		173	Itchy homolog E3 ubiquitin protein ligase; C2 doma	99.8
2cjt_A		131	UNC-13 homolog A, MUNC13-1; phorbol-ester binding,	99.79
3pyc_A		132	E3 ubiquitin-protein ligase smurf1; phospholipid b	99.78
2cjs_A		167	UNC-13 homolog A, MUNC13-1; neurotransmitter trans	99.74
1ugk_A		138	Synaptotagmin IV, KIAA1342; beta sandwich, structu	99.73
1v27_A		141	Regulating synaptic membrane exocytosis protein 2;	99.73
2d8k_A		141	Synaptotagmin VII; exocytosis, calcium binding, ly	99.72
2chd_A		142	Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium	99.72
1a25_A		149	CALB, protein kinase C (beta); calcium++/phospholi	99.71
2b3r_A		134	Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA	99.71
2enp_A		147	B/K protein; C2 type 1,beta sandwich, structural g	99.71
2bwq_A		129	Regulating synaptic membrane exocytosis protein 2;	99.71
3f04_A		143	Synaptotagmin-1; C2A, calcium, cell junction, cyto	99.71
1rsy_A		152	Synaptotagmin I; calcium/phospholipid binding prot	99.71
2dmg_A		142	KIAA1228 protein; beta-sandwich, structural genomi	99.7
2r83_A		284	Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel	99.7
3fdw_A		148	Synaptotagmin-like protein 4; structural genomics,	99.7
1wfm_A		138	Synaptotagmin XIII; C2 domain, exocytosis, neurotr	99.7
2z0u_A		155	WW domain-containing protein 1; C2 domain, alterna	99.69
3rdl_A		137	Protein kinase C alpha type; protein kinase PKC, t	99.69
1rh8_A		142	Piccolo protein; beta-sandwich, metal binding prot	99.68
3n5a_A		138	Synaptotagmin-7; calcium/phospholipid binding prot	99.68
3fbk_A		153	RGS3, RGP3, regulator of G-protein signaling 3; al	99.68
1tjx_A		159	Similar to synaptotagmini/P65; C2B domain, calcium	99.67
2q3x_A		171	Regulating synaptic membrane exocytosis protein 1;	99.66
1w15_A		153	Synaptotagmin IV; metal binding protein, endocytos	99.66
2cm5_A		166	Rabphilin-3A; protein transport, zinc-finger, Ca2+	99.66
3l9b_A		144	Otoferlin; C2-domain, beta-sheets, cell membrane,	99.64
1dqv_A		296	Synaptotagmin III; beta sandwich, calcium ION, C2	99.63
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	99.59
3jzy_A		510	Intersectin 2; C2 domain, structural genomics cons	99.58
2r83_A		284	Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel	99.49
3nsj_A		540	Perforin-1; pore forming protein, immune system; H	99.47
1cjy_A		749	CPLA2, protein (cytosolic phospholipase A2); lipid	99.44
3bxj_A		483	RAS GTPase-activating protein syngap; GTPase activ	99.44
3qr0_A		816	Phospholipase C-beta (PLC-beta); PH domain, EF han	99.42
3ohm_B		885	1-phosphatidylinositol-4,5-bisphosphate phosphodi	99.41
1dqv_A		296	Synaptotagmin III; beta sandwich, calcium ION, C2	99.4
2zkm_X		799	1-phosphatidylinositol-4,5-bisphosphate phosphodie	99.38
3pfq_A		674	PKC-B, PKC-beta, protein kinase C beta type; phosp	99.21
1yrk_A		126	NPKC-delta, protein kinase C, delta type; C2 domai	98.68
2enj_A		138	NPKC-theta, protein kinase C theta type; beta-sand	98.53
2yrb_A		156	Protein fantom; beta sandwich, NPPSFA, national pr	95.85
3hhm_A		1091	Phosphatidylinositol-4,5-bisphosphate 3-kinase cat	92.26
2wxf_A		940	Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca	91.69
3l4c_A		220	Dedicator of cytokinesis protein 1; DOCK180, DOCK1	86.6
1e7u_A		961	Phosphatidylinositol 3-kinase catalytic subunit; p	85.02
2y3a_A		1092	Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca	82.9

>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2	Back alignment and structure

Probab=99.85  E-value=3.9e-21  Score=164.93  Aligned_cols=126  Identities=21%  Similarity=0.292  Sum_probs=106.7

Q ss_pred             ccccceEEEEEEEEecCCCCC--CCCCCcEEEEEEcCCCeeEeeecCCCCCCceeceEEEEEecCCCCCCCCceEEEEEE
Q 041258            5 ILAPFQLLELNIISAQDLAPV--SRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDEDFLHNDTSAVMIEIF   82 (510)
Q Consensus         5 ~~~P~gtLEVTVISAqdLk~v--~GKmDPYVVV~I~pd~K~rTrVdr~Gg~NPvWNEkF~F~V~e~~L~~~~s~L~VEVy   82 (510)
                      ...+.+.|+|+|++|++|+..  .+++||||++++.+ ++.+|++.++++.||+|||+|.|.+.+.     ...|.|+||
T Consensus         5 ~~~~~~~L~v~v~~a~~L~~~d~~g~~dpyv~v~~~~-~~~kT~~~~~~~~nP~Wne~f~f~v~~~-----~~~l~~~V~   78 (136)
T 1wfj_A            5 SSGPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRT-QDQKSNVAEGMGTTPEWNETFIFTVSEG-----TTELKAKIF   78 (136)
T ss_dssp             CCCCEEEEEEEEEEEEECSSCCSSCSSCCCEEEESSS-CEEECCCCTTCCSSCEEEEEEEEEEESS-----CCEEEEEEC
T ss_pred             CCCCcEEEEEEEEeccCCCCcccCCCcCceEEEEECC-ccceeEeccCCCCCCccCcEEEEEECCC-----CCEEEEEEE
Confidence            345789999999999999986  48999999999975 5789999875699999999999999862     568999999


Q ss_pred             eecCC-CCcceEEEEEeCcccCCCCCCCCCCCCCcccceEEEEEeeCCCCCcceEEEEEEEEeeCCC
Q 041258           83 ALHWF-RDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQVRRPSGRPQGILNIGVALLDSSM  148 (510)
Q Consensus        83 D~d~~-gDdlIGeVrVPLsdLl~~~~R~~h~~~~~~~~r~vsyqLrrpSGKpqG~LnLsV~f~d~sm  148 (510)
                      |++.+ +|++||++.|+|.+++..+           .....||+|. ++++..|.|+|.+.|.+...
T Consensus        79 d~~~~~~d~~lG~~~i~l~~l~~~~-----------~~~~~w~~L~-~~~~~~G~i~l~l~~~p~~~  133 (136)
T 1wfj_A           79 DKDVGTEDDAVGEATIPLEPVFVEG-----------SIPPTAYNVV-KDEEYKGEIWVALSFKPSGP  133 (136)
T ss_dssp             CSSSCTTTCCSEEEEEESHHHHHHS-----------EEEEEEEEEE-ETTEEEEEEEEEEEEEECCS
T ss_pred             ECCCCCCCceEEEEEEEHHHhccCC-----------CCCcEEEEee-cCCccCEEEEEEEEEEeCCC
Confidence            99966 6999999999999996432           1234578887 67889999999999998754

PyMOL of 1wfj

>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A	Back alignment and structure

>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1	Back alignment and structure

>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1	Back alignment and structure

>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1	Back alignment and structure

>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus}	Back alignment and structure

>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens}	Back alignment and structure

>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A*	Back alignment and structure

>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1	Back alignment and structure

>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1	Back alignment and structure

>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A	Back alignment and structure

>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1	Back alignment and structure

>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2	Back alignment and structure

>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2	Back alignment and structure

>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A	Back alignment and structure

>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2	Back alignment and structure

>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus}	Back alignment and structure

>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2	Back alignment and structure

>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A*	Back alignment and structure

>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2	Back alignment and structure

>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2	Back alignment and structure

>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens}	Back alignment and structure

>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2	Back alignment and structure

>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens}	Back alignment and structure

>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2	Back alignment and structure

>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus}	Back alignment and structure

>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0	Back alignment and structure

>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A*	Back alignment and structure

>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus}	Back alignment and structure

>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A	Back alignment and structure

>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A	Back alignment and structure

>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus}	Back alignment and structure

>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A	Back alignment and structure

>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B	Back alignment and structure

>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2	Back alignment and structure

>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus}	Back alignment and structure

>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A	Back alignment and structure

>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus}	Back alignment and structure

>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A	Back alignment and structure

>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens}	Back alignment and structure

>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A	Back alignment and structure

>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B	Back alignment and structure

>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A	Back alignment and structure

>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A	Back alignment and structure

>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2yrb_A Protein fantom; beta sandwich, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.7.1.1	Back alignment and structure

>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A	Back alignment and structure

>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A*	Back alignment and structure

>3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens}	Back alignment and structure

>2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		510
d1qasa2		131	b.7.1.1 (A:626-756) PI-specific phospholipase C is	2e-06
d1wfja_		136	b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr	1e-04
d2cm5a1		137	b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (	2e-04
d2bwqa1		125	b.7.1.2 (A:729-853) Regulating synaptic membrane e	3e-04
d1w15a_		138	b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi	4e-04
d1a25a_		132	b.7.1.2 (A:) C2 domain from protein kinase c (beta	5e-04
d2ep6a1		126	b.7.1.1 (A:92-217) Multiple C2 and transmembrane d	0.004

>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131	Back information, alignment and structure


class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 44.8 bits (105), Expect = 2e-06
 Identities = 23/130 (17%), Positives = 43/130 (33%), Gaps = 15/130 (11%)

Query: 10  QLLELNIISAQDLAPVSRS----MRTYAVAWVHP----NRKLSTRVDAHGRNNPTWNDKF 61
           + L + IIS Q L  V+++    +    +  +H          T V  +   NP W+ +F
Sbjct: 4   ERLRVRIISGQQLPKVNKNKNSIVDPKVIVEIHGVGRDTGSRQTAVITNNGFNPRWDMEF 63

Query: 62  VFRVDEDFLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPP----PTRSLHHSHRSF 117
            F V    L      V          ++  +G   +   +L          S +      
Sbjct: 64  EFEVTVPDLALVRFMVEDYD---SSSKNDFIGQSTIPWNSLKQGYRHVHLLSKNGDQHPS 120

Query: 118 GMRFVALQVR 127
              FV + ++
Sbjct: 121 ATLFVKISIQ 130

PyMOL of d1qasa2

>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136	Back information, alignment and structure

>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137	Back information, alignment and structure

>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125	Back information, alignment and structure

>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138	Back information, alignment and structure

>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132	Back information, alignment and structure

>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		510
d1wfja_		136	C2 domain protein At1g63220 {Thale cress (Arabidop	99.88
d2ep6a1		126	Multiple C2 and transmembrane domain-containing pr	99.85
d1rlwa_		126	Domain from cytosolic phospholipase A2 {Human (Hom	99.82
d1gmia_		136	Domain from protein kinase C epsilon {Rat (Rattus	99.8
d1qasa2		131	PI-specific phospholipase C isozyme D1 (PLC-D1), C	99.79
d2nq3a1		133	E3 ubiquitin-protein ligase Itchy {Human (Homo sap	99.79
d2cjta1		128	Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId:	99.72
d1a25a_		132	C2 domain from protein kinase c (beta) {Rat (Rattu	99.7
d1dqva1		130	Synaptotagmin III {Rat (Rattus norvegicus) [TaxId:	99.69
d1rsya_		143	Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10	99.68
d1ugka_		138	Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960	99.66
d2bwqa1		125	Regulating synaptic membrane exocytosis protein, r	99.65
d1wfma_		138	Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9	99.64
d1rh8a_		142	Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]}	99.63
d2cm5a1		137	C2b-domain of rabphilin {Rat (Rattus norvegicus) [	99.59
d1bdya_		123	Domain from protein kinase C delta {Rat (Rattus no	99.58
d1w15a_		138	Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId:	99.57
d1uowa_		157	Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10	99.56
d2zkmx2		122	Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI	99.52
d1dqva2		145	Synaptotagmin III {Rat (Rattus norvegicus) [TaxId:	99.5
d1e7ua2		174	Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa)	95.67
d2yrba1		142	Fantom {Human (Homo sapiens) [TaxId: 9606]}	92.14

>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: C2 domain protein At1g63220
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.88  E-value=1.1e-22  Score=174.67  Aligned_cols=125  Identities=21%  Similarity=0.311  Sum_probs=104.8

Q ss_pred             cccceEEEEEEEEecCCCCC--CCCCCcEEEEEEcCCCeeEeeecCCCCCCceeceEEEEEecCCCCCCCCceEEEEEEe
Q 041258            6 LAPFQLLELNIISAQDLAPV--SRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVDEDFLHNDTSAVMIEIFA   83 (510)
Q Consensus         6 ~~P~gtLEVTVISAqdLk~v--~GKmDPYVVV~I~pd~K~rTrVdr~Gg~NPvWNEkF~F~V~e~~L~~~~s~L~VEVyD   83 (510)
                      ..|.|+|+|+|++|++|++.  .+++||||++++.+ ++.+|++++++++||+|||+|.|.|.+.     ...|+|+|||
T Consensus         6 ~~p~G~L~V~v~~a~~L~~~d~~g~~Dpyv~v~~~~-~~~~t~~~~~~~~nP~Wne~f~f~v~~~-----~~~L~v~V~d   79 (136)
T d1wfja_           6 SGPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRT-QDQKSNVAEGMGTTPEWNETFIFTVSEG-----TTELKAKIFD   79 (136)
T ss_dssp             CCCEEEEEEEEEEEEECSSCCSSCSSCCCEEEESSS-CEEECCCCTTCCSSCEEEEEEEEEEESS-----CCEEEEEECC
T ss_pred             CCCcEEEEEEEEEeeCCCCCCCCCCCCccEEEEEee-eeEEEEEEecCCCcEEEeeEEEEEEcCc-----cceEEEEEEE
Confidence            56789999999999999987  48999999999964 6778888877799999999999999874     3569999999


Q ss_pred             ecCC-CCcceEEEEEeCcccCCCCCCCCCCCCCcccceEEEEEeeCCCCCcceEEEEEEEEeeCCC
Q 041258           84 LHWF-RDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQVRRPSGRPQGILNIGVALLDSSM  148 (510)
Q Consensus        84 ~d~~-gDdlIGeVrVPLsdLl~~~~R~~h~~~~~~~~r~vsyqLrrpSGKpqG~LnLsV~f~d~sm  148 (510)
                      ++.+ .|++||.+.|||.+++....           ....++.|.. +++.+|.|+|.+.|.+...
T Consensus        80 ~d~~~~d~~iG~~~i~L~~l~~~~~-----------~~~~~~~l~~-~~~~~G~i~l~l~~~p~~p  133 (136)
T d1wfja_          80 KDVGTEDDAVGEATIPLEPVFVEGS-----------IPPTAYNVVK-DEEYKGEIWVALSFKPSGP  133 (136)
T ss_dssp             SSSCTTTCCSEEEEEESHHHHHHSE-----------EEEEEEEEEE-TTEEEEEEEEEEEEEECCS
T ss_pred             ecCCCCCCEEEEEEEEhHHhcccCC-----------cCcEEEEecC-CCccCEEEEEEEEEEeCCC
Confidence            9866 78999999999999875331           2334677764 6788999999999988654

PyMOL of d1wfja_

>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2yrba1 b.7.1.1 (A:596-737) Fantom {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure