Citrus Sinensis ID: 041343

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MSYLHLVMRDIPVRVRSRAQDLHFRPGGGQTHWASHGRIIISAFAIDKLKADIIAHTAFGSSFAEGRETLEAQAELQECCAASISDIFIPGSQHLYNGLALLHWQAKLREEVLEYCGIGIPDADILSNLKLVNMVLLEALRLYSPVIRLYRQGSQEDAEEFSPLRFINGVTKAARNPNAMLAFGAGPRACIGQKIEF
ccccHHHHcccHHHHHHHHHHHcccccccccHHHcccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcEEccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccEEEEccccccccccHHcccccccccccccccccccccccccccccEEEcccccccccccccccc
cccHEHHHHHccHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcHHHHHHHHHHHHccccHHHHEEEccccccHccccHHcccccccccccccEEEEccccccccccccccc
MSYLHLVMrdipvrvrsraqdlhfrpgggqthwasHGRIIISAFAIDKLKADIIAHtafgssfaEGRETLEAQAELQECCAAsisdifipgsqhLYNGLALLHWQAKLREEVLEYCgigipdadilSNLKLVNMVLLEALRLYSPVIRLYrqgsqedaeefsplrfingvtkaarnpnamlafgagpracigqkief
MSYLHLVMRDIPVrvrsraqdlhfrpgggqthwasHGRIIISAFAIDKLKADIIAHTAFGSSFAEGRETLEAQAELQECCAASISDIFIPGSQHLYNGLALLHWQAKLREEVLEYCGIGIPDADILSNLKLVNMVLLEALRLYSPVIRLYRQGsqedaeefsPLRFINGVTKAARNPNAMLAFGAGPRACIGQKIEF
MSYLHLVMRDIPVRVRSRAQDLHFRPGGGQTHWASHGRIIISAFAIDKLKADIIAHTAFGSSFAEGRETleaqaelqeccaaSISDIFIPGSQHLYNGLALLHWQAKLREEVLEYCGIGIPDADILSNLKLVNMVLLEALRLYSPVIRLYRQGSQEDAEEFSPLRFINGVTKAARNPNAMLAFGAGPRACIGQKIEF
***LHLVMRDIPVRVRSRAQDLHFRPGGGQTHWASHGRIIISAFAIDKLKADIIAHTAFGSSFAEGRETLEAQAELQECCAASISDIFIPGSQHLYNGLALLHWQAKLREEVLEYCGIGIPDADILSNLKLVNMVLLEALRLYSPVIRLYRQG*******FSPLRFINGVTKAARNPNAMLAFGAGPRACI******
****H**MRDIPVRVR********************GRIIISAFAIDKLKADIIAHTAFGSSFAE*****EAQAELQECCAASISDIFIPGSQHLYNGLALLHWQAKLREEVLEYCGIGIPDADILSNLKLVNMVLLEALRLYSPVIRLYRQGSQEDAEEFSPLRFINGVTKAARNPNAMLAFGAGPRACIGQKIEF
MSYLHLVMRDIPVRVRSRAQDLHFRPGGGQTHWASHGRIIISAFAIDKLKADIIAHTAFGSSFAEGRETLEAQAELQECCAASISDIFIPGSQHLYNGLALLHWQAKLREEVLEYCGIGIPDADILSNLKLVNMVLLEALRLYSPVIRLYRQGSQEDAEEFSPLRFINGVTKAARNPNAMLAFGAGPRACIGQKIEF
*SYLHLVMRDIPVRVRSRAQDLHFRPGGGQTHWASHGRIIISAFAIDKLKADIIAHTAFGSS**********QAELQECCAASISDIFIPGSQHLYNGLALLHWQAKLREEVLEYCGIGIPDADILSNLKLVNMVLLEALRLYSPVIRLYRQGSQEDAEEFSPLRFINGVTKAARNPNAMLAFGAGPRACIGQKIEF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYLHLVMRDIPVRVRSRAQDLHFRPGGGQTHWASHGRIIISAFAIDKLKADIIAHTAFGSSFAEGRETLEAQAELQECCAASISDIFIPGSQHLYNGLALLHWQAKLREEVLEYCGIGIPDADILSNLKLVNMVLLEALRLYSPVIRLYRQGSQEDAEEFSPLRFINGVTKAARNPNAMLAFGAGPRACIGQKIEF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query197 2.2.26 [Sep-21-2011]
Q05047524 Secologanin synthase OS=C N/A no 0.456 0.171 0.383 3e-15
B9X287542 Cytochrome P450 734A6 OS= no no 0.583 0.212 0.318 5e-14
O48786520 Cytochrome P450 734A1 OS= no no 0.624 0.236 0.305 6e-14
Q6Z6D6557 Cytochrome P450 734A2 OS= no no 0.583 0.206 0.306 2e-13
Q9SHG5519 Cytochrome P450 72C1 OS=A no no 0.609 0.231 0.320 1e-12
Q69XM6538 Cytochrome P450 734A4 OS= no no 0.619 0.226 0.284 5e-11
Q8LIF2537 Cytochrome P450 734A5 OS= no no 0.558 0.204 0.309 3e-09
Q9ZW95512 Cytokinin hydroxylase OS= no no 0.441 0.169 0.330 3e-09
Q9FF18518 Cytokinin hydroxylase OS= no no 0.446 0.169 0.327 2e-07
Q64462511 Cytochrome P450 4B1 OS=Mu yes no 0.446 0.172 0.322 4e-07
>sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 Back     alignment and function desciption
 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 62/120 (51%), Gaps = 30/120 (25%)

Query: 104 WQAKLREEVLEYCGIGIPDADILSNLKLVNMVLLEALRLYSPVIRLYR------------ 151
           WQ + REEVL+  G   P+ + L++LK V+M+L E LRLY PVI L +            
Sbjct: 354 WQERAREEVLQAFGKNKPEFERLNHLKYVSMILYEVLRLYPPVIDLTKIVHKDTKLGSYT 413

Query: 152 --QGSQ----------------EDAEEFSPLRFINGVTKAARNPNAMLAFGAGPRACIGQ 193
              G+Q                EDA EF+P+RF++GV  A +N    L F  GPR C+GQ
Sbjct: 414 IPAGTQVMLPTVMLHREKSIWGEDAMEFNPMRFVDGVANATKNNVTYLPFSWGPRVCLGQ 473
Converts loganin into secologanin.
Catharanthus roseus (taxid: 4058)
EC: 1EC: .EC: 3EC: .EC: 3EC: .EC: 9
>sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 Back     alignment and function description
>sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHG5|C72C1_ARATH Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 Back     alignment and function description
>sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 Back     alignment and function description
>sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 Back     alignment and function description
>sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
222636909255 hypothetical protein OsJ_23983 [Oryza sa 0.751 0.580 0.401 2e-29
147767555 362 hypothetical protein VITISV_029177 [Viti 0.467 0.254 0.508 2e-27
255548211 503 cytochrome P450, putative [Ricinus commu 0.467 0.182 0.508 2e-26
297744075 521 unnamed protein product [Vitis vinifera] 0.467 0.176 0.5 4e-26
359479981 525 PREDICTED: cytochrome P450 734A6 [Vitis 0.467 0.175 0.5 4e-26
224089831 525 cytochrome P450 [Populus trichocarpa] gi 0.467 0.175 0.483 8e-25
297803324 520 CYP709B3 [Arabidopsis lyrata subsp. lyra 0.456 0.173 0.471 2e-22
49660018 514 cytochrome P450 CYP709C1 [Triticum aesti 0.644 0.247 0.384 4e-22
38112707 514 cytochrome P450 [Triticum aestivum] 0.467 0.178 0.450 4e-22
242057283 525 hypothetical protein SORBIDRAFT_03g01362 0.629 0.236 0.402 8e-22
>gi|222636909|gb|EEE67041.1| hypothetical protein OsJ_23983 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 104/182 (57%), Gaps = 34/182 (18%)

Query: 46  IDKLKADIIAHTAFGSSFAEGRETLEAQAELQECCAASISDIFIPGSQHLYNGLALLHW- 104
            ++L A++I+HT FGSS+ EG++   AQ ELQ    ++   + +PG  +L        W 
Sbjct: 23  FEELTANVISHTVFGSSYKEGKQVFLAQRELQFLAFSTFLTVQVPGFSYLPTMKNFKTWS 82

Query: 105 ---QAKLREEVLEYCGIGIPDADILSNLKLVNMVLLEALRLYSPVIRLYRQ-GSQ----- 155
              + KLREE+   CG  +P  D+L+ LK+VNM LLE LRLYSPV+ + R+ G+      
Sbjct: 83  LDKKEKLREEIAMECGDEMPTGDMLNKLKMVNMFLLETLRLYSPVLLIRRKVGTDIELGG 142

Query: 156 ------------------------EDAEEFSPLRFINGVTKAARNPNAMLAFGAGPRACI 191
                                   EDA+EF P RF NGVT+AA++PNA+L+F +GPR+CI
Sbjct: 143 IKMPEGALLMIPIATIHRDKEVWGEDADEFRPERFENGVTRAAKHPNALLSFSSGPRSCI 202

Query: 192 GQ 193
           GQ
Sbjct: 203 GQ 204

Source: Oryza sativa Japonica Group

Species: Oryza sativa

Genus: Oryza

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147767555|emb|CAN75640.1| hypothetical protein VITISV_029177 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255548211|ref|XP_002515162.1| cytochrome P450, putative [Ricinus communis] gi|223545642|gb|EEF47146.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297744075|emb|CBI37045.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359479981|ref|XP_002273663.2| PREDICTED: cytochrome P450 734A6 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224089831|ref|XP_002308827.1| cytochrome P450 [Populus trichocarpa] gi|222854803|gb|EEE92350.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297803324|ref|XP_002869546.1| CYP709B3 [Arabidopsis lyrata subsp. lyrata] gi|297315382|gb|EFH45805.1| CYP709B3 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|49660018|gb|AAT68297.1| cytochrome P450 CYP709C1 [Triticum aestivum] Back     alignment and taxonomy information
>gi|38112707|gb|AAR11387.1| cytochrome P450 [Triticum aestivum] Back     alignment and taxonomy information
>gi|242057283|ref|XP_002457787.1| hypothetical protein SORBIDRAFT_03g013620 [Sorghum bicolor] gi|241929762|gb|EES02907.1| hypothetical protein SORBIDRAFT_03g013620 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
TAIR|locus:2137697518 CYP709B3 ""cytochrome P450, fa 0.294 0.111 0.573 6.8e-25
TAIR|locus:2041389519 CYP709B1 ""cytochrome P450, fa 0.335 0.127 0.426 7.2e-22
UNIPROTKB|B9X287542 CYP734A6 "Cytochrome P450 734A 0.279 0.101 0.421 2.6e-19
TAIR|locus:2041399572 CYP709B2 ""cytochrome P450, fa 0.335 0.115 0.426 8.9e-19
TAIR|locus:2149438532 CYP714A1 "cytochrome P450, fam 0.269 0.099 0.490 4.5e-16
TAIR|locus:2089526512 CYP72A7 ""cytochrome P450, fam 0.329 0.126 0.388 1.5e-13
TAIR|locus:2089521512 CYP72A15 ""cytochrome P450, fa 0.243 0.093 0.520 3.5e-12
TAIR|locus:2089561514 CYP72A10 ""cytochrome P450, fa 0.269 0.103 0.490 4.6e-12
TAIR|locus:2089621512 CYP72A14 ""cytochrome P450, fa 0.243 0.093 0.5 7.1e-12
TAIR|locus:2089546508 CYP72A9 ""cytochrome P450, fam 0.329 0.127 0.417 8.7e-12
TAIR|locus:2137697 CYP709B3 ""cytochrome P450, family 709, subfamily B, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 164 (62.8 bits), Expect = 6.8e-25, Sum P(3) = 6.8e-25
 Identities = 35/61 (57%), Positives = 43/61 (70%)

Query:    99 LALLH--WQAKLREEVLEYCGIG-IPDADILSNLKLVNMVLLEALRLYSPVIRLYRQGSQ 155
             L  LH  WQ KLREEV   CG   IPD D  S LKL+NMVL+E+LRLY PVI++ R+ +Q
Sbjct:   341 LLSLHQGWQEKLREEVFNECGKDKIPDTDTFSKLKLMNMVLMESLRLYGPVIKISREATQ 400

Query:   156 E 156
             +
Sbjct:   401 D 401
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2041389 CYP709B1 ""cytochrome P450, family 709, subfamily B, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B9X287 CYP734A6 "Cytochrome P450 734A6" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2041399 CYP709B2 ""cytochrome P450, family 709, subfamily B, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149438 CYP714A1 "cytochrome P450, family 714, subfamily A, polypeptide 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089526 CYP72A7 ""cytochrome P450, family 72, subfamily A, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089521 CYP72A15 ""cytochrome P450, family 72, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089561 CYP72A10 ""cytochrome P450, family 72, subfamily A, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089621 CYP72A14 ""cytochrome P450, family 72, subfamily A, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089546 CYP72A9 ""cytochrome P450, family 72, subfamily A, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
4343035
cytochrome P450, putative (296 aa)
(Oryza sativa Japonica)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
pfam00067461 pfam00067, p450, Cytochrome P450 5e-16
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 5e-14
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 2e-07
PLN02290 516 PLN02290, PLN02290, cytokinin trans-hydroxylase 2e-06
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 3e-06
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 2e-05
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 1e-04
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 2e-04
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score = 75.0 bits (185), Expect = 5e-16
 Identities = 44/154 (28%), Positives = 65/154 (42%), Gaps = 40/154 (25%)

Query: 81  AASISDIFIPG----SQHLYNGLALL----HWQAKLREEVLEYCG-IGIPDADILSNLKL 131
            A++ ++F  G    S  L   L  L      Q KLREE+ E  G    P  D L N+  
Sbjct: 263 RATVLELFFAGTDTTSSTLSWALYELAKHPEVQEKLREEIDEVIGDKRSPTYDDLQNMPY 322

Query: 132 VNMVLLEALRLYSPV-IRLYRQGSQ-----------------------------EDAEEF 161
           ++ V+ E LRL+  V + L R+ ++                              + EEF
Sbjct: 323 LDAVIKETLRLHPVVPLLLPREVTKDTVIPGYLIPKGTLVIVNLYALHRDPEVFPNPEEF 382

Query: 162 SPLRFINGVTKAARNPNAMLAFGAGPRACIGQKI 195
            P RF++      R   A L FGAGPR C+G+++
Sbjct: 383 DPERFLDE-NGKFRKSFAFLPFGAGPRNCLGERL 415

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 197
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN02290516 cytokinin trans-hydroxylase 99.97
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.97
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.97
PLN02738633 carotene beta-ring hydroxylase 99.97
PLN02971543 tryptophan N-hydroxylase 99.97
PLN02500490 cytochrome P450 90B1 99.97
PTZ00404482 cytochrome P450; Provisional 99.97
PLN02183516 ferulate 5-hydroxylase 99.97
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.97
PLN03234499 cytochrome P450 83B1; Provisional 99.97
PLN02687517 flavonoid 3'-monooxygenase 99.97
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.97
PLN02394503 trans-cinnamate 4-monooxygenase 99.96
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.96
PLN03195516 fatty acid omega-hydroxylase; Provisional 99.96
PLN02966502 cytochrome P450 83A1 99.96
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.96
PLN03112514 cytochrome P450 family protein; Provisional 99.96
PLN02655466 ent-kaurene oxidase 99.96
PLN02936489 epsilon-ring hydroxylase 99.96
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.95
PLN02774463 brassinosteroid-6-oxidase 99.95
PLN03018534 homomethionine N-hydroxylase 99.95
PLN02196463 abscisic acid 8'-hydroxylase 99.95
PLN02302490 ent-kaurenoic acid oxidase 99.95
PLN02987472 Cytochrome P450, family 90, subfamily A 99.94
PLN00168519 Cytochrome P450; Provisional 99.93
PLN02648480 allene oxide synthase 99.9
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 99.9
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.88
PLN00168 519 Cytochrome P450; Provisional 94.3
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.1e-35  Score=243.41  Aligned_cols=178  Identities=28%  Similarity=0.386  Sum_probs=143.0

Q ss_pred             ecCCCcccccCCCcchHHHHhhhhccc-cchhhhh------------------------------------HHHHHHHHc
Q 041343           17 SRAQDLHFRPGGGQTHWASHGRIIISA-FAIDKLK------------------------------------ADIIAHTAF   59 (197)
Q Consensus        17 ~~~~~~~~~~~~~g~~wk~~Rk~~~~~-f~~~~~~------------------------------------~~~i~~~~f   59 (197)
                      ..+.++.+++|  |+.||.+||++... |+...++                                    .|+|++++|
T Consensus       107 ~~~~~i~~a~y--G~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~~~~~~~vdl~~~l~~~~~nvI~~~~f  184 (489)
T KOG0156|consen  107 YGGKGIVFAPY--GDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSKSKKGEPVDLSELLDLLVGNVICRMLF  184 (489)
T ss_pred             CCCCceEeCCC--cHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHhcCCCceeeHHHHHHHHHHHHHHHHHh
Confidence            36788999999  99999999998774 4433222                                    899999999


Q ss_pred             CCCcccc-----hhHHHHHHHHHHHHHhhhhhcccC-ChhhHhh------------------------------------
Q 041343           60 GSSFAEG-----RETLEAQAELQECCAASISDIFIP-GSQHLYN------------------------------------   97 (197)
Q Consensus        60 G~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~p-~~~~~~~------------------------------------   97 (197)
                      |++++.+     .++...+.+..+..+.....+++| ++.+++.                                    
T Consensus       185 G~rf~~~~~~~~~~~~~l~~~~~~~~~~~~~~d~~p~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~i~eh~~~~~~~~~~  264 (489)
T KOG0156|consen  185 GRRFEEEDEEEFLELKELVEESLELLGSFNLSDYFPFLLRWLDGISGLEKRLKKVSKRLDEFLERIIDEHREKIGDEEGR  264 (489)
T ss_pred             CCccccCCchHHHHHHHHHHHHHHHhCCccHHHHhhHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCC
Confidence            9999742     235666777777777777777777 4444431                                    


Q ss_pred             --------------------------------------------HhhHH----HHHHHHHHHHHHHhCC-CCCCHHhhhh
Q 041343           98 --------------------------------------------GLALL----HWQAKLREEVLEYCGI-GIPDADILSN  128 (197)
Q Consensus        98 --------------------------------------------~l~ll----e~~~kl~~Ei~~~~~~-~~~~~~~~~~  128 (197)
                                                                  +++.|    ++|+|+++||++++|. ..++.+|+.+
T Consensus       265 D~vD~lL~~~~~~~~~~~t~~~i~~~~~dl~~AGtdTta~Tl~Wa~a~Ll~~Pev~~K~qeEId~vvG~~r~v~e~D~~~  344 (489)
T KOG0156|consen  265 DFVDALLKLMKEEKAEGLTDDHLKALILDLFLAGTDTTATTLEWAMAELLNNPEVQKKLQEEIDEVVGKGRLVSESDLPK  344 (489)
T ss_pred             cHHHHHHHhhcccccCCCCHHHHHHHHHHHHhcccchHHHHHHHHHHHHHhCHHHHHHHHHHHHHHhCCCCCCChhhhcc
Confidence                                                        22233    9999999999999994 4499999999


Q ss_pred             chhHHHHhhhcccccccccc-cccccc-----------------------------CCCCCCccCCCCCCCCcccCCCCC
Q 041343          129 LKLVNMVLLEALRLYSPVIR-LYRQGS-----------------------------QEDAEEFSPLRFINGVTKAARNPN  178 (197)
Q Consensus       129 l~yl~a~i~EslRl~~~~~~-~~r~~~-----------------------------~~dp~~F~P~R~~~~~~~~~~~~~  178 (197)
                      +||++|+|+|++|++|++|. ++|.+.                             |+||++|+||||++.+.... ...
T Consensus       345 lpYL~Avi~E~~Rl~p~~Pl~~ph~~~~d~~i~Gy~IPkgT~v~vn~~ai~rDp~vw~dP~eF~PERFl~~~d~~~-~~~  423 (489)
T KOG0156|consen  345 LPYLKAVIKETLRLHPPLPLLLPRETTEDTKIGGYDIPKGTTVLVNLWAIHRDPKVWEDPEEFKPERFLDSNDGKG-LDF  423 (489)
T ss_pred             CHHHHHHHHHHHhcCCCccccccccccCCeeEcCEEcCCCCEEEEeehhhhcCCccCCCccccChhhhcCCccccC-Cce
Confidence            99999999999999999998 677776                             99999999999999741222 678


Q ss_pred             CccccCCCcccccCCccCC
Q 041343          179 AMLAFGAGPRACIGQKIEF  197 (197)
Q Consensus       179 ~~~~Fg~G~r~C~G~~lA~  197 (197)
                      .++|||+|||+|||+.+|+
T Consensus       424 ~~iPFG~GRR~CpG~~La~  442 (489)
T KOG0156|consen  424 KLIPFGSGRRICPGEGLAR  442 (489)
T ss_pred             EecCCCCCcCCCCcHHHHH
Confidence            9999999999999999884

>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 6e-05
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 6e-05
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 1e-04
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 1e-04
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 1e-04
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 2e-04
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 2e-04
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-04
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 2e-04
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 2e-04
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 2e-04
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 2e-04
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 2e-04
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-04
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 2e-04
1fah_A471 Structure Of Cytochrome P450 Length = 471 2e-04
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 2e-04
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 2e-04
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 2e-04
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 2e-04
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 2e-04
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 2e-04
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-04
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 2e-04
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 2e-04
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 2e-04
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 2e-04
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 2e-04
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 2e-04
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 2e-04
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 2e-04
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 3e-04
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 3e-04
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 4e-04
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 4e-04
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 5e-04
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 7e-04
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure 
Iteration: 1

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 49/124 (39%), Gaps = 34/124 (27%)
Query: 103 HWQAKLREEVLEYCGIGIPDADILSNLKLVNMVLLEALRLY--SPVIRLY---------- 150
           H   K  EE        +P    +  LK V MVL EALRL+  SP   LY          
Sbjct: 288 HVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTSPAFSLYAKEDTVLGGE 347
Query: 151 ---RQGSQ----------------EDAEEFSPLRFINGVTKAARNPNAMLAFGAGPRACI 191
               +G +                +D EEF P RF N    +A   +A   FG G RACI
Sbjct: 348 YPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFEN---PSAIPQHAFKPFGNGQRACI 404
Query: 192 GQKI 195
           GQ+ 
Sbjct: 405 GQQF 408
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 3e-27
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 1e-24
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 3e-20
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-19
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-19
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 3e-19
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-18
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 7e-18
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 9e-18
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 2e-17
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 5e-17
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 8e-16
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 3e-15
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 4e-15
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 3e-12
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 3e-11
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-09
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 3e-09
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 7e-09
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-04
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 1e-04
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
 Score =  106 bits (266), Expect = 3e-27
 Identities = 35/123 (28%), Positives = 43/123 (34%), Gaps = 34/123 (27%)

Query: 103 HWQAKLREEVLEYCGIGIPDADILSNLKLVNMVLLEALRLYSPVIRLYRQGSQ------- 155
           H   K  EE        +P    +  LK V MVL EALRL+           +       
Sbjct: 285 HVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGE 344

Query: 156 ------------------------EDAEEFSPLRFINGVTKAARNPNAMLAFGAGPRACI 191
                                   +D EEF P RF N    +A   +A   FG G RACI
Sbjct: 345 YPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFEN---PSAIPQHAFKPFGNGQRACI 401

Query: 192 GQK 194
           GQ+
Sbjct: 402 GQQ 404
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.98
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.97
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.97
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.97
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.97
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.97
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.97
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.97
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 99.97
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 99.97
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.97
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.97
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.96
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.96
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.96
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.96
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.96
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.96
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.96
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.95
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.95
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.93
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.92
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.92
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.92
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.92
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.91
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.91
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.91
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.91
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.91
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.91
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.91
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.91
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.91
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.91
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.91
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.91
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.9
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.9
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.9
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.9
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.9
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.9
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.9
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.9
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.9
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.9
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.9
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.9
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.9
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.9
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.9
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.9
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.9
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.9
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.9
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.89
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.89
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.89
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.89
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.89
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.89
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.89
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.89
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.88
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.88
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.88
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.88
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.88
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.88
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.88
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.87
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.87
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.74
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.73
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=2.9e-33  Score=230.39  Aligned_cols=94  Identities=24%  Similarity=0.370  Sum_probs=83.5

Q ss_pred             HHHHHHHHHHHHHhC-CCCCCHHhhhhchhHHHHhhhccccccccccccc-ccc--------------------------
Q 041343          103 HWQAKLREEVLEYCG-IGIPDADILSNLKLVNMVLLEALRLYSPVIRLYR-QGS--------------------------  154 (197)
Q Consensus       103 e~~~kl~~Ei~~~~~-~~~~~~~~~~~l~yl~a~i~EslRl~~~~~~~~r-~~~--------------------------  154 (197)
                      ++|+|+++||+++++ +..++.+++++|||++|||+|+||++|+++...| .+.                          
T Consensus       304 ~~q~kl~~Ei~~~~~~~~~~~~~~l~~lpyl~avi~EtlRl~p~~~~~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d  383 (479)
T 3tbg_A          304 DVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKD  383 (479)
T ss_dssp             HHHHHHHHHHHHHTCSSSCCCHHHHTTCHHHHHHHHHHHHHHCSSTTCCCEECSSCEEETTEEECTTCEEEEEHHHHHTC
T ss_pred             HHHHHHHHHHHHHHhhccccchhhhccccccccceeeeccccccccccceeecCCCceECCEEecCCCeeeechhhhcCC
Confidence            999999999999998 6789999999999999999999999999998444 333                          


Q ss_pred             ---CCCCCCccCCCCCCCCcccCCCCCCccccCCCcccccCCccCC
Q 041343          155 ---QEDAEEFSPLRFINGVTKAARNPNAMLAFGAGPRACIGQKIEF  197 (197)
Q Consensus       155 ---~~dp~~F~P~R~~~~~~~~~~~~~~~~~Fg~G~r~C~G~~lA~  197 (197)
                         |+||++|+||||++++.. ..++..|+|||+|+|.|+|++||+
T Consensus       384 ~~~~~dP~~F~PeRfl~~~~~-~~~~~~~~pFG~G~R~C~G~~lA~  428 (479)
T 3tbg_A          384 EAVWEKPFRFHPEHFLDAQGH-FVKPEAFLPFSAGRRACLGEPLAR  428 (479)
T ss_dssp             TTTSSSTTSCCGGGGBCTTCC-BCCCTTCCTTCCSTTSCTTHHHHH
T ss_pred             hhhCCCccccCccccCCCCcc-cCCCCceecCCCCCcCChhHHHHH
Confidence               999999999999987444 446788999999999999999984
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 197
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 8e-10
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 1e-09
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 1e-09
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 5e-09
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 1e-08
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 1e-08
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 3e-06
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 4e-06
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 5e-06
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 6e-06
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 9e-06
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 1e-05
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 2e-05
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 2e-05
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 3e-05
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 4e-05
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 4e-05
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 6e-05
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 9e-05
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 2e-04
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 4e-04
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome p450 14 alpha-sterol demethylase (cyp51)
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score = 55.3 bits (131), Expect = 8e-10
 Identities = 11/40 (27%), Positives = 16/40 (40%)

Query: 156 EDAEEFSPLRFINGVTKAARNPNAMLAFGAGPRACIGQKI 195
            D  +F P R+     +   N    + FGAG   C+G   
Sbjct: 356 PDPHDFVPARYEQPRQEDLLNRWTWIPFGAGRHRCVGAAF 395
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.97
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.97
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.96
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.96
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.95
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.95
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.94
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.9
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.85
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.83
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.81
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.81
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.79
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.79
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.78
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.76
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.76
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.76
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.76
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.75
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.7
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=2.8e-31  Score=214.96  Aligned_cols=94  Identities=21%  Similarity=0.322  Sum_probs=83.9

Q ss_pred             HHHHHHHHHHHHHhC-CCCCCHHhhhhchhHHHHhhhcccccccccccccccc---------------------------
Q 041343          103 HWQAKLREEVLEYCG-IGIPDADILSNLKLVNMVLLEALRLYSPVIRLYRQGS---------------------------  154 (197)
Q Consensus       103 e~~~kl~~Ei~~~~~-~~~~~~~~~~~l~yl~a~i~EslRl~~~~~~~~r~~~---------------------------  154 (197)
                      ++|+++++|++++++ +..++.++++++||++|||+|++|++|+++...|.+.                           
T Consensus       293 ~~~~~l~~Ei~~~~~~~~~~~~~~~~~l~yL~a~i~E~lRl~p~~~~~~r~~~~~~~~~~g~~ip~gt~v~~~~~~~~~d  372 (467)
T d1r9oa_         293 EVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYIDLLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHD  372 (467)
T ss_dssp             HHHHHHHHHHHHHTCSSSCCCGGGGGGCHHHHHHHHHHHHHHTSSTTCSCEECSSCEEETTEEECTTCEEEECSHHHHTC
T ss_pred             hHHHHHHhhhhhhcCCCCCCcHHHhhhhhhhhhhccccccccccCCcccccccccccccceeEEecCCccccchhhhcCC
Confidence            899999999999998 5688999999999999999999999999988666543                           


Q ss_pred             ---CCCCCCccCCCCCCCCcccCCCCCCccccCCCcccccCCccCC
Q 041343          155 ---QEDAEEFSPLRFINGVTKAARNPNAMLAFGAGPRACIGQKIEF  197 (197)
Q Consensus       155 ---~~dp~~F~P~R~~~~~~~~~~~~~~~~~Fg~G~r~C~G~~lA~  197 (197)
                         |+||++|+||||++++.. ..++..|+|||+|+|.|+|++||+
T Consensus       373 ~~~~~dp~~F~PeRfl~~~~~-~~~~~~~~pFg~G~r~C~G~~~A~  417 (467)
T d1r9oa_         373 NKEFPNPEMFDPHHFLDEGGN-FKKSKYFMPFSAGKRICVGEALAG  417 (467)
T ss_dssp             TTTSSSTTSCCGGGGBCTTSC-BCCCTTCCTTCCGGGSCTTHHHHH
T ss_pred             cccCcCcceeCccccCCCCCC-cCCCCCcccCCCCCcCChHHHHHH
Confidence               999999999999987443 446678999999999999999984
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure