Citrus Sinensis ID: 041498

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MYICLFHALQNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQELHYLKAVVKETIRLQPT
cHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHccccc
ccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccEcHccccccHHHHHHHHHHHHHccc
MYICLFHALQNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLiggnkgfvneddVQELHYLKAVVKETIRLQPT
MYICLFHALQNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQELHYLKAVVKETIRLQPT
MYICLFHALQNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQELHYLKAVVKETIRLQPT
*YICLFHALQNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQELHYLKAVVKETI*****
MYICLFHALQNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQELHYLKAVVKETIRLQP*
MYICLFHALQNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQELHYLKAVVKETIRLQPT
MYICLFHALQNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQELHYLKAVVKETIRLQ**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYICLFHALQNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQELHYLKAVVKETIRLQPT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query80 2.2.26 [Sep-21-2011]
Q9LTL2 501 Cytochrome P450 71B25 OS= yes no 0.875 0.139 0.585 5e-18
O65782 499 Cytochrome P450 83B1 OS=A no no 0.85 0.136 0.550 4e-17
Q9LTM3 502 Cytochrome P450 71B20 OS= no no 0.887 0.141 0.507 2e-16
Q9LTL8 498 Cytochrome P450 71B24 OS= no no 0.887 0.142 0.541 3e-16
Q9LTM0 501 Cytochrome P450 71B23 OS= no no 0.887 0.141 0.478 4e-16
Q9LIP3 500 Cytochrome P450 71B37 OS= no no 0.875 0.14 0.591 8e-16
Q9SAE3 490 Cytochrome P450 71B28 OS= no no 0.887 0.144 0.478 9e-16
Q9LIP4 500 Cytochrome P450 71B36 OS= no no 0.875 0.14 0.577 2e-15
Q9LTM4 502 Cytochrome P450 71B19 OS= no no 0.887 0.141 0.478 3e-15
O65786 504 Cytochrome P450 71B4 OS=A no no 0.887 0.140 0.513 3e-15
>sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 Back     alignment and function desciption
 Score = 89.7 bits (221), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 41/70 (58%), Positives = 52/70 (74%)

Query: 10  QNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQELHYLKA 69
           Q++F  G +TSA TM+W+M  L+NNPR MKKVQ EIRS IG  K  + E+DV +L YLK 
Sbjct: 300 QDIFLAGIDTSAITMIWAMAELVNNPRVMKKVQDEIRSCIGIKKERIEEEDVGKLQYLKL 359

Query: 70  VVKETIRLQP 79
           V+KET+RL P
Sbjct: 360 VIKETLRLHP 369

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LTM3|C71BK_ARATH Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTL8|C71BO_ARATH Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 Back     alignment and function description
>sp|Q9SAE3|C71BS_ARATH Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIP4|C71BX_ARATH Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 Back     alignment and function description
>sp|Q9LTM4|C71BJ_ARATH Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 Back     alignment and function description
>sp|O65786|C71B4_ARATH Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
357016484 209 putative cytochrome P450 [Citrus sinensi 0.862 0.330 0.782 3e-25
224062041 513 cytochrome P450 [Populus trichocarpa] gi 0.887 0.138 0.680 7e-22
224062037 513 cytochrome P450 [Populus trichocarpa] gi 0.887 0.138 0.680 9e-22
255589898 267 cytochrome P450, putative [Ricinus commu 0.887 0.265 0.680 7e-21
225458055 495 PREDICTED: cytochrome P450 83B1 [Vitis v 0.875 0.141 0.661 5e-20
302142617 231 unnamed protein product [Vitis vinifera] 0.875 0.303 0.661 6e-20
224097756 504 cytochrome P450 [Populus trichocarpa] gi 0.887 0.140 0.652 7e-20
224065988 504 cytochrome P450 [Populus trichocarpa] gi 0.887 0.140 0.652 7e-20
255538866 496 cytochrome P450, putative [Ricinus commu 0.875 0.141 0.619 1e-19
255542144 441 cytochrome P450, putative [Ricinus commu 0.862 0.156 0.6 7e-19
>gi|357016484|gb|AET50435.1| putative cytochrome P450 [Citrus sinensis] Back     alignment and taxonomy information
 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 62/69 (89%)

Query: 11 NVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQELHYLKAV 70
          ++F  GT+TSAATMVW+MTYLM +PR MKKVQ EIRSL+GGNK FV+EDDVQELHYLKAV
Sbjct: 1  DIFVAGTDTSAATMVWTMTYLMMHPRVMKKVQEEIRSLVGGNKSFVDEDDVQELHYLKAV 60

Query: 71 VKETIRLQP 79
          VKE +RLQP
Sbjct: 61 VKEAMRLQP 69

Source: Citrus sinensis

Species: Citrus sinensis

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224062041|ref|XP_002300725.1| cytochrome P450 [Populus trichocarpa] gi|222842451|gb|EEE79998.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224062037|ref|XP_002300723.1| cytochrome P450 [Populus trichocarpa] gi|222842449|gb|EEE79996.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255589898|ref|XP_002535120.1| cytochrome P450, putative [Ricinus communis] gi|223523988|gb|EEF27263.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225458055|ref|XP_002278300.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142617|emb|CBI19820.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224097756|ref|XP_002334586.1| cytochrome P450 [Populus trichocarpa] gi|222873361|gb|EEF10492.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224065988|ref|XP_002301993.1| cytochrome P450 [Populus trichocarpa] gi|222843719|gb|EEE81266.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255538866|ref|XP_002510498.1| cytochrome P450, putative [Ricinus communis] gi|223551199|gb|EEF52685.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255542144|ref|XP_002512136.1| cytochrome P450, putative [Ricinus communis] gi|223549316|gb|EEF50805.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
TAIR|locus:2093526 501 CYP71B25 ""cytochrome P450, fa 0.875 0.139 0.585 2.1e-16
TAIR|locus:2125264 499 CYP83B1 ""cytochrome P450, fam 0.85 0.136 0.550 7.2e-16
TAIR|locus:2079316 500 CYP71B37 ""cytochrome P450, fa 0.875 0.14 0.591 1.5e-15
TAIR|locus:2093521 500 CYP71B22 ""cytochrome P450, fa 0.887 0.142 0.492 2e-15
TAIR|locus:2093541 499 CYP71B21 ""cytochrome P450, fa 0.887 0.142 0.492 2.5e-15
TAIR|locus:2079311 500 CYP71B36 ""cytochrome P450, fa 0.875 0.14 0.577 3.2e-15
TAIR|locus:2093516 502 CYP71B20 ""cytochrome P450, fa 0.887 0.141 0.507 3.3e-15
TAIR|locus:2093546 501 CYP71B3 ""cytochrome P450, fam 0.887 0.141 0.527 4.2e-15
TAIR|locus:2093556 498 CYP71B24 ""cytochrome P450, fa 0.887 0.142 0.541 5.3e-15
TAIR|locus:2093531 501 CYP71B23 ""cytochrome P450, fa 0.887 0.141 0.478 6.9e-15
TAIR|locus:2093526 CYP71B25 ""cytochrome P450, family 71, subfamily B, polypeptide 25"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 211 (79.3 bits), Expect = 2.1e-16, P = 2.1e-16
 Identities = 41/70 (58%), Positives = 52/70 (74%)

Query:    10 QNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQELHYLKA 69
             Q++F  G +TSA TM+W+M  L+NNPR MKKVQ EIRS IG  K  + E+DV +L YLK 
Sbjct:   300 QDIFLAGIDTSAITMIWAMAELVNNPRVMKKVQDEIRSCIGIKKERIEEEDVGKLQYLKL 359

Query:    70 VVKETIRLQP 79
             V+KET+RL P
Sbjct:   360 VIKETLRLHP 369
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2125264 CYP83B1 ""cytochrome P450, family 83, subfamily B, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079316 CYP71B37 ""cytochrome P450, family 71, subfamily B, polypeptide 37"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093521 CYP71B22 ""cytochrome P450, family 71, subfamily B, polypeptide 22"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093541 CYP71B21 ""cytochrome P450, family 71, subfamily B, polypeptide 21"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079311 CYP71B36 ""cytochrome P450, family 71, subfamily B, polypeptide 36"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093516 CYP71B20 ""cytochrome P450, family 71, subfamily B, polypeptide 20"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093546 CYP71B3 ""cytochrome P450, family 71, subfamily B, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093556 CYP71B24 ""cytochrome P450, family 71, subfamily B, polypeptide 24"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093531 CYP71B23 ""cytochrome P450, family 71, subfamily B, polypeptide 23"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 4e-21
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 3e-17
pfam00067 461 pfam00067, p450, Cytochrome P450 3e-17
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 4e-16
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 6e-16
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 5e-15
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 2e-13
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 2e-13
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 4e-10
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 4e-10
PLN02738 633 PLN02738, PLN02738, carotene beta-ring hydroxylase 3e-09
PLN03195 516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 6e-09
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 1e-08
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 2e-08
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 2e-08
PLN02290 516 PLN02290, PLN02290, cytokinin trans-hydroxylase 4e-06
PLN02936 489 PLN02936, PLN02936, epsilon-ring hydroxylase 1e-05
PLN02169 500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 1e-05
PLN02426 502 PLN02426, PLN02426, cytochrome P450, family 94, su 2e-05
COG2124 411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 3e-05
PLN02302 490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 2e-04
PLN02648 480 PLN02648, PLN02648, allene oxide synthase 0.001
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information 
 Score = 85.1 bits (210), Expect = 4e-21
 Identities = 37/69 (53%), Positives = 56/69 (81%), Gaps = 1/69 (1%)

Query: 11  NVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQELHYLKAV 70
           ++   GT+T+AA +VW+MTYL+  P AMKK Q E+R++I G+KG+V+E+D+  L YLKAV
Sbjct: 295 DIVVPGTDTAAAVVVWAMTYLIKYPEAMKKAQDEVRNVI-GDKGYVSEEDIPNLPYLKAV 353

Query: 71  VKETIRLQP 79
           +KE++RL+P
Sbjct: 354 IKESLRLEP 362

Length = 499
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|215350 PLN02648, PLN02648, allene oxide synthase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 80
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.94
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.93
PLN02971 543 tryptophan N-hydroxylase 99.93
PLN03234 499 cytochrome P450 83B1; Provisional 99.92
PLN02394 503 trans-cinnamate 4-monooxygenase 99.92
PLN02183 516 ferulate 5-hydroxylase 99.92
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.92
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.92
PLN02500 490 cytochrome P450 90B1 99.91
PLN00168 519 Cytochrome P450; Provisional 99.91
PLN02290 516 cytokinin trans-hydroxylase 99.91
PLN02966 502 cytochrome P450 83A1 99.91
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.91
PLN03112 514 cytochrome P450 family protein; Provisional 99.91
PTZ00404 482 cytochrome P450; Provisional 99.91
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.9
PLN02738 633 carotene beta-ring hydroxylase 99.9
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.9
PLN02655 466 ent-kaurene oxidase 99.9
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.9
PLN02774 463 brassinosteroid-6-oxidase 99.9
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.9
PLN03018 534 homomethionine N-hydroxylase 99.9
PLN02687 517 flavonoid 3'-monooxygenase 99.9
PLN02936 489 epsilon-ring hydroxylase 99.9
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.88
PLN02196 463 abscisic acid 8'-hydroxylase 99.88
PLN02302 490 ent-kaurenoic acid oxidase 99.87
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.86
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.85
PLN02648 480 allene oxide synthase 99.8
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.72
PF0595257 ComX: Bacillus competence pheromone ComX; InterPro 81.2
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.94  E-value=7.5e-27  Score=140.86  Aligned_cols=79  Identities=27%  Similarity=0.366  Sum_probs=75.1

Q ss_pred             ChHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHhChHHHHHHHHHHHHhhCCCCCCCCHHhhhcChhHHHHHHHHhcCCCC
Q 041498            1 MYICLFHALQNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQELHYLKAVVKETIRLQPT   80 (80)
Q Consensus         1 ~~~~i~~~~~~~~~ag~~tt~~~~~~~~~~l~~~p~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~l~~~i~E~lRl~p~   80 (80)
                      +.++|+.+++.+++||+||||++++.++|.|++||++|+|+++||+.++.+. ..++++.+.+|+|+++||+||||+||+
T Consensus       291 t~dei~aQafvFl~AGfeTts~tlsf~lYeLA~~PdvQ~kLreEI~~~~~~~-~~ltyd~l~~L~YLd~Vi~ETLR~yP~  369 (499)
T KOG0158|consen  291 TDDEIAAQAFVFLLAGFETTASTLSFALYELAKNPDVQDKLREEIDEVLEEK-EGLTYDSLSKLKYLDMVIKETLRLYPP  369 (499)
T ss_pred             CHHHHHHHHHHHHHhhhHhHHHHHHHHHHHHhcChHHHHHHHHHHHHHhccc-CCCCHHHHhCCcHHHHHHHHHHhhCCC
Confidence            5789999999999999999999999999999999999999999999997776 339999999999999999999999996

>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF05952 ComX: Bacillus competence pheromone ComX; InterPro: IPR009233 Competence is the ability of a cell to take up exogenous DNA from its environment, resulting in transformation Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
3k9v_A 482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 1e-06
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 3e-06
2q9f_A 456 Crystal Structure Of Human Cytochrome P450 46a1 In 1e-05
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 2e-05
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 2e-05
3qz1_A 496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 2e-05
3ld6_A 461 Crystal Structure Of Human Lanosterol 14alpha-Demet 1e-04
3dbg_A 467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 2e-04
4h1n_A 479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 2e-04
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 2e-04
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 4e-04
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 5e-04
3ua1_A 487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 6e-04
1w0e_A 485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 6e-04
1tqn_A 486 Crystal Structure Of Human Microsomal P450 3a4 Leng 6e-04
3e4e_A 476 Human Cytochrome P450 2e1 In Complex With The Inhib 8e-04
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 8e-04
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure 
Iteration: 1

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 47/76 (61%), Gaps = 1/76 (1%)
Query: 5   LFHALQNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQEL 64
           L+ A+  +      T+A +++W +  L  NP+A +++  E++S++  N+     +D++ +
Sbjct: 284 LYAAVTELQLAAVETTANSLMWILYNLSRNPQAQRRLLQEVQSVLPDNQT-PRAEDLRNM 342
Query: 65  HYLKAVVKETIRLQPT 80
            YLKA +KE++RL P+
Sbjct: 343 PYLKACLKESMRLTPS 358
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-26
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 6e-26
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 1e-23
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-23
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 3e-19
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 3e-16
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 8e-16
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 1e-15
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 6e-14
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 3e-13
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 4e-13
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 2e-12
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 3e-12
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 4e-12
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 7e-12
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 7e-12
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 2e-11
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 3e-11
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 3e-11
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 3e-11
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 4e-11
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 1e-10
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-10
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-10
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-10
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-10
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 5e-10
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 5e-09
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 7e-04
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score = 98.9 bits (247), Expect = 2e-26
 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 4/73 (5%)

Query: 7   HALQNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQELHY 66
            A+     V    +     W M YL+ +P A++ V+ EI+    G K    E+  +    
Sbjct: 256 RAMLLQLWVTQGNAGPAAFWVMGYLLTHPEALRAVREEIQ----GGKHLRLEERQKNTPV 311

Query: 67  LKAVVKETIRLQP 79
             +V+ ET+RL  
Sbjct: 312 FDSVLWETLRLTA 324
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.93
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.93
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.92
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.92
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.92
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.92
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.92
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.92
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.92
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.92
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.92
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.91
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.91
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.91
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.91
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.91
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.91
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.91
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.9
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.9
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.89
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.89
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.87
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.86
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.86
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.85
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.84
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.83
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.74
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.74
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.74
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.73
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.73
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.73
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.73
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.73
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.72
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.72
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.72
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.72
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.72
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.72
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.72
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.72
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.72
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.72
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.72
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.71
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.71
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.71
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.71
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.71
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.71
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.71
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.7
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.7
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.7
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.7
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.7
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.7
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.7
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.69
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.69
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.69
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.68
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.68
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.68
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.67
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.67
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.66
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.65
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.64
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.62
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.62
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.52
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.44
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.07
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=99.93  E-value=1.4e-25  Score=133.18  Aligned_cols=79  Identities=24%  Similarity=0.388  Sum_probs=75.3

Q ss_pred             ChHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHhChHHHHHHHHHHHHhhCCCCCCCCHHhhhcChhHHHHHHHHhcCCCC
Q 041498            1 MYICLFHALQNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQELHYLKAVVKETIRLQPT   80 (80)
Q Consensus         1 ~~~~i~~~~~~~~~ag~~tt~~~~~~~~~~l~~~p~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~l~~~i~E~lRl~p~   80 (80)
                      +++++...+..+++||+|||+.++.|++++|++||++|+++++|++.+++.. ..++.+++.+|||+++||+|++|++||
T Consensus       269 ~~~~i~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~-~~~~~~~l~~lpyl~avi~EtlRl~p~  347 (479)
T 3tbg_A          269 NDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQV-RRPEMGDQAHMPYTTAVIHEVQRFGDI  347 (479)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSS-SCCCHHHHTTCHHHHHHHHHHHHHHCS
T ss_pred             hhHHHHHHHHHHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHhhc-cccchhhhccccccccceeeecccccc
Confidence            4788999999999999999999999999999999999999999999998877 789999999999999999999999986
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 80
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 6e-05
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score = 37.0 bits (84), Expect = 6e-05
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 5   LFHALQNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQEL 64
           L   + ++F  GT T++ T+ +    ++  P   ++VQ EI  +IG +      DD  ++
Sbjct: 261 LILTVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSH-RPPALDDRAKM 319

Query: 65  HYLKAVVKETIR 76
            Y  AV+ E  R
Sbjct: 320 PYTDAVIHEIQR 331

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.9
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.9
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.89
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.89
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.87
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.84
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.71
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.62
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.52
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.34
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.23
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.13
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.07
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 98.95
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 98.94
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 98.91
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 98.9
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 98.75
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 98.69
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 98.63
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 98.03
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.90  E-value=7.9e-24  Score=123.33  Aligned_cols=79  Identities=29%  Similarity=0.400  Sum_probs=74.9

Q ss_pred             ChHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHhChHHHHHHHHHHHHhhCCCCCCCCHHhhhcChhHHHHHHHHhcCCCC
Q 041498            1 MYICLFHALQNVFAVGTNTSAATMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNEDDVQELHYLKAVVKETIRLQPT   80 (80)
Q Consensus         1 ~~~~i~~~~~~~~~ag~~tt~~~~~~~~~~l~~~p~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~l~~~i~E~lRl~p~   80 (80)
                      +++++.+.+..+++||++||+.++.|++++|++||++++++++|++.+.++. ..++..++.+|||+++||+|++|++|+
T Consensus       258 ~~~~i~~~~~~~~~Ag~dTTa~~l~~~l~~L~~~p~~~~~l~~Ei~~~~~~~-~~~~~~~~~~l~yL~a~i~E~lRl~p~  336 (467)
T d1r9oa_         258 TIESLENTAVDLFGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRN-RSPCMQDRSHMPYTDAVVHEVQRYIDL  336 (467)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSS-SCCCGGGGGGCHHHHHHHHHHHHHHTS
T ss_pred             chhHHHHHHHHHHHcccccchhHHHHHHHHhhcCchHHHHHHhhhhhhcCCC-CCCcHHHhhhhhhhhhhcccccccccc
Confidence            3688999999999999999999999999999999999999999999998877 789999999999999999999999986
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure