Citrus Sinensis ID: 041424


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MKTVTLNVEKSETIKNLKGMVHEKEGTSEDIQDLFFAGDRLMNGRLIDYEDMALASPNVKRESTMQLLFCAIKVLSISVKAPSDDILKLKVKIFVKMLTEEIVKLKVKVLLTIRDLFCTGMKLKDCKTLACYGVKDDRGVACFISDIC
ccEEEEEEEccccHHHHHHHHHHHccccccccEEEEcccccccccccccccccccccccccccEEEEEEEEEEEcEEEEccccccEEEEEEEEEEEEEEEEEEEHHHccccccEEEEEccEEEcccccccccccccccEEEEEEcccc
ccEEEEEcccccEHHHHHHHHHHHHcccHHHEEEEEccEEcccccEcccccccHHHcccccccEEEEEEEcccccccccccccccccccccEEEEEEccccEEEEEEccccHHHHHHHccccccccccccHcccccccEEEEEEcccc
MKTVTLNVEKSETIKNLKGmvhekegtseDIQDLFFAGdrlmngrlidyedmalaspnvkresTMQLLFCAIKVLSisvkapsddiLKLKVKIFVKMLTEEIVKLKVKVLLTIRDLFCtgmklkdcktlacygvkddrgvaCFISDIC
mktvtlnveksetiknlkgmvhekegtseDIQDLFFAGDRLMNGRLIDYEDMALASPNVKRESTMQLLFCAIKVLsisvkapsddiLKLKVKIFVKMLTEEIVKLKVKVLLTIRDLFctgmklkdcktlacygvkddrgVACFISDIC
MKTVTLNVEKSETIKNLKGMVHEKEGTSEDIQDLFFAGDRLMNGRLIDYEDMALASPNVKRESTMQLLFCAIKVLSISVKAPSDDILKLKVKIFVKMLTEEIVKLKVKVLLTIRDLFCTGMKLKDCKTLACYGVKDDRGVACFISDIC
******************************IQDLFFAGDRLMNGRLIDYEDMALASPNVKRESTMQLLFCAIKVLSISVKAPSDDILKLKVKIFVKMLTEEIVKLKVKVLLTIRDLFCTGMKLKDCKTLACYGVKDDRGVACFISD**
MKTVTLNVEKSETIKNLKGMVHEKEGTSEDIQDLFFAGDRLMNGRLIDYEDMALASPNVKRESTMQLLFCAIKVLSISVKAPSDDILKLKVKIFVKMLTEEIVKLKVKVLLTIRDLFCTGMKLKDCKTLACYGVKDDRGVACFISDIC
MKTVTLNVEKSETIKNLKGMVHEKEGTSEDIQDLFFAGDRLMNGRLIDYEDMALASPNVKRESTMQLLFCAIKVLSISVKAPSDDILKLKVKIFVKMLTEEIVKLKVKVLLTIRDLFCTGMKLKDCKTLACYGVKDDRGVACFISDIC
*KTVTLNVEKSETIKNLKGMVHEKEGTSEDIQDLFFAGDRLMNGRLIDYEDMALASPNVKRESTMQLLFCAIKVLSISVKAPSDDILKLKVKIFVKMLTEEIVKLKVKVLLTIRDLFCTGMKLKDCKTLACYGVKDDRGVACFISDIC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTVTLNVEKSETIKNLKGMVHEKEGTSEDIQDLFFAGDRLMNGRLIDYEDMALASPNVKRESTMQLLFCAIKVLSISVKAPSDDILKLKVKIFVKMLTEEIVKLKVKVLLTIRDLFCTGMKLKDCKTLACYGVKDDRGVACFISDIC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
P0CG84 377 Polyubiquitin (Fragment) N/A no 0.75 0.294 0.324 4e-11
P69309 305 Polyubiquitin OS=Avena fa N/A no 0.75 0.363 0.324 4e-11
P0CH05 458 Polyubiquitin OS=Petrosel N/A no 0.75 0.242 0.324 4e-11
P0CH04 458 Polyubiquitin OS=Petrosel N/A no 0.75 0.242 0.324 4e-11
P0CH32 382 Polyubiquitin 4 OS=Arabid yes no 0.75 0.290 0.324 4e-11
P69315 305 Polyubiquitin (Fragment) N/A no 0.75 0.363 0.324 4e-11
Q3E7T8 305 Polyubiquitin 14 OS=Arabi no no 0.75 0.363 0.324 4e-11
P69325 305 Polyubiquitin OS=Glycine no no 0.75 0.363 0.324 4e-11
P69322 381 Polyubiquitin OS=Pisum sa N/A no 0.75 0.291 0.324 4e-11
P0CH33229 Polyubiquitin 11 OS=Arabi no no 0.75 0.484 0.324 4e-11
>sp|P0CG84|UBI4P_NICSY Polyubiquitin (Fragment) OS=Nicotiana sylvestris GN=UBI4 PE=2 SV=1 Back     alignment and function desciption
 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 74/151 (49%), Gaps = 40/151 (26%)

Query: 2   KTVTLNVEKSETIKNLKGMVHEKEGTSEDIQDLFFAGDRLMNGRLIDYEDMALASPNVKR 61
           KT+TL VE S+TI N+K  + +KEG   D Q L FAG +L +GR        LA  N+++
Sbjct: 7   KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR-------TLADYNIQK 59

Query: 62  ESTMQLLFCAIKVLSISVKAPSDDILKLKVKIFVKMLTEEIVKLKVKVLLTI-------- 113
           EST+ L+                  L+  ++IFVK LT + + L+V+   TI        
Sbjct: 60  ESTLHLVLR----------------LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ 103

Query: 114 ---------RDLFCTGMKLKDCKTLACYGVK 135
                    + L   G +L+D +TLA Y ++
Sbjct: 104 DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ 134




Ubiquitin exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in lysosomal degradation; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling.
Nicotiana sylvestris (taxid: 4096)
>sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 Back     alignment and function description
>sp|P0CH05|UBI2P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-2 PE=3 SV=1 Back     alignment and function description
>sp|P0CH04|UBI1P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=2 SV=1 Back     alignment and function description
>sp|P0CH32|UBQ4_ARATH Polyubiquitin 4 OS=Arabidopsis thaliana GN=UBQ4 PE=1 SV=1 Back     alignment and function description
>sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 Back     alignment and function description
>sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 Back     alignment and function description
>sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 Back     alignment and function description
>sp|P69322|UBIQP_PEA Polyubiquitin OS=Pisum sativum GN=PU1 PE=2 SV=2 Back     alignment and function description
>sp|P0CH33|UBQ11_ARATH Polyubiquitin 11 OS=Arabidopsis thaliana GN=UBQ11 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
326427340220 ubiquitin [Salpingoeca sp. ATCC 50818] 0.777 0.522 0.347 2e-10
410976446229 PREDICTED: polyubiquitin-B-like [Felis c 0.743 0.480 0.335 2e-10
350420431 471 PREDICTED: polyubiquitin-like [Bombus im 0.797 0.250 0.331 2e-10
348537407237 PREDICTED: polyubiquitin-C-like [Oreochr 0.851 0.531 0.331 3e-10
226473052 304 polyubiquitin [Schistosoma japonicum] 0.777 0.378 0.344 4e-10
307108562 979 hypothetical protein CHLNCDRAFT_51574 [C 0.75 0.113 0.322 5e-10
339232974210 ubiquitin family protein [Trichinella sp 0.743 0.523 0.328 6e-10
226484025229 ubiquitin C [Schistosoma japonicum] 0.743 0.480 0.328 6e-10
302143601 771 unnamed protein product [Vitis vinifera] 0.702 0.134 0.343 6e-10
12849189 305 unnamed protein product [Mus musculus] 0.743 0.360 0.328 6e-10
>gi|326427340|gb|EGD72910.1| ubiquitin [Salpingoeca sp. ATCC 50818] Back     alignment and taxonomy information
 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 76/138 (55%), Gaps = 23/138 (16%)

Query: 2   KTVTLNVEKSETIKNLKGMVHEKEGTSEDIQDLFFAGDRLMNGR-LIDYEDMALASPNVK 60
           KT+TL VE S++I+N+K  + +KEG   D Q L FAG +L +GR L DY        N++
Sbjct: 11  KTITLEVEPSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY--------NIQ 62

Query: 61  RESTMQLLFCAI---KVLSISVKAPSDDILKLKVKIFVKMLTEEIVKLKVKVLLTIRDLF 117
           +EST+ L+F      K +++ V+ PSD I  +K KI          + K  +    + L 
Sbjct: 63  KESTLHLIFVKTLTGKTITLEVE-PSDSIENVKAKI----------QDKEGIPPDQQRLI 111

Query: 118 CTGMKLKDCKTLACYGVK 135
             G +L+D +TL+ Y ++
Sbjct: 112 FAGKQLEDGRTLSDYNIQ 129




Source: Salpingoeca sp. ATCC 50818

Species: Salpingoeca sp. ATCC 50818

Genus: Salpingoeca

Family: Salpingoecidae

Order: Choanoflagellida

Class:

Phylum:

Superkingdom: Eukaryota

>gi|410976446|ref|XP_003994631.1| PREDICTED: polyubiquitin-B-like [Felis catus] Back     alignment and taxonomy information
>gi|350420431|ref|XP_003492506.1| PREDICTED: polyubiquitin-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|348537407|ref|XP_003456186.1| PREDICTED: polyubiquitin-C-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|226473052|emb|CAX71212.1| polyubiquitin [Schistosoma japonicum] Back     alignment and taxonomy information
>gi|307108562|gb|EFN56802.1| hypothetical protein CHLNCDRAFT_51574 [Chlorella variabilis] Back     alignment and taxonomy information
>gi|339232974|ref|XP_003381604.1| ubiquitin family protein [Trichinella spiralis] gi|316979565|gb|EFV62342.1| ubiquitin family protein [Trichinella spiralis] Back     alignment and taxonomy information
>gi|226484025|emb|CAX79681.1| ubiquitin C [Schistosoma japonicum] Back     alignment and taxonomy information
>gi|302143601|emb|CBI22354.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|12849189|dbj|BAB28242.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
UNIPROTKB|E1B9K1 305 UBC "Ubiquitin" [Bos taurus (t 0.844 0.409 0.354 1.7e-11
TAIR|locus:2138386229 UBQ11 "AT4G05050" [Arabidopsis 0.851 0.550 0.342 2.2e-11
UNIPROTKB|F1PDG4229 UBB "Uncharacterized protein" 0.844 0.545 0.347 2.8e-11
UNIPROTKB|P0CG47229 UBB "Polyubiquitin-B" [Homo sa 0.844 0.545 0.347 2.8e-11
UNIPROTKB|A7U5U2229 UBB "Uncharacterized protein" 0.844 0.545 0.347 2.8e-11
UNIPROTKB|J3QKN0206 UBB "Ubiquitin" [Homo sapiens 0.844 0.606 0.347 2.8e-11
UNIPROTKB|F5GXK7169 UBC "Polyubiquitin-C" [Homo sa 0.844 0.739 0.347 2.8e-11
UNIPROTKB|F5H747161 UBC "Polyubiquitin-C" [Homo sa 0.844 0.776 0.347 2.8e-11
UNIPROTKB|F1NGE3157 UBB "Polyubiquitin-B" [Gallus 0.844 0.796 0.347 2.8e-11
UNIPROTKB|Q91021157 UBB "Ubiquitin" [Gallus gallus 0.844 0.796 0.347 2.8e-11
UNIPROTKB|E1B9K1 UBC "Ubiquitin" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 161 (61.7 bits), Expect = 1.7e-11, P = 1.7e-11
 Identities = 50/141 (35%), Positives = 78/141 (55%)

Query:     2 KTVTLNVEKSETIKNLKGMVHEKEGTSEDIQDLFFAGDRLMNGR-LIDYEDMALASPNVK 60
             KT+TL VE S+TI+N+KG + +KEG   D Q L FAG +L +GR L DY        N++
Sbjct:    11 KTITLEVEPSDTIENVKGKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY--------NIQ 62

Query:    61 RESTMQLLFCAIKVLSISVKAPSDDILKLKVKIFVKMLTEEIVKLKVKVLLTI----RDL 116
             +EST+ L+      + I VK  +   + L+V+      T E VK K++    I    + L
Sbjct:    63 KESTLHLVLRLRGGMQIFVKTLTGKTITLEVE---PSDTIENVKAKIQDKEGIPPDQQRL 119

Query:   117 FCTGMKLKDCKTLACYGVKDD 137
                G +L+D +TL+ Y ++ +
Sbjct:   120 IFAGKQLEDGRTLSDYNIQKE 140


GO:0097009 "energy homeostasis" evidence=IEA
GO:0072520 "seminiferous tubule development" evidence=IEA
GO:0060613 "fat pad development" evidence=IEA
GO:0021888 "hypothalamus gonadotrophin-releasing hormone neuron development" evidence=IEA
GO:0010992 "ubiquitin homeostasis" evidence=IEA
GO:0008585 "female gonad development" evidence=IEA
GO:0007144 "female meiosis I" evidence=IEA
GO:0007141 "male meiosis I" evidence=IEA
GO:0002020 "protease binding" evidence=IEA
TAIR|locus:2138386 UBQ11 "AT4G05050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1PDG4 UBB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P0CG47 UBB "Polyubiquitin-B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A7U5U2 UBB "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J3QKN0 UBB "Ubiquitin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5GXK7 UBC "Polyubiquitin-C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5H747 UBC "Polyubiquitin-C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGE3 UBB "Polyubiquitin-B" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q91021 UBB "Ubiquitin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
cd0180376 cd01803, Ubiquitin, Ubiquitin 1e-11
pfam0024069 pfam00240, ubiquitin, Ubiquitin family 3e-06
cd0176969 cd01769, UBL, Ubiquitin-like domain of UBL 4e-04
smart0021372 smart00213, UBQ, Ubiquitin homologues 0.004
>gnl|CDD|176398 cd01803, Ubiquitin, Ubiquitin Back     alignment and domain information
 Score = 56.4 bits (136), Expect = 1e-11
 Identities = 31/68 (45%), Positives = 44/68 (64%), Gaps = 9/68 (13%)

Query: 2  KTVTLNVEKSETIKNLKGMVHEKEGTSEDIQDLFFAGDRLMNGR-LIDYEDMALASPNVK 60
          KT+TL VE S+TI+N+K  + +KEG   D Q L FAG +L +GR L DY        N++
Sbjct: 11 KTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY--------NIQ 62

Query: 61 RESTMQLL 68
          +EST+ L+
Sbjct: 63 KESTLHLV 70


Ubiquitin (includes Ubq/RPL40e and Ubq/RPS27a fusions as well as homopolymeric multiubiquitin protein chains). Length = 76

>gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family Back     alignment and domain information
>gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL Back     alignment and domain information
>gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 99.76
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 99.71
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 99.7
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 99.7
PTZ0004476 ubiquitin; Provisional 99.69
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 99.68
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 99.67
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 99.67
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 99.65
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 99.65
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 99.64
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 99.64
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 99.64
KOG0003128 consensus Ubiquitin/60s ribosomal protein L40 fusi 99.63
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 99.62
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 99.6
KOG0004156 consensus Ubiquitin/40S ribosomal protein S27a fus 99.59
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 99.59
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 99.58
KOG000570 consensus Ubiquitin-like protein [Cell cycle contr 99.57
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 99.56
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 99.56
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 99.56
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 99.55
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 99.54
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 99.51
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 99.48
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 99.47
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 99.42
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 99.38
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 99.38
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 99.36
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 99.29
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 99.28
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 99.24
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 99.22
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 99.22
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 99.21
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 99.21
PTZ0004476 ubiquitin; Provisional 99.19
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 99.19
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 99.13
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 99.12
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 99.12
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 99.11
KOG0003128 consensus Ubiquitin/60s ribosomal protein L40 fusi 99.11
KOG0004156 consensus Ubiquitin/40S ribosomal protein S27a fus 99.1
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 99.09
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 99.06
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 99.05
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 99.04
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 99.03
KOG0010 493 consensus Ubiquitin-like protein [Posttranslationa 99.03
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 99.03
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 98.96
KOG000175 consensus Ubiquitin and ubiquitin-like proteins [P 98.91
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 98.88
KOG0011 340 consensus Nucleotide excision repair factor NEF2, 98.85
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 98.83
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 98.82
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 98.8
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 98.79
KOG000570 consensus Ubiquitin-like protein [Cell cycle contr 98.78
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 98.78
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 98.72
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 98.67
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 98.64
KOG0010 493 consensus Ubiquitin-like protein [Posttranslationa 98.52
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 98.45
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 98.45
PLN02560 308 enoyl-CoA reductase 98.43
KOG4248 1143 consensus Ubiquitin-like protein, regulator of apo 98.43
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 98.4
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 98.34
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 98.3
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 98.27
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 98.26
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 98.11
KOG0011 340 consensus Nucleotide excision repair factor NEF2, 98.09
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 98.08
KOG0006 446 consensus E3 ubiquitin-protein ligase (Parkin prot 98.01
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 97.98
KOG1872 473 consensus Ubiquitin-specific protease [Posttransla 97.98
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 97.96
KOG349373 consensus Ubiquitin-like protein [Posttranslationa 97.92
KOG000175 consensus Ubiquitin and ubiquitin-like proteins [P 97.85
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 97.64
KOG4495110 consensus RNA polymerase II transcription elongati 97.61
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 97.57
KOG4248 1143 consensus Ubiquitin-like protein, regulator of apo 97.13
KOG0013231 consensus Uncharacterized conserved protein [Funct 96.92
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 96.91
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 96.79
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 96.66
PLN02560 308 enoyl-CoA reductase 96.52
KOG176999 consensus Ubiquitin-like proteins [Posttranslation 96.28
KOG3206234 consensus Alpha-tubulin folding cofactor B [Posttr 96.06
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 95.69
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 95.52
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 95.39
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 95.32
COG541781 Uncharacterized small protein [Function unknown] 94.58
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 94.51
PF13019162 Telomere_Sde2: Telomere stability and silencing 94.0
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 93.86
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 93.6
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 93.55
PF1162088 GABP-alpha: GA-binding protein alpha chain; InterP 93.14
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 92.72
PF1504476 CLU_N: Mitochondrial function, CLU-N-term 92.38
KOG4583 391 consensus Membrane-associated ER protein involved 91.86
COG541781 Uncharacterized small protein [Function unknown] 91.77
KOG176999 consensus Ubiquitin-like proteins [Posttranslation 91.57
PF1483688 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A 91.09
COG5227103 SMT3 Ubiquitin-like protein (sentrin) [Posttransla 90.42
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 90.29
smart0016680 UBX Domain present in ubiquitin-regulatory protein 88.66
KOG1639 297 consensus Steroid reductase required for elongatio 88.5
KOG0006 446 consensus E3 ubiquitin-protein ligase (Parkin prot 88.33
cd0641178 PB1_p51 The PB1 domain is present in the p51 prote 87.74
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 85.08
cd0056565 ThiS ThiaminS ubiquitin-like sulfur carrier protei 83.93
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 83.43
PF1079076 DUF2604: Protein of Unknown function (DUF2604); In 83.0
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 82.84
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 82.24
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 81.28
PF1445357 ThiS-like: ThiS-like ubiquitin 81.05
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 80.85
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
Probab=99.76  E-value=1.1e-18  Score=113.20  Aligned_cols=62  Identities=29%  Similarity=0.305  Sum_probs=60.6

Q ss_pred             eEEEEEEcCCCcHHHHHHHHHhhhCCCCcccEEEEcCeecCCCcccccccccccCCCcccccceeEEEe
Q 041424            2 KTVTLNVEKSETIKNLKGMVHEKEGTSEDIQDLFFAGDRLMNGRLIDYEDMALASPNVKRESTMQLLFC   70 (148)
Q Consensus         2 ~~~~l~v~~~~tV~~lK~~i~~~~gip~~~Q~L~~~g~~L~d~~~~~~~~~~L~~~~i~~~s~i~l~~~   70 (148)
                      ++++++|+|++||+++|++|++.+|+|+++|+|+|+|+.|+|+.       +|++|++++++++|++++
T Consensus         9 ~~~~l~v~~~~tV~~lK~~i~~~~gip~~~q~Li~~Gk~L~D~~-------tL~~~~i~~~~tl~l~~~   70 (74)
T cd01793           9 NTHTLEVTGQETVSDIKAHVAGLEGIDVEDQVLLLAGVPLEDDA-------TLGQCGVEELCTLEVAGR   70 (74)
T ss_pred             CEEEEEECCcCcHHHHHHHHHhhhCCCHHHEEEEECCeECCCCC-------CHHHcCCCCCCEEEEEEe
Confidence            57899999999999999999999999999999999999999999       999999999999999999



Fubi is a ubiquitin-like protein encoded by the fau gene which has an N-terminal ubiquitin-like domain (also referred to as FUBI) fused to the ribosomal protein S30. Fubi is thought to be a tumor suppressor protein and the FUBI domain may act as a substitute or an inhibitor of ubiquitin or one of ubiquitin's close relatives UCRP, FAT10, and Nedd8.

>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>KOG0001 consensus Ubiquitin and ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>KOG3493 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0001 consensus Ubiquitin and ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>KOG4495 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B [Transcription] Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0013 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3206 consensus Alpha-tubulin folding cofactor B [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>COG5417 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>PF13019 Telomere_Sde2: Telomere stability and silencing Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>PF11620 GABP-alpha: GA-binding protein alpha chain; InterPro: IPR024668 GA-binding protein alpha is a transcription factor capable of interacting with purine rich repeats (GA repeats) Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>PF15044 CLU_N: Mitochondrial function, CLU-N-term Back     alignment and domain information
>KOG4583 consensus Membrane-associated ER protein involved in stress response (contains ubiquitin-like domain) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5417 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A Back     alignment and domain information
>COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>KOG1639 consensus Steroid reductase required for elongation of the very long chain fatty acids [Lipid transport and metabolism] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06411 PB1_p51 The PB1 domain is present in the p51 protein, a homolog of the p67 protein Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>PF10790 DUF2604: Protein of Unknown function (DUF2604); InterPro: IPR019726 This entry represents bacterial proteins with undetermined function Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>PF14453 ThiS-like: ThiS-like ubiquitin Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
2y5b_B152 Structure Of Usp21 In Complex With Linear Diubiquit 4e-12
2w9n_A152 Crystal Structure Of Linear Di-Ubiquitin Length = 1 5e-12
3u30_A172 Crystal Structure Of A Linear-Specific Ubiquitin Fa 5e-12
2zvn_A154 Nemo Cozi Domain Incomplex With Diubiquitin In P212 5e-12
3b08_A152 Crystal Structure Of The Mouse Hoil1-L-Nzf In Compl 5e-12
2znv_B76 Crystal Structure Of Human Amsh-Lp Dub Domain In Co 1e-09
2o6v_B76 Crystal Structure And Solution Nmr Studies Of Lys48 1e-09
2o6v_D76 Crystal Structure And Solution Nmr Studies Of Lys48 2e-09
3dvg_Y79 Crystal Structure Of K63-Specific Fab Apu.3a8 Bound 2e-09
1yx5_B98 Solution Structure Of S5a Uim-1UBIQUITIN COMPLEX Le 2e-09
4a18_K129 T.Thermophila 60s Ribosomal Subunit In Complex With 3e-09
3ldz_F73 Crystal Structure Of Human Stam1 Vhs Domain In Comp 3e-09
3ons_A72 Crystal Structure Of Human Ubiquitin In A New Cryst 3e-09
3rul_A79 New Strategy To Analyze Structures Of Glycopeptide- 4e-09
2k6d_B76 Cin85 Sh3-C Domain In Complex With Ubiquitin Length 4e-09
1xd3_B75 Crystal Structure Of Uchl3-Ubvme Complex Length = 7 4e-09
1cmx_B76 Structural Basis For The Specificity Of Ubiquitin C 4e-09
2gbj_A84 Crystal Structure Of The 9-10 8 Glycine Insertion M 4e-09
3k9o_B96 The Crystal Structure Of E2-25k And Ubb+1 Complex L 4e-09
2zcb_A76 Crystal Structure Of Ubiquitin P37aP38A Length = 76 4e-09
1yiw_A76 X-Ray Crystal Structure Of A Chemically Synthesized 4e-09
1aar_A76 Structure Of A Diubiquitin Conjugate And A Model Fo 4e-09
1s1q_B76 Tsg101(Uev) Domain In Complex With Ubiquitin Length 4e-09
2znv_C77 Crystal Structure Of Human Amsh-Lp Dub Domain In Co 4e-09
3nob_A78 Structure Of K11-Linked Di-Ubiquitin Length = 78 5e-09
2gbk_A83 Crystal Structure Of The 9-10 Moad Insertion Mutant 5e-09
2kdi_A114 Solution Structure Of A UbiquitinUIM FUSION PROTEIN 5e-09
2ld9_A77 Backbone Structure Of Ubiquitin Determined Using Ba 5e-09
4ap4_C80 Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le 5e-09
2khw_B79 Solution Structure Of The Human Polymerase Iota Ubm 5e-09
1zgu_B76 Solution Structure Of The Human Mms2-Ubiquitin Comp 5e-09
3jvz_X81 E2~ubiquitin-Hect Length = 81 5e-09
3dvg_X80 Crystal Structure Of K63-Specific Fab Apu.3a8 Bound 5e-09
3u5e_m128 The Structure Of The Eukaryotic Ribosome At 3.0 A R 6e-09
4ii2_B83 Crystal Structure Of Ubiquitin Activating Enzyme 1 6e-09
3q3f_A189 Engineering Domain-Swapped Binding Interfaces By Mu 7e-09
3l0w_B169 Structure Of Split Monoubiquitinated Pcna With Ubiq 8e-09
2k25_A103 Automated Nmr Structure Of The Ubb By Fapsy Length 8e-09
3vdz_A111 Tailoring Encodable Lanthanide-Binding Tags As Mri 8e-09
2ojr_A111 Structure Of Ubiquitin Solved By Sad Using The Lant 9e-09
3ai5_A307 Crystal Structure Of Yeast Enhanced Green Fluoresce 9e-09
3olm_D79 Structure And Function Of A Ubiquitin Binding Site 1e-08
1otr_B76 Solution Structure Of A Cue-Ubiquitin Complex Lengt 1e-08
3u5c_f152 The Structure Of The Eukaryotic Ribosome At 3.0 A R 1e-08
4ii3_B96 Crystal Structure Of S. Pombe Ubiquitin Activating 1e-08
3u5g_f152 The Structure Of The Eukaryotic Ribosome At 3.0 A R 1e-08
1ud7_A76 Solution Structure Of The Designed Hydrophobic Core 1e-08
3h7s_B76 Crystal Structures Of K63-Linked Di- And Tri-Ubiqui 1e-08
3zf7_s128 High-resolution Cryo-electron Microscopy Structure 2e-08
3v6e_B91 Crystal Structure Of Usp2 And A Mutant Form Of Ubiq 2e-08
4hcn_B98 Crystal Structure Of Burkholderia Pseudomallei Effe 2e-08
2xk5_B76 Crystal Structure Of K6-Linked Diubiquitin Length = 2e-08
1ogw_A76 Synthetic Ubiquitin With Fluoro-Leu At 50 And 67 Le 3e-08
2fcs_A76 X-Ray Crystal Structure Of A Chemically Synthesized 4e-08
2jwz_A76 Mutations In The Hydrophobic Core Of Ubiquitin Diff 4e-08
1yj1_A76 X-Ray Crystal Structure Of A Chemically Synthesized 4e-08
3v6c_B91 Crystal Structure Of Usp2 In Complex With Mutated U 4e-08
1sif_A88 Crystal Structure Of A Multiple Hydrophobic Core Mu 5e-08
1c3t_A76 Rotamer Strain As A Determinant Of Protein Structur 7e-08
3mtn_B85 Usp21 In Complex With A Ubiquitin-based, Usp21-spec 1e-07
2gbr_A81 Crystal Structure Of The 35-36 Moad Insertion Mutan 2e-07
4hk2_A78 U7ub25.2540 Length = 78 3e-07
1zw7_A82 Elimination Of The C-Cap In Ubiquitin Structure, Dy 3e-07
4gsw_A80 Crystal Structure Of Ubiquitin From Entamoeba Histo 5e-07
4i6l_B76 Crystal Structure Of Otub1 In Complex With Ubiquiti 8e-07
4hjk_A77 U7ub7 Disulfide Variant Length = 77 1e-06
3n3k_B85 The Catalytic Domain Of Usp8 In Complex With A Usp8 3e-06
2gbm_A84 Crystal Structure Of The 35-36 8 Glycine Insertion 5e-06
1gjz_A53 Solution Structure Of A Dimeric N-Terminal Fragment 1e-05
2jvc_A82 Nmr Solution Structure Of Ubiquitin Like Protein Le 2e-05
>pdb|2Y5B|B Chain B, Structure Of Usp21 In Complex With Linear Diubiquitin-Aldehyde Length = 152 Back     alignment and structure

Iteration: 1

Score = 67.0 bits (162), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 49/152 (32%), Positives = 76/152 (50%), Gaps = 42/152 (27%) Query: 2 KTVTLNVEKSETIKNLKGMVHEKEGTSEDIQDLFFAGDRLMNGR-LIDYEDMALASPNVK 60 KT+TL VE S+TI+N+K + +KEG D Q L FAG +L +GR L DY N++ Sbjct: 11 KTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY--------NIQ 62 Query: 61 RESTMQLLFCAIKVLSISVKAPSDDILKLKVKIFVKMLTEEIVKLKVKVLLTIRD----- 115 +EST+ L+ L+ ++IFVK LT + + L+V+ TI + Sbjct: 63 KESTLHLVLR----------------LRGHMQIFVKTLTGKTITLEVEPSDTIENVKAKI 106 Query: 116 ------------LFCTGMKLKDCKTLACYGVK 135 L G +L+D +TL+ Y ++ Sbjct: 107 QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138
>pdb|2W9N|A Chain A, Crystal Structure Of Linear Di-Ubiquitin Length = 152 Back     alignment and structure
>pdb|3U30|A Chain A, Crystal Structure Of A Linear-Specific Ubiquitin Fab Bound To Linear Ubiquitin Length = 172 Back     alignment and structure
>pdb|2ZVN|A Chain A, Nemo Cozi Domain Incomplex With Diubiquitin In P212121 Space Group Length = 154 Back     alignment and structure
>pdb|3B08|A Chain A, Crystal Structure Of The Mouse Hoil1-L-Nzf In Complex With Linear Di- Ubiquitin Length = 152 Back     alignment and structure
>pdb|2ZNV|B Chain B, Crystal Structure Of Human Amsh-Lp Dub Domain In Complex With Lys63-Linked Ubiquitin Dimer Length = 76 Back     alignment and structure
>pdb|2O6V|B Chain B, Crystal Structure And Solution Nmr Studies Of Lys48-Linked Tetraubiquitin At Neutral Ph Length = 76 Back     alignment and structure
>pdb|2O6V|D Chain D, Crystal Structure And Solution Nmr Studies Of Lys48-Linked Tetraubiquitin At Neutral Ph Length = 76 Back     alignment and structure
>pdb|3DVG|Y Chain Y, Crystal Structure Of K63-Specific Fab Apu.3a8 Bound To K63-Linked Di- Ubiquitin Length = 79 Back     alignment and structure
>pdb|1YX5|B Chain B, Solution Structure Of S5a Uim-1UBIQUITIN COMPLEX Length = 98 Back     alignment and structure
>pdb|4A18|K Chain K, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 26s Rrna And Proteins Of Molecule 1 Length = 129 Back     alignment and structure
>pdb|3LDZ|F Chain F, Crystal Structure Of Human Stam1 Vhs Domain In Complex With Ubiquitin Length = 73 Back     alignment and structure
>pdb|3ONS|A Chain A, Crystal Structure Of Human Ubiquitin In A New Crystal Form Length = 72 Back     alignment and structure
>pdb|3RUL|A Chain A, New Strategy To Analyze Structures Of Glycopeptide-Target Complexes Length = 79 Back     alignment and structure
>pdb|2K6D|B Chain B, Cin85 Sh3-C Domain In Complex With Ubiquitin Length = 76 Back     alignment and structure
>pdb|1XD3|B Chain B, Crystal Structure Of Uchl3-Ubvme Complex Length = 75 Back     alignment and structure
>pdb|1CMX|B Chain B, Structural Basis For The Specificity Of Ubiquitin C- Terminal Hydrolases Length = 76 Back     alignment and structure
>pdb|2GBJ|A Chain A, Crystal Structure Of The 9-10 8 Glycine Insertion Mutant Of Ubiquitin. Length = 84 Back     alignment and structure
>pdb|3K9O|B Chain B, The Crystal Structure Of E2-25k And Ubb+1 Complex Length = 96 Back     alignment and structure
>pdb|2ZCB|A Chain A, Crystal Structure Of Ubiquitin P37aP38A Length = 76 Back     alignment and structure
>pdb|1YIW|A Chain A, X-Ray Crystal Structure Of A Chemically Synthesized Ubiquitin Length = 76 Back     alignment and structure
>pdb|1AAR|A Chain A, Structure Of A Diubiquitin Conjugate And A Model For Interaction With Ubiquitin Conjugating Enzyme (E2) Length = 76 Back     alignment and structure
>pdb|1S1Q|B Chain B, Tsg101(Uev) Domain In Complex With Ubiquitin Length = 76 Back     alignment and structure
>pdb|2ZNV|C Chain C, Crystal Structure Of Human Amsh-Lp Dub Domain In Complex With Lys63-Linked Ubiquitin Dimer Length = 77 Back     alignment and structure
>pdb|3NOB|A Chain A, Structure Of K11-Linked Di-Ubiquitin Length = 78 Back     alignment and structure
>pdb|2GBK|A Chain A, Crystal Structure Of The 9-10 Moad Insertion Mutant Of Ubiquitin Length = 83 Back     alignment and structure
>pdb|2KDI|A Chain A, Solution Structure Of A UbiquitinUIM FUSION PROTEIN Length = 114 Back     alignment and structure
>pdb|2LD9|A Chain A, Backbone Structure Of Ubiquitin Determined Using Backbone Amide Noes And Backbone N-H And N-C Rdcs Length = 77 Back     alignment and structure
>pdb|4AP4|C Chain C, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 80 Back     alignment and structure
>pdb|2KHW|B Chain B, Solution Structure Of The Human Polymerase Iota Ubm2- Ubiquitin Complex Length = 79 Back     alignment and structure
>pdb|1ZGU|B Chain B, Solution Structure Of The Human Mms2-Ubiquitin Complex Length = 76 Back     alignment and structure
>pdb|3JVZ|X Chain X, E2~ubiquitin-Hect Length = 81 Back     alignment and structure
>pdb|3DVG|X Chain X, Crystal Structure Of K63-Specific Fab Apu.3a8 Bound To K63-Linked Di- Ubiquitin Length = 80 Back     alignment and structure
>pdb|3U5E|MM Chain m, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 60s Subunit, Ribosome A Length = 128 Back     alignment and structure
>pdb|4II2|B Chain B, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 83 Back     alignment and structure
>pdb|3Q3F|A Chain A, Engineering Domain-Swapped Binding Interfaces By Mutually Exclusive Folding: Insertion Of Ubiquitin Into Position 103 Of Barnase Length = 189 Back     alignment and structure
>pdb|3L0W|B Chain B, Structure Of Split Monoubiquitinated Pcna With Ubiquitin In Position Two Length = 169 Back     alignment and structure
>pdb|2K25|A Chain A, Automated Nmr Structure Of The Ubb By Fapsy Length = 103 Back     alignment and structure
>pdb|3VDZ|A Chain A, Tailoring Encodable Lanthanide-Binding Tags As Mri Contrast Agents: Xq-Dse3-Ubiquitin At 2.4 Angstroms Length = 111 Back     alignment and structure
>pdb|2OJR|A Chain A, Structure Of Ubiquitin Solved By Sad Using The Lanthanide- Binding Tag Length = 111 Back     alignment and structure
>pdb|3AI5|A Chain A, Crystal Structure Of Yeast Enhanced Green Fluorescent Protein- Ubiquitin Fusion Protein Length = 307 Back     alignment and structure
>pdb|3OLM|D Chain D, Structure And Function Of A Ubiquitin Binding Site Within The Catalytic Domain Of A Hect Ubiquitin Ligase Length = 79 Back     alignment and structure
>pdb|1OTR|B Chain B, Solution Structure Of A Cue-Ubiquitin Complex Length = 76 Back     alignment and structure
>pdb|3U5C|FF Chain f, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 40s Subunit, Ribosome A Length = 152 Back     alignment and structure
>pdb|4II3|B Chain B, Crystal Structure Of S. Pombe Ubiquitin Activating Enzyme 1 (uba1) In Complex With Ubiquitin And Atp/mg Length = 96 Back     alignment and structure
>pdb|3U5G|FF Chain f, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 40s Subunit, Ribosome B Length = 152 Back     alignment and structure
>pdb|1UD7|A Chain A, Solution Structure Of The Designed Hydrophobic Core Mutant Of Ubiquitin, 1d7 Length = 76 Back     alignment and structure
>pdb|3ZF7|SS Chain s, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 128 Back     alignment and structure
>pdb|3V6E|B Chain B, Crystal Structure Of Usp2 And A Mutant Form Of Ubiquitin Length = 91 Back     alignment and structure
>pdb|4HCN|B Chain B, Crystal Structure Of Burkholderia Pseudomallei Effector Protein Chbp In Complex With Ubiquitin Length = 98 Back     alignment and structure
>pdb|2XK5|B Chain B, Crystal Structure Of K6-Linked Diubiquitin Length = 76 Back     alignment and structure
>pdb|1OGW|A Chain A, Synthetic Ubiquitin With Fluoro-Leu At 50 And 67 Length = 76 Back     alignment and structure
>pdb|2FCS|A Chain A, X-Ray Crystal Structure Of A Chemically Synthesized [l-Gln35]ubiquitin With A Cubic Space Group Length = 76 Back     alignment and structure
>pdb|2JWZ|A Chain A, Mutations In The Hydrophobic Core Of Ubiquitin Differentially Affect Its Recognition By Receptor Proteins Length = 76 Back     alignment and structure
>pdb|1YJ1|A Chain A, X-Ray Crystal Structure Of A Chemically Synthesized [d-Gln35]ubiquitin Length = 76 Back     alignment and structure
>pdb|3V6C|B Chain B, Crystal Structure Of Usp2 In Complex With Mutated Ubiquitin Length = 91 Back     alignment and structure
>pdb|1SIF|A Chain A, Crystal Structure Of A Multiple Hydrophobic Core Mutant Of Ubiquitin Length = 88 Back     alignment and structure
>pdb|1C3T|A Chain A, Rotamer Strain As A Determinant Of Protein Structural Specificity Length = 76 Back     alignment and structure
>pdb|3MTN|B Chain B, Usp21 In Complex With A Ubiquitin-based, Usp21-specific Inhibitor Length = 85 Back     alignment and structure
>pdb|2GBR|A Chain A, Crystal Structure Of The 35-36 Moad Insertion Mutant Of Ubiquitin Length = 81 Back     alignment and structure
>pdb|4HK2|A Chain A, U7ub25.2540 Length = 78 Back     alignment and structure
>pdb|1ZW7|A Chain A, Elimination Of The C-Cap In Ubiquitin Structure, Dynamics And Thermodynamic Consequences Length = 82 Back     alignment and structure
>pdb|4GSW|A Chain A, Crystal Structure Of Ubiquitin From Entamoeba Histolytica To 2.15 Angstrom Length = 80 Back     alignment and structure
>pdb|4I6L|B Chain B, Crystal Structure Of Otub1 In Complex With Ubiquitin Variant Length = 76 Back     alignment and structure
>pdb|4HJK|A Chain A, U7ub7 Disulfide Variant Length = 77 Back     alignment and structure
>pdb|3N3K|B Chain B, The Catalytic Domain Of Usp8 In Complex With A Usp8 Specific Inhibitor Length = 85 Back     alignment and structure
>pdb|2GBM|A Chain A, Crystal Structure Of The 35-36 8 Glycine Insertion Mutant Of Ubiquitin Length = 84 Back     alignment and structure
>pdb|1GJZ|A Chain A, Solution Structure Of A Dimeric N-Terminal Fragment Of Human Ubiquitin Length = 53 Back     alignment and structure
>pdb|2JVC|A Chain A, Nmr Solution Structure Of Ubiquitin Like Protein Length = 82 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 4e-13
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 4e-13
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 5e-07
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 5e-13
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 1e-06
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 9e-13
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 2e-06
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 4e-12
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 2e-04
3u5c_F225 RP14, S2, YS8, 40S ribosomal protein S5; translati 8e-12
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 2e-11
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 9e-10
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 2e-11
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 3e-11
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 4e-11
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 5e-11
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 8e-11
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 9e-11
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 1e-10
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 1e-10
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 1e-10
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 2e-10
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 2e-10
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 2e-10
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 2e-10
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 2e-10
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 4e-10
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 4e-10
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 5e-10
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 2e-09
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 5e-09
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 6e-09
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 7e-09
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 9e-09
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 1e-08
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 2e-08
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 6e-08
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 6e-08
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 1e-07
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 2e-07
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 2e-07
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 3e-07
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 4e-07
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 8e-07
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 9e-07
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 3e-06
1we6_A111 Splicing factor, putative; structural genomics, ub 4e-06
3m62_B106 UV excision repair protein RAD23; armadillo-like r 6e-06
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 8e-06
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 1e-05
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 7e-04
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 1e-05
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 2e-05
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 8e-05
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
 Score = 60.5 bits (147), Expect = 4e-13
 Identities = 17/83 (20%), Positives = 36/83 (43%), Gaps = 15/83 (18%)

Query: 2   KTVTLNVEKSETIKNLKGMVHEKEGTSEDIQDLFFAGDRLMNGR-LIDYEDMALASPNVK 60
           K + L V  ++T+ ++K  +H  EG     Q  FF+G  L +     +          + 
Sbjct: 34  KDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEEL--------KIP 85

Query: 61  RESTMQLLFCAIKVLSISVKAPS 83
           ++  +Q+      ++S  V+ P+
Sbjct: 86  KDYVVQV------IVSQPVQNPT 102


>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Length = 172 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Length = 172 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Length = 152 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Length = 152 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>3u5c_F RP14, S2, YS8, 40S ribosomal protein S5; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_F 3o30_D 3o2z_D 3u5g_F 3jyv_G* 2noq_F 1s1h_G 3iz6_F Length = 225 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Length = 189 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Length = 189 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: k.45.1.1 PDB: 3dbr_I 3dbl_I Length = 88 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Length = 76 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 87 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 85 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Length = 76 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 89 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Length = 96 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Length = 88 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Length = 169 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Length = 114 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} Length = 85 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Length = 115 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Length = 98 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Length = 111 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Length = 79 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Length = 189 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Length = 88 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Length = 84 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 78 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Length = 128 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 94 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Length = 307 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 111 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Length = 85 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.97
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.97
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.96
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 99.77
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 99.74
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.74
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.73
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 99.73
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 99.7
4ajy_B118 Transcription elongation factor B polypeptide 2; E 99.7
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 99.7
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.69
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 99.69
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 99.69
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.68
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 99.68
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.68
2fnj_B118 Transcription elongation factor B polypeptide 2; b 99.68
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 99.68
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 99.67
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.67
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 99.67
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 99.67
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 99.67
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.67
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 99.67
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 99.67
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 99.67
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.66
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.66
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 99.66
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 99.66
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 99.66
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.66
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.66
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 99.65
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.65
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 99.65
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.65
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.64
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.64
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.64
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 99.64
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.64
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 99.64
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 99.63
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 99.63
1we6_A111 Splicing factor, putative; structural genomics, ub 99.63
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 99.62
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 99.61
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 99.4
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.61
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 99.6
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 99.6
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 99.6
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 99.6
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.6
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 99.59
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 99.59
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 99.59
2kj6_A97 Tubulin folding cofactor B; methods development, N 99.58
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 99.57
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 99.56
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 99.56
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 99.55
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.55
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 99.55
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 99.55
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 99.55
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 99.54
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 99.53
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 99.53
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 99.52
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 99.52
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 99.51
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 99.51
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.51
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 99.49
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 99.48
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 99.47
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 99.43
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 99.4
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.38
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 99.38
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 99.36
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 99.32
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 99.3
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.3
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 99.3
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.28
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 99.26
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 99.26
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.22
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 99.22
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.22
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.2
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 99.2
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.19
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.19
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 99.19
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 99.18
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 99.17
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.17
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 99.17
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 99.16
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.16
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.16
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 99.15
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.15
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 99.14
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.13
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 99.12
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 99.12
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 99.11
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 99.11
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.11
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 99.1
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.09
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 98.68
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 99.09
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.09
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.08
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 99.08
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 99.08
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 99.07
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 99.07
2fnj_B118 Transcription elongation factor B polypeptide 2; b 99.06
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 99.05
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 99.05
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 99.04
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 99.04
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.03
4ajy_B118 Transcription elongation factor B polypeptide 2; E 99.03
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 99.03
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 99.02
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 99.02
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 99.01
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 99.01
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 99.0
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 99.0
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 98.99
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 98.98
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 98.96
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 98.96
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 98.94
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 98.94
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 98.94
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 98.94
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 98.94
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 98.93
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 98.92
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 98.92
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 98.89
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 98.88
1we6_A111 Splicing factor, putative; structural genomics, ub 98.88
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 98.86
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 98.86
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 98.84
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 98.8
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 98.78
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 98.75
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 98.69
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 98.69
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 98.69
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 98.62
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 98.61
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 98.6
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 98.58
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 98.55
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 98.53
2xzm_9 189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 98.52
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 98.48
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 98.48
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 98.48
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 98.47
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 98.41
2pjh_A80 Protein NPL4, nuclear protein localization protein 98.39
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 98.39
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 98.33
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 98.3
2kj6_A97 Tubulin folding cofactor B; methods development, N 98.29
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 98.24
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 98.23
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 98.22
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 98.22
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 98.12
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 98.11
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 98.1
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 98.08
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 98.05
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 98.03
3v7o_A227 Minor nucleoprotein VP30; ssgcid, seattle structur 98.02
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 97.62
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 97.58
3ix6_A 360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 97.57
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 97.53
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 97.31
4da1_A 389 Protein phosphatase 1K, mitochondrial; metal-ION-a 97.29
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 97.15
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 96.99
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 96.9
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 96.75
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 96.63
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 96.62
3v7o_A 227 Minor nucleoprotein VP30; ssgcid, seattle structur 96.33
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 96.11
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 95.81
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 95.75
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 95.6
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 94.93
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 94.5
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 94.27
4e71_A111 Plexin-B2, MM1; transmembrane, signaling, RBD, str 94.16
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 94.12
3ix6_A 360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 94.03
2juo_A89 GA-binding protein alpha chain; OST, ubiquitin, tr 93.68
3h6n_A127 Plexin-D1; structural genomics consortium, SGC, me 93.66
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 93.65
2kvr_A130 Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi 93.45
2pjh_A80 Protein NPL4, nuclear protein localization protein 92.82
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 92.31
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 92.05
4e74_A117 Plexin-A4; RBD, structural genomics, structural ge 91.9
3uf8_A 209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 91.55
4da1_A 389 Protein phosphatase 1K, mitochondrial; metal-ION-a 91.47
3kuz_A126 Plexin-C1; structural genomics, structural genomic 91.09
2r2o_A138 Plexin-B1; effector domain, structural genomics, s 90.88
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 89.96
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 88.93
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 88.39
2ylm_A 530 Ubiquitin carboxyl-terminal hydrolase 7; UBL; 2.70 84.67
3ig3_A 627 Plxna3 protein; plexin intracellular GAP RBD inact 81.75
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
Probab=99.97  E-value=3.4e-30  Score=190.36  Aligned_cols=121  Identities=40%  Similarity=0.642  Sum_probs=115.4

Q ss_pred             eEEEEEEcCCCcHHHHHHHHHhhhCCCCcccEEEEcCeecCCCcccccccccccCCCcccccceeEEEeeeeeccccccC
Q 041424            2 KTVTLNVEKSETIKNLKGMVHEKEGTSEDIQDLFFAGDRLMNGRLIDYEDMALASPNVKRESTMQLLFCAIKVLSISVKA   81 (148)
Q Consensus         2 ~~~~l~v~~~~tV~~lK~~i~~~~gip~~~Q~L~~~g~~L~d~~~~~~~~~~L~~~~i~~~s~i~l~~~~~~~~~~~~~~   81 (148)
                      ++++++|++++||.+||++|++.+|+|+++|+|+|+|+.|+|+.       +|++|||+++++++++.+           
T Consensus        31 ~~~~l~v~~~~tV~~lK~~I~~~~gip~~~QrL~~~g~~L~d~~-------tL~~~~i~~~~~l~l~~~-----------   92 (172)
T 3u30_A           31 KTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGR-------TLSDYNIQKESTLHLVLR-----------   92 (172)
T ss_dssp             EEEEEEECTTCBHHHHHHHHHHHHCCCGGGEEEEETTEECCTTC-------BTGGGTCCTTCEEEEEEC-----------
T ss_pred             CEEEEEECCCCcHHHHHHHHHHHHCcChHHEEEEECCccccccC-------CHhHcCCcccceeeeeec-----------
Confidence            57899999999999999999999999999999999999999999       999999999999999999           


Q ss_pred             Cchhhhhheeeeeeeeeeeeeeehhhh-------Hhhhhhe----------eeecCeeeCCCCchhhhCCCCCCEEEEEe
Q 041424           82 PSDDILKLKVKIFVKMLTEEIVKLKVK-------VLLTIRD----------LFCTGMKLKDCKTLACYGVKDDRGVACFI  144 (148)
Q Consensus        82 p~~~~~~~~i~I~Vk~~~gk~~~l~v~-------lK~~i~e----------L~f~g~~L~d~~tL~~y~I~~gstI~l~l  144 (148)
                           +++|+.++|+..+|++++++++       +|++|++          |+|+|+.|+|+++|++|+|++|++|||++
T Consensus        93 -----~~gg~~i~Vk~~~g~~~~l~v~~~~tV~~lK~~I~~~~gip~~~q~L~~~g~~L~D~~tL~~y~i~~g~tl~l~~  167 (172)
T 3u30_A           93 -----LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  167 (172)
T ss_dssp             -----CCCCEEEEEEESSCCEEEEEECTTCBHHHHHHHHHHHHCCCGGGCCEEETTEECCTTSBSGGGTCCTTCEEEECC
T ss_pred             -----ccccccceeecccCcceeEEecCCCCHHHHHHHHHHHhCCCceeEEEEECCccCCCCCcHHHhCCCCCCEEEEEE
Confidence                 8899999999999999998887       8998886          99999999999999999999999999987


Q ss_pred             e
Q 041424          145 S  145 (148)
Q Consensus       145 ~  145 (148)
                      +
T Consensus       168 r  168 (172)
T 3u30_A          168 R  168 (172)
T ss_dssp             -
T ss_pred             e
Confidence            6



>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>2juo_A GA-binding protein alpha chain; OST, ubiquitin, transcription factor, ensemble, DNA-binding, nucleus, transcription regulation; NMR {Mus musculus} Back     alignment and structure
>3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>3kuz_A Plexin-C1; structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2ylm_A Ubiquitin carboxyl-terminal hydrolase 7; UBL; 2.70A {Homo sapiens} Back     alignment and structure
>3ig3_A Plxna3 protein; plexin intracellular GAP RBD inactive, membrane, transmembra membrane protein, signaling protein; 1.99A {Mus musculus} PDB: 3ryt_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 148
d1uh6a_100 d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mous 9e-10
d1zkha186 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t 3e-08
d2c9wb1103 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) 4e-08
d1v5oa_102 d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus mu 5e-08
d1wjna_97 d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse 7e-08
d1ogwa_76 d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [Tax 3e-07
d1wiaa_95 d.15.1.1 (A:) Ubiquitin-like protein bab25500 (201 4e-07
d1bt0a_73 d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis t 1e-06
d1z2ma276 d.15.1.1 (A:79-154) Interferon-induced 15 kDa prot 3e-06
d1z2ma176 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protei 3e-06
d1ttna180 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquit 3e-06
d1t0ya_90 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 3e-06
d1wjua_100 d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human 4e-06
d2zeqa178 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin 4e-06
d1v86a_95 d.15.1.1 (A:) hypothetical D7wsu128e protein {Mous 5e-06
d1wx9a173 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 5e-06
d2bwfa173 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc 8e-06
d1wy8a176 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING fing 1e-05
d1v2ya_105 d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik 2e-05
d1v6ea_95 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 3e-05
d1j8ca_103 d.15.1.1 (A:) Ubiquitin-like N-terminal domain of 8e-05
d1wgda_93 d.15.1.1 (A:) Homocysteine-responsive endoplasmic 9e-05
d1wgha_116 d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mous 1e-04
d1m94a_73 d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 1e-04
d1wxva181 d.15.1.1 (A:7-87) Bag-family molecular chaperone r 2e-04
d1wx8a183 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus muscul 2e-04
d1wgga_96 d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolas 3e-04
d1oqya477 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h 3e-04
d1oqya477 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h 0.001
d2faza176 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING fing 4e-04
d1yqba184 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapien 6e-04
d1euvb_79 d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea 8e-04
d1v5ta_90 d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus mu 0.004
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Ubiquitin-like protein 5, ubl5
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 50.8 bits (121), Expect = 9e-10
 Identities = 13/69 (18%), Positives = 25/69 (36%), Gaps = 9/69 (13%)

Query: 2  KTVTLNVEKSETIKNLKGMVHEKEGTSEDIQDLFFAGDRLMNGR-LIDYEDMALASPNVK 60
          K V +     +TI +LK ++  + GT  +   L        +   L DY         + 
Sbjct: 39 KKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY--------EIH 90

Query: 61 RESTMQLLF 69
              ++L +
Sbjct: 91 DGMNLELYY 99


>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 90 Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 105 Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 99.79
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 99.78
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 99.77
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.76
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 99.75
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 99.74
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 99.73
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 99.73
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 99.73
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.73
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 99.72
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 99.71
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 99.71
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 99.69
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 99.68
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 99.68
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.68
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.66
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 99.66
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 99.6
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 99.6
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 99.59
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 99.58
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 99.56
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 99.55
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 99.53
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 99.5
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 99.5
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 99.5
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 99.48
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 99.48
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 99.47
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 99.46
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 99.43
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 99.43
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 99.4
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 99.4
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 99.38
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 99.38
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 99.37
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 99.35
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 99.35
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 99.33
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 99.32
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.31
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 99.29
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.25
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 99.24
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 99.2
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.19
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.18
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 99.13
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 99.09
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 99.03
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 99.02
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 99.0
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 99.0
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 99.0
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 98.93
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 98.87
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 98.87
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 98.71
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 98.71
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 98.68
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 98.63
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 98.54
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 98.41
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 98.4
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 98.25
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 97.98
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 97.48
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 96.97
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 96.86
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 91.25
d1oeya_82 Neutrophil cytosol factor 2 (p67phox component of 89.93
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 89.89
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 84.81
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 81.78
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Ubiquitin-like domain of parkin
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.79  E-value=1.1e-19  Score=116.73  Aligned_cols=62  Identities=21%  Similarity=0.370  Sum_probs=60.8

Q ss_pred             eEEEEEEcCCCcHHHHHHHHHhhhCCCCcccEEEEcCeecCCCcccccccccccCCCcccccceeEEEe
Q 041424            2 KTVTLNVEKSETIKNLKGMVHEKEGTSEDIQDLFFAGDRLMNGRLIDYEDMALASPNVKRESTMQLLFC   70 (148)
Q Consensus         2 ~~~~l~v~~~~tV~~lK~~i~~~~gip~~~Q~L~~~g~~L~d~~~~~~~~~~L~~~~i~~~s~i~l~~~   70 (148)
                      ++++++|++++||++||++|++++|+||++|+|+|+|+.|+|+.       +|++|+|+++++||++.|
T Consensus        13 ~t~~l~v~~~~tV~~lK~~i~~~~gip~~~qrLi~~Gk~L~d~~-------tL~~y~I~~~sti~lv~R   74 (78)
T d2zeqa1          13 YGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHL-------TVQNCDLEQQSIVHIVQR   74 (78)
T ss_dssp             SCEEEEECTTCBHHHHHHHHHHHHTCCGGGEEEEETTEEECTTC-------BGGGSSCCTTCEEEEEES
T ss_pred             CEEEEEEcccccHHHHHHHHHHHHCcChhHeEEEEeeeEcCCCC-------CHHHcCCCCCCEEEEEec
Confidence            67999999999999999999999999999999999999999999       999999999999999998



>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oeya_ d.15.2.2 (A:) Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure