Citrus Sinensis ID: 041570

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390----
MGSGSKMVIMLVLSVLLILEVGWSEGCLEHERFALLRLRHFFSSPSRLQNWEDEQGDFCQWESVECSNTTGRVIGLDLSDTRNEDLGEGYLNAFLFTPFQQLESLILSNNSIAGCVENEGLEMLSRLSNLKFLDLRMNLFKNSISSSLARLSSLISLSLSHNKLEGSIEVKGSSKLQSLDLSHNNLNRIILSSLTTLSELYLSGMGFEGTFDVQEFDSLSNLEELYLSNNKGINNFVVPQDYRGLSKLKRLDLSGVGIRDGSELLRSMGSFPSLKTLFLEANNFTATTTQELHNFTNLEFLNLRHSSLDINLLKTIASFTSLKNLSMVSCEVNGVLDGQGFLNFKSLERLDMGGARNALNASFLQIIGESMASLKHLSLSYSILNANCTILNQA
ccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEccccccEEEEEccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccHHcccccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEccccccEEEcccccccccccccEEEccccccccEEcccHHHHHccccccEEEccccccEEEccccccc
cccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccccccccEEEEEcccccEEEEEEEEEEEcccccccccccHHHcccccccEEEccccccccccccccHHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccHHHHcccccccEEEEccccccccccccHHHcccccccEEEcccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcccccccEEEEEcccccccccccHHHHHHHHcccEEEcccccccccccccccc
MGSGSKMVIMLVLSVLLILevgwsegclEHERFALLRLRhffsspsrlqnwedeqgdfcqwesvecsnttgrvigldlsdtrnedlgegylnaflftpfQQLESLILSnnsiagcvenegLEMLSRLSNLKFLDLRMNLFKNSISSSLARLSSLISLSlshnklegsievkgssklqsldlshnNLNRIILSSLTTLSELYlsgmgfegtfdvqefdslsNLEELYLSnnkginnfvvpqdyrglsklkrldlsgvgirDGSELLrsmgsfpslkTLFLEANNFTATTTQELhnftnleflnlrhsSLDINLLKTIASFTslknlsmvscevngvldgqgflnfkslerldmggarnALNASFLQIIGESMASLKHLSLSYSILNANCTILNQA
MGSGSKMVIMLVLSVLLILEVGWSEGCLEHERFALLRLRHFFSSPSRLQNWEDEQGDFCQWESVECSNTTGRVIGLDLSDTRNEDLGEGYLNAFLFTPFQQLESLILSNNSIAGCVENEGLEMLSRLSNLKFLDLRMNLFKNSISSSLARLSSLISLSLSHNKLEGSIEVKGSSKLQSLDLSHNNLNRIILSSLTTLSELYLSGMGFEGTFDVQEFDSLSNLEELYLSNNKGINNFVVPQDYRGLSKLKRLDLSGVGIRDGSELLRSMGSFPSLKTLFLEANNFTATTTQELHNFTNLEFLNLRHSSLDINLLKTIASFTSLKNLSMVSCEVNGVLDGQGFLNFKSLERLDMGGARNALNASFLQIIGESMASLKHLSLSYSILNANCTILNQA
MGSGSKmvimlvlsvllilevGWSEGCLEHERFALLRLRHFFSSPSRLQNWEDEQGDFCQWESVECSNTTGRVIGLDLSDTRNEDLGEGYLNAFLFTPFQQLESLILSNNSIAGCVENEGLEMLSRLSNLKFLDLRMNLFKNsissslarlsslislslsHNKLEGSIEVKGSSKLQSLDLSHNNLNRIIlsslttlselylsGMGFEGTFDVQEFDslsnleelylsnnKGINNFVVPQDYRGLSKLKRLDLSGVGIRDGSELLRSMGSFPSLKTLFLEANNFTATTTQELHNFTNLEFLNLRHSSLDINLLKTIASFTSLKNLSMVSCEVNGVLDGQGFLNFKSLERLDMGGARNALNASFLQIIGESMASLKHLSLSYSILNANCTILNQA
******MVIMLVLSVLLILEVGWSEGCLEHERFALLRLRHFFSSPSRLQNWEDEQGDFCQWESVECSNTTGRVIGLDLSDTRNEDLGEGYLNAFLFTPFQQLESLILSNNSIAGCVENEGLEMLSRLSNLKFLDLRMNLFKNSISSSLARLSSLISLS*********************DLSHNNLNRIILSSLTTLSELYLSGMGFEGTFDVQEFDSLSNLEELYLSNNKGINNFVVPQDYRGLSKLKRLDLSGVGIRDGSELLRSMGSFPSLKTLFLEANNFTATTTQELHNFTNLEFLNLRHSSLDINLLKTIASFTSLKNLSMVSCEVNGVLDGQGFLNFKSLERLDMGGARNALNASFLQIIGESMASLKHLSLSYSILNANCTIL***
*****KM*IMLVLSVLLILEVGWSEGCLEHERFALLRLRHFFSSPSRLQNWEDEQGDFCQWESVECSNTTGRVIGLDLSDTRNEDLGEGYLNAFLFTPFQQLESLILSNNSIAGCVENEGLEMLSRLSNLKFLDLRMNLFKNSISSSLARLSSLISLSLSHNKLEGSIEVKGSSKLQSLDLSHNNLNRIILSSLTTLSELYLSGMGFEGTFDVQEFDSLSNLEELYLSNNKGINNFVVPQDYRGLSKLKRLDLSGVGIRDGSELLRSMGSFPSLKTLFLEANNFTATTTQELHNFTNLEFLNLRHSSLDINLLKTIASFTSLKNLSMVSCEVNGVLDGQGFLNFKSLERLDMGGARNALNASFLQIIGESMASLKHLSLSYSILNANCTIL***
MGSGSKMVIMLVLSVLLILEVGWSEGCLEHERFALLRLRHFFSSPSRLQNWEDEQGDFCQWESVECSNTTGRVIGLDLSDTRNEDLGEGYLNAFLFTPFQQLESLILSNNSIAGCVENEGLEMLSRLSNLKFLDLRMNLFKNSISSSLARLSSLISLSLSHNKLEGSIEVKGSSKLQSLDLSHNNLNRIILSSLTTLSELYLSGMGFEGTFDVQEFDSLSNLEELYLSNNKGINNFVVPQDYRGLSKLKRLDLSGVGIRDGSELLRSMGSFPSLKTLFLEANNFTATTTQELHNFTNLEFLNLRHSSLDINLLKTIASFTSLKNLSMVSCEVNGVLDGQGFLNFKSLERLDMGGARNALNASFLQIIGESMASLKHLSLSYSILNANCTILNQA
**SGSKMVIMLVLSVLLILEVGWSEGCLEHERFALLRLRHFFSSPSRLQNWEDEQGDFCQWESVECSNTTGRVIGLDLSDTRNEDLGEGYLNAFLFTPFQQLESLILSNNSIAGCVENEGLEMLSRLSNLKFLDLRMNLFKNSISSSLARLSSLISLSLSHNKLEGSIEVKGSSKLQSLDLSHNNLNRIILSSLTTLSELYLSGMGFEGTFDVQEFDSLSNLEELYLSNNKGINNFVVPQDYRGLSKLKRLDLSGVGIRDGSELLRSMGSFPSLKTLFLEANNFTATTTQELHNFTNLEFLNLRHSSLDINLLKTIASFTSLKNLSMVSCEVNGVLDGQGFLNFKSLERLDMGGARNALNASFLQIIGESMASLKHLSLSYSILNANCTI****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSGSKMVIMLVLSVLLILEVGWSEGCLEHERFALLRLRHFFSSPSRLQNWEDEQGDFCQWESVECSNTTGRVIGLDLSDTRNEDLGEGYLNAFLFTPFQQLESLILSNNSIAGCVENEGLEMLSRLSNLKFLDLRMNLFKNSISSSLARLSSLISLSLSHNKLEGSIEVKGSSKLQSLDLSHNNLNRIILSSLTTLSELYLSGMGFEGTFDVQEFDSLSNLEELYLSNNKGINNFVVPQDYRGLSKLKRLDLSGVGIRDGSELLRSMGSFPSLKTLFLEANNFTATTTQELHNFTNLEFLNLRHSSLDINLLKTIASFTSLKNLSMVSCEVNGVLDGQGFLNFKSLERLDMGGARNALNASFLQIIGESMASLKHLSLSYSILNANCTILNQA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query394 2.2.26 [Sep-21-2011]
C0LGJ1 1106 Probable LRR receptor-lik no no 0.865 0.308 0.280 2e-17
Q9M2Z1 1002 Leucine-rich repeat recep no no 0.700 0.275 0.301 2e-14
C0LGQ9 1037 Probable LRR receptor-lik no no 0.619 0.235 0.333 1e-13
Q9C9H7 847 Receptor-like protein 12 no no 0.847 0.394 0.266 4e-13
C0LGP4 1010 Probable LRR receptor-lik no no 0.748 0.292 0.275 3e-12
Q9LRT1 1016 Probably inactive leucine no no 0.771 0.299 0.289 5e-12
Q8VZG8 1045 Probable LRR receptor-lik no no 0.769 0.289 0.274 7e-12
Q9FRS6 1029 Leucine-rich repeat recep no no 0.807 0.309 0.260 8e-12
C0LGQ5 1249 LRR receptor-like serine/ no no 0.652 0.205 0.299 9e-12
Q9M5J9330 Polygalacturonase inhibit no no 0.413 0.493 0.321 1e-11
>sp|C0LGJ1|Y1743_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g74360 OS=Arabidopsis thaliana GN=At1g74360 PE=1 SV=1 Back     alignment and function desciption
 Score = 90.1 bits (222), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 107/382 (28%), Positives = 160/382 (41%), Gaps = 41/382 (10%)

Query: 28  LEHERFALLRLRHFFSSPSRLQN------WEDEQGDF-CQWESVECSNTTGRVIGLDLSD 80
           L+ +R  LL L+ +  S    QN      W+ E  D  CQW  + C+    RV G++L+D
Sbjct: 38  LDSDREVLLSLKSYLES-RNPQNRGLYTEWKMENQDVVCQWPGIICTPQRSRVTGINLTD 96

Query: 81  TRNEDLGEGYLNAFLFTPFQQLESLILSNNSIAGCVEN------------------EGLE 122
           +     G  + N   F+   +L  L LS N+I G + +                  EG  
Sbjct: 97  STIS--GPLFKN---FSALTELTYLDLSRNTIEGEIPDDLSRCHNLKHLNLSHNILEGEL 151

Query: 123 MLSRLSNLKFLDLRMNLFKNSISSSLARL-SSLISLSLSHNKLEGSIE--VKGSSKLQSL 179
            L  LSNL+ LDL +N     I SS     +SL+  +LS N   G I+    G   L+ +
Sbjct: 152 SLPGLSNLEVLDLSLNRITGDIQSSFPLFCNSLVVANLSTNNFTGRIDDIFNGCRNLKYV 211

Query: 180 DLSHNNLNRIILSSLTTLSELYLSGMGFEGTFDVQEFDSLSNLEELYLSNNKGINNFVVP 239
           D S N  +  + +    L E  ++     G      F     L+ L LS N     F  P
Sbjct: 212 DFSSNRFSGEVWTGFGRLVEFSVADNHLSGNISASMFRGNCTLQMLDLSGNAFGGEF--P 269

Query: 240 QDYRGLSKLKRLDLSGVGIRDGSELLRSMGSFPSLKTLFLEANNFTATTTQELHNFTNLE 299
                   L  L+L G        +   +GS  SLK L+L  N F+    + L N TNL 
Sbjct: 270 GQVSNCQNLNVLNLWGNKFT--GNIPAEIGSISSLKGLYLGNNTFSRDIPETLLNLTNLV 327

Query: 300 FLNLRHSSLDINLLKTIASFTSLKNLSMVSCEVNGVLDGQGFLNFKSLERLDMGGARNAL 359
           FL+L  +    ++ +    FT +K L + +    G ++    L   +L RLD+G   N  
Sbjct: 328 FLDLSRNKFGGDIQEIFGRFTQVKYLVLHANSYVGGINSSNILKLPNLSRLDLG--YNNF 385

Query: 360 NASFLQIIGESMASLKHLSLSY 381
           +      I + + SLK L L+Y
Sbjct: 386 SGQLPTEISQ-IQSLKFLILAY 406

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ9|Y4294_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function description
>sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9M5J9|PGIP1_ARATH Polygalacturonase inhibitor 1 OS=Arabidopsis thaliana GN=PGIP1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query394
224112233 976 leucine rich repeat family protein with 0.941 0.380 0.422 9e-54
224142723 923 predicted protein [Populus trichocarpa] 0.870 0.371 0.404 5e-50
224120450 935 predicted protein [Populus trichocarpa] 0.898 0.378 0.378 5e-49
224142721 926 predicted protein [Populus trichocarpa] 0.936 0.398 0.395 6e-49
224134597 947 predicted protein [Populus trichocarpa] 0.923 0.384 0.388 5e-48
224120284 929 predicted protein [Populus trichocarpa] 0.878 0.372 0.372 7e-48
224144186 973 predicted protein [Populus trichocarpa] 0.926 0.375 0.392 1e-47
224142717 876 predicted protein [Populus trichocarpa] 0.840 0.377 0.369 4e-40
224098008 1097 predicted protein [Populus trichocarpa] 0.921 0.330 0.352 5e-40
224073949280 predicted protein [Populus trichocarpa] 0.685 0.964 0.412 5e-39
>gi|224112233|ref|XP_002332812.1| leucine rich repeat family protein with ABC domain [Populus trichocarpa] gi|222833206|gb|EEE71683.1| leucine rich repeat family protein with ABC domain [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  217 bits (552), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 163/386 (42%), Positives = 228/386 (59%), Gaps = 15/386 (3%)

Query: 9   IMLVLSVLLILEVGWSE-GCLEHERFALLRLRHFFSSP--SRLQNWEDEQGDFCQWESVE 65
           ++LVL +L++   GW   GCLE ER ALL L+   + P  + L +W       C WES+ 
Sbjct: 1   MLLVLVILMVSLQGWVPLGCLEEERIALLHLKDSLNYPNGTSLPSWRIAHAHCCDWESIV 60

Query: 66  CSNTTGRVIGLDLSDTRNEDLGEGYLNAFLFTPFQQLESLILSNNSIAGCVENEGLEMLS 125
           C+++TGRV  LDL   RNEDLG+ YLNA LF PFQQL  L L NN IAG VEN+G   L 
Sbjct: 61  CNSSTGRVTVLDLWGVRNEDLGDWYLNASLFLPFQQLNVLYLWNNRIAGWVENKGGSELQ 120

Query: 126 RLSNLKFLDLRMNLFKNSISSSLARLSSLISLSLSHNKLEGSIEVKGS-SKLQSLDLSHN 184
           +LSNL+ L L  N F NSI S +  L SL SL LS+N+LEG I++K S S L++L L  N
Sbjct: 121 KLSNLESLYLEDNSFNNSILSFVEGLPSLKSLYLSYNRLEGLIDLKESLSSLETLGLGGN 180

Query: 185 NLNRIILS-SLTTLSELYLSGMGFEG-TFD-VQEFDSLSNLEELYLSNNKGINNFVVPQD 241
           N+++++ S  L+ L  L L  +   G +F  +Q   +  NL  LYL +N      ++  +
Sbjct: 181 NISKLVASRGLSNLRYLSLYNITTYGSSFQLLQSLRAFPNLTTLYLGSND-FRGRILGDE 239

Query: 242 YRGLSKLKRLDLSGVGIRDGSELLRSMGSFPSLKTLFLEANNFTATTTQELHNFTNLEFL 301
            + LS LK L L G  + + S  L+S+G+  SLK L L+  N T  +   L +  NLE+L
Sbjct: 240 LQNLSSLKMLYLDGCSLDEHS--LQSLGALSSLKNLSLQELNGTVPSGDFL-DLKNLEYL 296

Query: 302 NLRHSSLDINLLKTIASFTSLKNLSMVSCEVNG-VLDGQGFLNFKSLERLDMGGARNALN 360
           +L +++L+ ++ + I + TSLK L +  C +NG +   Q FL+ K+LE LD+  +  ALN
Sbjct: 297 DLSNTALNNSIFQAIGTMTSLKTLILEGCSLNGQIPTTQDFLDLKNLEYLDL--SNTALN 354

Query: 361 ASFLQIIGESMASLKHLSLSYSILNA 386
            S  Q IG +M SLK L L    LN 
Sbjct: 355 NSIFQAIG-TMTSLKTLILEGCSLNG 379

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224142723|ref|XP_002324704.1| predicted protein [Populus trichocarpa] gi|222866138|gb|EEF03269.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224120450|ref|XP_002331051.1| predicted protein [Populus trichocarpa] gi|222872981|gb|EEF10112.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142721|ref|XP_002324703.1| predicted protein [Populus trichocarpa] gi|222866137|gb|EEF03268.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134597|ref|XP_002327443.1| predicted protein [Populus trichocarpa] gi|222835997|gb|EEE74418.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224120284|ref|XP_002331010.1| predicted protein [Populus trichocarpa] gi|222872940|gb|EEF10071.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224144186|ref|XP_002336117.1| predicted protein [Populus trichocarpa] gi|222873047|gb|EEF10178.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142717|ref|XP_002324701.1| predicted protein [Populus trichocarpa] gi|222866135|gb|EEF03266.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224098008|ref|XP_002334579.1| predicted protein [Populus trichocarpa] gi|222873205|gb|EEF10336.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073949|ref|XP_002335892.1| predicted protein [Populus trichocarpa] gi|222836248|gb|EEE74669.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query394
TAIR|locus:2037308 976 RLP14 "AT1G74180" [Arabidopsis 0.741 0.299 0.269 4.4e-23
TAIR|locus:2155909 908 RLP56 "AT5G49290" [Arabidopsis 0.832 0.361 0.289 1.1e-22
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.403 0.170 0.340 1.1e-22
TAIR|locus:2019662 965 RLP15 "AT1G74190" [Arabidopsis 0.852 0.348 0.251 7.5e-17
TAIR|locus:2096339 786 RLP30 "receptor like protein 3 0.378 0.189 0.325 6.9e-14
TAIR|locus:2055772 983 RLP19 "receptor like protein 1 0.885 0.355 0.252 1.1e-12
TAIR|locus:2019255 1106 AT1G74360 [Arabidopsis thalian 0.725 0.258 0.249 9.1e-05
TAIR|locus:2139885 1013 AT4G28650 [Arabidopsis thalian 0.837 0.325 0.238 3.5e-11
TAIR|locus:2120412 992 BAM3 "BARELY ANY MERISTEM 3" [ 0.365 0.145 0.331 6.9e-11
TAIR|locus:2129246 891 RLP50 "receptor like protein 5 0.322 0.142 0.280 9.4e-11
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 253 (94.1 bits), Expect = 4.4e-23, Sum P(2) = 4.4e-23
 Identities = 85/315 (26%), Positives = 137/315 (43%)

Query:    27 CLEHERFALLRLRHFFSSP-------SRLQNW-EDEQGDFCQWESVECSNTTGRVIGLDL 78
             C+E ER ALL L+ +  S        S L  W  D + + C+WE ++C+ T+GR+I L +
Sbjct:    27 CIEKERKALLELKKYMISKTADWGLDSVLPTWTNDTKSNCCRWEGLKCNQTSGRIIELSI 86

Query:    79 SDTRNEDLGEGYLNAFLFTPFQQLESLILSN---NSIAGCVEN-EGLEMLSRLSNLKFLD 134
               T  ++     LN  L  PF++L SL LS    N   G  ++ EG E L RL NL+ LD
Sbjct:    87 GQTNFKE--SSLLNLSLLHPFEELRSLNLSGEIYNEFNGLFDDVEGYESLRRLRNLEILD 144

Query:   135 LRMNLFKNXXXXXXXXXXXXXXXXXXHNKLEGSI---EVKGSSKLQSLDLSHNNLNRII- 190
             L  N F N                   N + G +   E+K  +KL+ LDLS +  N  I 
Sbjct:   145 LSSNSFNNSIFPFLNAATSLTTLFIQSNYIGGPLPIKELKNLTKLELLDLSRSGYNGSIP 204

Query:   191 -XXXXXXXXXXXXXGMGFEGTFDVQEFDXXXXXXXXXXXXXKGINNFVVPQDYRGLSKLK 249
                              F    ++QE                 ++  +  + +  +  L+
Sbjct:   205 EFTHLEKLKALDLSANDFSSLVELQELKVLTNLEVLGLAWNH-LDGPIPKEVFCEMKNLR 263

Query:   250 RLDLSGVGIRDGSELLRSMGSFPSLKTLFLEANNFTATTTQELHNFTNLEFLNLRHSSLD 309
             +LDL G    +G +L   +G+   L+ L L +N  +       ++  +LE+L+L  ++ +
Sbjct:   264 QLDLRG-NYFEG-QLPVCLGNLNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNFE 321

Query:   310 -INLLKTIASFTSLK 323
                 L  +A+ T LK
Sbjct:   322 GFFSLNPLANLTKLK 336
GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096339 RLP30 "receptor like protein 30" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019255 AT1G74360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139885 AT4G28650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120412 BAM3 "BARELY ANY MERISTEM 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_scaffold_281000005
leucine rich repeat family protein with ABC domain (976 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query394
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-14
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-04
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score = 73.7 bits (181), Expect = 5e-14
 Identities = 85/308 (27%), Positives = 150/308 (48%), Gaps = 27/308 (8%)

Query: 35  LLRLRHFFSSPSR-LQNWEDEQGDFCQWESVECSNTTGRVIGLDLSDTRNEDLGEGYLNA 93
           LL  +   + P + L NW +   D C W+ + C+N++ RV+ +DLS    +++     +A
Sbjct: 34  LLSFKSSINDPLKYLSNW-NSSADVCLWQGITCNNSS-RVVSIDLS---GKNISGKISSA 88

Query: 94  FLFTPFQQLESLILSNNSIAGCVENEGLEMLSRLSNLKFLDLRMNLFKNSISSSLARLSS 153
               P+  ++++ LSNN ++G + +   ++ +  S+L++L+L  N F  SI      + +
Sbjct: 89  IFRLPY--IQTINLSNNQLSGPIPD---DIFTTSSSLRYLNLSNNNFTGSIPR--GSIPN 141

Query: 154 LISLSLSHNKLEGSI--EVKGSSKLQSLDLSHNNLNRII---LSSLTTLSELYLSGMGFE 208
           L +L LS+N L G I  ++   S L+ LDL  N L   I   L++LT+L  L L+     
Sbjct: 142 LETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLV 201

Query: 209 GTFDVQEFDSLSNLEELYLSNNKGINNFV--VPQDYRGLSKLKRLDLSGVGIRDGSELLR 266
           G     E   + +L+ +YL    G NN    +P +  GL+ L  LDL  V       +  
Sbjct: 202 GQIPR-ELGQMKSLKWIYL----GYNNLSGEIPYEIGGLTSLNHLDL--VYNNLTGPIPS 254

Query: 267 SMGSFPSLKTLFLEANNFTATTTQELHNFTNLEFLNLRHSSLDINLLKTIASFTSLKNLS 326
           S+G+  +L+ LFL  N  +      + +   L  L+L  +SL   + + +    +L+ L 
Sbjct: 255 SLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILH 314

Query: 327 MVSCEVNG 334
           + S    G
Sbjct: 315 LFSNNFTG 322

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 394
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.89
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.85
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.81
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.81
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
KOG4237498 consensus Extracellular matrix protein slit, conta 99.76
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
PLN03150623 hypothetical protein; Provisional 99.49
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.47
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.41
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.28
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.28
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.27
PLN03150623 hypothetical protein; Provisional 99.26
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.26
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.23
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.22
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.21
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.12
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.11
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.89
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.86
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.86
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.86
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.83
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.8
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.77
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.76
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.75
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.64
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.64
KOG4341483 consensus F-box protein containing LRR [General fu 98.59
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.57
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.53
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.48
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.43
KOG4341483 consensus F-box protein containing LRR [General fu 98.32
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.06
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.03
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.98
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.96
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.91
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.9
PRK15386 426 type III secretion protein GogB; Provisional 97.87
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.85
PRK15386 426 type III secretion protein GogB; Provisional 97.84
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.53
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.53
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.46
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.34
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.33
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.18
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.07
KOG1947 482 consensus Leucine rich repeat proteins, some prote 96.26
KOG4308478 consensus LRR-containing protein [Function unknown 96.24
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.55
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.45
KOG4308478 consensus LRR-containing protein [Function unknown 94.55
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.63
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.94
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.8
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.89
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.3
smart0037026 LRR Leucine-rich repeats, outliers. 89.1
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.1
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.08
KOG0473 326 consensus Leucine-rich repeat protein [Function un 87.71
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 84.06
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.2e-43  Score=368.68  Aligned_cols=341  Identities=26%  Similarity=0.381  Sum_probs=231.4

Q ss_pred             CHHHHHHHHHhhhhcCCCC-CCCCCCCCCCCCCccceeEecCCCCcEEEEecCCCCCCCCCCCccccccCCCCCCCCEEe
Q 041570           28 LEHERFALLRLRHFFSSPS-RLQNWEDEQGDFCQWESVECSNTTGRVIGLDLSDTRNEDLGEGYLNAFLFTPFQQLESLI  106 (394)
Q Consensus        28 ~~~~~~al~~~~~~~~~~~-~~~~W~~~~~~~c~w~gv~c~~~~~~v~~l~l~~~~~~~~~~~~l~~~~~~~l~~L~~L~  106 (394)
                      .++|+.||++|++++.+|. .+.+|.. ..++|.|.||+|+. .++|+.++++++++....     +..+..+++|+.|+
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~-~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~-----~~~~~~l~~L~~L~   99 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNS-SADVCLWQGITCNN-SSRVVSIDLSGKNISGKI-----SSAIFRLPYIQTIN   99 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCC-CCCCCcCcceecCC-CCcEEEEEecCCCccccC-----ChHHhCCCCCCEEE
Confidence            5689999999999998776 7889975 67899999999984 679999999998875322     23467788888888


Q ss_pred             ccCCcCCCccccchhhhhcCCCCCcEEEcccccCCccchHhhhcCCCCCEEEcCCceeecccc--ccCCCCCCEEEcCCC
Q 041570          107 LSNNSIAGCVENEGLEMLSRLSNLKFLDLRMNLFKNSISSSLARLSSLISLSLSHNKLEGSIE--VKGSSKLQSLDLSHN  184 (394)
Q Consensus       107 l~~~~l~~~~~~~~~~~l~~l~~L~~L~L~~n~~~~~~p~~l~~l~~L~~L~l~~n~l~~~~~--~~~~~~L~~L~l~~n  184 (394)
                      +++|.+++.+|...   +..+++|++|++++|.+++.+|.  +.+++|++|++++|.+++.+|  +..+++|++|++++|
T Consensus       100 Ls~n~~~~~ip~~~---~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n  174 (968)
T PLN00113        100 LSNNQLSGPIPDDI---FTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGN  174 (968)
T ss_pred             CCCCccCCcCChHH---hccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccC
Confidence            88888887777642   44677777777777777666654  346667777777766665555  455666667777666


Q ss_pred             CCCccccc---cCCCCcEEEccCcccCCccChhhhcCCCCCCEEECCCCCCCCCcccCcCCCCCCCcCEEEcCCCCCCCC
Q 041570          185 NLNRIILS---SLTTLSELYLSGMGFEGTFDVQEFDSLSNLEELYLSNNKGINNFVVPQDYRGLSKLKRLDLSGVGIRDG  261 (394)
Q Consensus       185 ~l~~~~~~---~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~l~~L~~L~l~~n~~~~~  261 (394)
                      .+.+..|.   ++++|++|++++|.+.+.+| ..++++++|++|++++|.+. +.+|. .+..+++|++|++++|.+++.
T Consensus       175 ~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p-~~l~~l~~L~~L~L~~n~l~-~~~p~-~l~~l~~L~~L~L~~n~l~~~  251 (968)
T PLN00113        175 VLVGKIPNSLTNLTSLEFLTLASNQLVGQIP-RELGQMKSLKWIYLGYNNLS-GEIPY-EIGGLTSLNHLDLVYNNLTGP  251 (968)
T ss_pred             cccccCChhhhhCcCCCeeeccCCCCcCcCC-hHHcCcCCccEEECcCCccC-CcCCh-hHhcCCCCCEEECcCceeccc
Confidence            66665554   55666666666666666655 56666666666666666665 44444 556666666666666666655


Q ss_pred             hhhhhhcCCCCCCCEEeCcCCCCCccchhhcCCCCCCCEEEcCCCcCChhhhhchhccCCCCeEecCCcccceeechhhc
Q 041570          262 SELLRSMGSFPSLKTLFLEANNFTATTTQELHNFTNLEFLNLRHSSLDINLLKTIASFTSLKNLSMVSCEVNGVLDGQGF  341 (394)
Q Consensus       262 ~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~n~l~~~~~~~l~~~~~L~~L~l~~n~l~~~ip~~~~  341 (394)
                        +|..+..+++|++|++++|.+++..|..+..+++|+.|++++|.+.+.+|..+.++++|++|++++|.+.+.+|. .+
T Consensus       252 --~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~-~~  328 (968)
T PLN00113        252 --IPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPV-AL  328 (968)
T ss_pred             --cChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCCh-hH
Confidence              566666666666666666666666666666666666666666666666666666666666666666666665555 55


Q ss_pred             cCCCCCcEEEcCCCCcccCCccccccccccCCCcEEeccccccceeEe
Q 041570          342 LNFKSLERLDMGGARNALNASFLQIIGESMASLKHLSLSYSILNANCT  389 (394)
Q Consensus       342 ~~~~~L~~L~l~~~~n~l~~g~l~~~~~~~~~L~~L~l~~n~l~g~~~  389 (394)
                      ..+++|+.|++++  |.++ +.+|..++.+++|+.|++++|+++|.+|
T Consensus       329 ~~l~~L~~L~L~~--n~l~-~~~p~~l~~~~~L~~L~Ls~n~l~~~~p  373 (968)
T PLN00113        329 TSLPRLQVLQLWS--NKFS-GEIPKNLGKHNNLTVLDLSTNNLTGEIP  373 (968)
T ss_pred             hcCCCCCEEECcC--CCCc-CcCChHHhCCCCCcEEECCCCeeEeeCC
Confidence            5666666666666  5565 5666666666666666666666655544

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query394
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-43
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-27
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-24
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-21
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-18
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-32
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-25
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-29
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-25
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-27
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-25
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-24
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-26
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-25
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-19
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-25
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-25
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-24
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-18
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-23
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-16
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-22
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-18
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-15
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-12
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-11
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-13
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-12
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-11
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-10
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-07
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 6e-10
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 8e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-07
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-08
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 9e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-07
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 1e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  158 bits (403), Expect = 5e-43
 Identities = 90/394 (22%), Positives = 147/394 (37%), Gaps = 62/394 (15%)

Query: 26  GCLEHERFALLRLRHFFSSPSRLQNWEDEQGDFCQWESVECSNTTGRVIGLDLSDTRNED 85
             L  E   L+  +      + L +W   + + C ++ V C +   +V  +DLS  +  +
Sbjct: 8   QSLYREIHQLISFKDVLPDKNLLPDWSSNK-NPCTFDGVTCRD--DKVTSIDLSS-KPLN 63

Query: 86  LGEGYLNAFLFTPFQQLESLILSNNSIAGCVENEGLEMLSRLSNLKFLDLRMNLFKNSIS 145
           +G   +++ L      LESL LSN+ I G V           ++L  LDL  N     ++
Sbjct: 64  VGFSAVSSSLL-SLTGLESLFLSNSHINGSVSG-----FKCSASLTSLDLSRNSLSGPVT 117

Query: 146 S--SLARLSSLISLSLSHNKLEGSIEV---KGSSKLQSLDLSHNNLNRII------LSSL 194
           +  SL   S L  L++S N L+   +V      + L+ LDLS N+++             
Sbjct: 118 TLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGC 177

Query: 195 TTLSELYLSGMGFEGTFDVQEFDSLSNLEELYLSNNK-------------------GINN 235
             L  L +SG    G     +     NLE L +S+N                      N 
Sbjct: 178 GELKHLAISGNKISGDV---DVSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNK 234

Query: 236 FV--VPQDYRGLSKLKRLDLSGVGIRDGSELLRSMGSFP-----SLKTLFLEANNFTATT 288
                 +     ++LK L++S              G  P     SL+ L L  N FT   
Sbjct: 235 LSGDFSRAISTCTELKLLNISSNQFV---------GPIPPLPLKSLQYLSLAENKFTGEI 285

Query: 289 TQEL-HNFTNLEFLNLRHSSLDINLLKTIASFTSLKNLSMVSCEVNGVLDGQGFLNFKSL 347
              L      L  L+L  +     +     S + L++L++ S   +G L     L  + L
Sbjct: 286 PDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGL 345

Query: 348 ERLDMGGARNALNASFLQIIGESMASLKHLSLSY 381
           + LD+    N  +    + +    ASL  L LS 
Sbjct: 346 KVLDLSF--NEFSGELPESLTNLSASLLTLDLSS 377
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query394
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.98
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.96
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.92
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.91
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.91
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.67
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.59
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.54
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.48
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.38
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.27
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.26
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.22
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.12
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.04
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.02
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.01
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.9
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.84
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.8
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.59
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.43
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.4
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.39
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.32
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.09
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.93
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.57
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.51
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.7e-46  Score=381.74  Aligned_cols=349  Identities=24%  Similarity=0.260  Sum_probs=223.1

Q ss_pred             CCccCHHHHHHHHHhhhhcCCCCCCCCCCCCCCCCCccceeEecCCCCcEEEEecCCCCCCCCCCCcccc----------
Q 041570           24 SEGCLEHERFALLRLRHFFSSPSRLQNWEDEQGDFCQWESVECSNTTGRVIGLDLSDTRNEDLGEGYLNA----------   93 (394)
Q Consensus        24 ~~~~~~~~~~al~~~~~~~~~~~~~~~W~~~~~~~c~w~gv~c~~~~~~v~~l~l~~~~~~~~~~~~l~~----------   93 (394)
                      ++++.++|++||++||+++.+|..+++|.. +.+||.|.||+|+  .++|+++++++.++..... .+++          
T Consensus         6 ~~~~~~~~~~all~~k~~~~~~~~l~~W~~-~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~-~l~~~l~~L~~L~~   81 (768)
T 3rgz_A            6 PSQSLYREIHQLISFKDVLPDKNLLPDWSS-NKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFS-AVSSSLLSLTGLES   81 (768)
T ss_dssp             --CCHHHHHHHHHHHHTTCSCTTSSTTCCT-TSCGGGSTTEEEE--TTEEEEEECTTSCCCEEHH-HHHHHTTTCTTCCE
T ss_pred             cccCCHHHHHHHHHHHhhCCCcccccCCCC-CCCCcCCcceEEC--CCcEEEEECCCCCcCCccC-ccChhHhccCcccc
Confidence            355578899999999999998777889974 7799999999997  6899999999987643100 0111          


Q ss_pred             ------------ccCCCCCCCCEEeccCCcCCCccccchhhhhcCCCCCcEEEcccccCCccchHhh-hcCCCCCEEEcC
Q 041570           94 ------------FLFTPFQQLESLILSNNSIAGCVENEGLEMLSRLSNLKFLDLRMNLFKNSISSSL-ARLSSLISLSLS  160 (394)
Q Consensus        94 ------------~~~~~l~~L~~L~l~~~~l~~~~~~~~~~~l~~l~~L~~L~L~~n~~~~~~p~~l-~~l~~L~~L~l~  160 (394)
                                  ..+..+++|++|+|++|.++|.+|..  ..++++++|++|++++|.+.+.+|..+ .++++|++|+++
T Consensus        82 l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~--~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls  159 (768)
T 3rgz_A           82 LFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTL--TSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLS  159 (768)
T ss_dssp             EECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGG--GGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECC
T ss_pred             cCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCCh--HHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECC
Confidence                        23455666666666666666555431  125556666666666665555555443 455555566665


Q ss_pred             Cceeecccc-----ccCCCCCCEEEcCCCCCCccccc-cCCCCcEEEccCcccCCccChhhhcCCCCCCEEECCCCCCCC
Q 041570          161 HNKLEGSIE-----VKGSSKLQSLDLSHNNLNRIILS-SLTTLSELYLSGMGFEGTFDVQEFDSLSNLEELYLSNNKGIN  234 (394)
Q Consensus       161 ~n~l~~~~~-----~~~~~~L~~L~l~~n~l~~~~~~-~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~n~~~~  234 (394)
                      +|.+++..+     +..+++|++|++++|.+.+..+. .+++|++|++++|.+.+.++ . ++++++|++|++++|.+. 
T Consensus       160 ~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~-~-l~~l~~L~~L~Ls~n~l~-  236 (768)
T 3rgz_A          160 ANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIP-F-LGDCSALQHLDISGNKLS-  236 (768)
T ss_dssp             SSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCC-B-CTTCCSCCEEECCSSCCC-
T ss_pred             CCccCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCc-c-cccCCCCCEEECcCCcCC-
Confidence            555555443     34445555555555555554433 55666666666666665554 2 566666666666666655 


Q ss_pred             CcccCcCCCCCCCcCEEEcCCCCCCCChhhhhhcCCCCCCCEEeCcCCCCCccchhhcCCC-CCCCEEEcCCCcCChhhh
Q 041570          235 NFVVPQDYRGLSKLKRLDLSGVGIRDGSELLRSMGSFPSLKTLFLEANNFTATTTQELHNF-TNLEFLNLRHSSLDINLL  313 (394)
Q Consensus       235 ~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~l~~~-~~L~~L~l~~n~l~~~~~  313 (394)
                      +.++. .+..+++|++|++++|.+++.  +|..  .+++|++|++++|.+++.+|..+... ++|++|++++|.+++.+|
T Consensus       237 ~~~~~-~l~~l~~L~~L~Ls~n~l~~~--~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p  311 (768)
T 3rgz_A          237 GDFSR-AISTCTELKLLNISSNQFVGP--IPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVP  311 (768)
T ss_dssp             SCHHH-HTTTCSSCCEEECCSSCCEES--CCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCC
T ss_pred             CcccH-HHhcCCCCCEEECCCCcccCc--cCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccc
Confidence            44443 556666666666666665544  3322  45566666666666665666665553 777777777777777777


Q ss_pred             hchhccCCCCeEecCCcccceeechhhccCCCCCcEEEcCCCCcccCCccccccccccC-CCcEEeccccccceeEe
Q 041570          314 KTIASFTSLKNLSMVSCEVNGVLDGQGFLNFKSLERLDMGGARNALNASFLQIIGESMA-SLKHLSLSYSILNANCT  389 (394)
Q Consensus       314 ~~l~~~~~L~~L~l~~n~l~~~ip~~~~~~~~~L~~L~l~~~~n~l~~g~l~~~~~~~~-~L~~L~l~~n~l~g~~~  389 (394)
                      ..++++++|++|++++|.++|.+|...+..+++|++|++++  |.++ |.+|..+..++ +|++|++++|+++|.+|
T Consensus       312 ~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~--n~l~-~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~  385 (768)
T 3rgz_A          312 PFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSF--NEFS-GELPESLTNLSASLLTLDLSSNNFSGPIL  385 (768)
T ss_dssp             GGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCS--SEEE-ECCCTTHHHHTTTCSEEECCSSEEEEECC
T ss_pred             hHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcC--CccC-ccccHHHHhhhcCCcEEEccCCCcCCCcC
Confidence            77777777777777777777777764467777777777777  7776 67776666665 66666666666666554
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 394
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 6e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 71.2 bits (173), Expect = 3e-14
 Identities = 45/178 (25%), Positives = 73/178 (41%), Gaps = 14/178 (7%)

Query: 128 SNLKFLDLRMNLFKNSISSSLARLSSLISLSLSHNKLEGSIEVKGSSKLQSLDLSHNNLN 187
           +NL  L L  N  K+    +LA L++L  L L++N++     + G +KL  L L  N ++
Sbjct: 219 TNLDELSLNGNQLKDI--GTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQIS 276

Query: 188 RIILSSLTTLSELYLSGMGFEGTFDVQEFDSLSNLEELYLSNNKGINNFVVPQDYRGLSK 247
            I    L  L+ L    +      D+    +L NL  L L      NN         L+K
Sbjct: 277 NIS--PLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYF----NNISDISPVSSLTK 330

Query: 248 LKRLDLSGVGIRDGSELLRSMGSFPSLKTLFLEANNFTATTTQELHNFTNLEFLNLRH 305
           L+RL  +   + D    + S+ +  ++  L    N    +    L N T +  L L  
Sbjct: 331 LQRLFFANNKVSD----VSSLANLTNINWLSAGHNQI--SDLTPLANLTRITQLGLND 382
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query394
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.73
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.67
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.65
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.65
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.61
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.3
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.35
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.24
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.21
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.07
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.79
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=1.4e-40  Score=301.07  Aligned_cols=293  Identities=22%  Similarity=0.348  Sum_probs=202.5

Q ss_pred             ccCHHHHHHHHHhhhhcCCCCCCCCCCCCCCCCC--ccceeEecCCC--CcEEEEecCCCCCCCCCCCccccccCCCCCC
Q 041570           26 GCLEHERFALLRLRHFFSSPSRLQNWEDEQGDFC--QWESVECSNTT--GRVIGLDLSDTRNEDLGEGYLNAFLFTPFQQ  101 (394)
Q Consensus        26 ~~~~~~~~al~~~~~~~~~~~~~~~W~~~~~~~c--~w~gv~c~~~~--~~v~~l~l~~~~~~~~~~~~l~~~~~~~l~~  101 (394)
                      -|.++|++||++||+++.+|..+++|.. ++|||  .|.||+|+...  +||++|+|+++++...  ..++. .+.++++
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~~l~sW~~-~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~--~~lp~-~l~~L~~   77 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPTTLSSWLP-TTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKP--YPIPS-SLANLPY   77 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCT-TSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSC--EECCG-GGGGCTT
T ss_pred             CCCHHHHHHHHHHHHHCCCCCcCCCCCC-CCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCC--CCCCh-HHhcCcc
Confidence            3899999999999999998888889975 78999  49999998643  4899999999877432  12322 3567777


Q ss_pred             CCEEeccC-CcCCCccccchhhhhcCCCCCcEEEcccccCCccchHhhhcCCCCCEEEcCCceeecccc--ccCCCCCCE
Q 041570          102 LESLILSN-NSIAGCVENEGLEMLSRLSNLKFLDLRMNLFKNSISSSLARLSSLISLSLSHNKLEGSIE--VKGSSKLQS  178 (394)
Q Consensus       102 L~~L~l~~-~~l~~~~~~~~~~~l~~l~~L~~L~L~~n~~~~~~p~~l~~l~~L~~L~l~~n~l~~~~~--~~~~~~L~~  178 (394)
                      |++|+|++ |+++|.+|..    ++++++|++|++++|.+.+..+..+..+.+|+++++++|.+.+.+|  +..++.+++
T Consensus        78 L~~L~Ls~~N~l~g~iP~~----i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~  153 (313)
T d1ogqa_          78 LNFLYIGGINNLVGPIPPA----IAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVG  153 (313)
T ss_dssp             CSEEEEEEETTEESCCCGG----GGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCE
T ss_pred             ccccccccccccccccccc----cccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccce
Confidence            77777775 6777776654    6777777777777777777666667777777777777777766555  444455555


Q ss_pred             EEcCCCCCCccccccCCCCcEEEccCcccCCccChhhhcCCCCC-CEEECCCCCCCCCcccCcCCCCCCCcCEEEcCCCC
Q 041570          179 LDLSHNNLNRIILSSLTTLSELYLSGMGFEGTFDVQEFDSLSNL-EELYLSNNKGINNFVVPQDYRGLSKLKRLDLSGVG  257 (394)
Q Consensus       179 L~l~~n~l~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L-~~L~l~~n~~~~~~~~~~~~~~l~~L~~L~l~~n~  257 (394)
                      +++++|.+.                     +.+| ..+..+..+ +.++++.|++. +..+. .+..+. ...++++.+.
T Consensus       154 l~l~~n~l~---------------------~~ip-~~~~~l~~l~~~l~~~~n~l~-~~~~~-~~~~l~-~~~l~l~~~~  208 (313)
T d1ogqa_         154 ITFDGNRIS---------------------GAIP-DSYGSFSKLFTSMTISRNRLT-GKIPP-TFANLN-LAFVDLSRNM  208 (313)
T ss_dssp             EECCSSCCE---------------------EECC-GGGGCCCTTCCEEECCSSEEE-EECCG-GGGGCC-CSEEECCSSE
T ss_pred             eeccccccc---------------------cccc-ccccccccccccccccccccc-ccccc-cccccc-cccccccccc
Confidence            555555544                     4444 344444443 56666666655 33333 444443 3356666666


Q ss_pred             CCCChhhhhhcCCCCCCCEEeCcCCCCCccchhhcCCCCCCCEEEcCCCcCChhhhhchhccCCCCeEecCCcccceeec
Q 041570          258 IRDGSELLRSMGSFPSLKTLFLEANNFTATTTQELHNFTNLEFLNLRHSSLDINLLKTIASFTSLKNLSMVSCEVNGVLD  337 (394)
Q Consensus       258 ~~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~n~l~~~~~~~l~~~~~L~~L~l~~n~l~~~ip  337 (394)
                      ..+.  +|..+..+++++.+++++|.+++.+| .+..+++|+.|++++|+++|.+|+.++++++|++|+|++|+++|.+|
T Consensus       209 ~~~~--~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP  285 (313)
T d1ogqa_         209 LEGD--ASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP  285 (313)
T ss_dssp             EEEC--CGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECC
T ss_pred             cccc--cccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCC
Confidence            6665  66666677777777777777766554 46667777777777777777777777777777777777777777777


Q ss_pred             hhhccCCCCCcEEEcCCCCcc
Q 041570          338 GQGFLNFKSLERLDMGGARNA  358 (394)
Q Consensus       338 ~~~~~~~~~L~~L~l~~~~n~  358 (394)
                      .  +.++++|+.+++++  |.
T Consensus       286 ~--~~~L~~L~~l~l~~--N~  302 (313)
T d1ogqa_         286 Q--GGNLQRFDVSAYAN--NK  302 (313)
T ss_dssp             C--STTGGGSCGGGTCS--SS
T ss_pred             C--cccCCCCCHHHhCC--Cc
Confidence            5  45667777777777  65
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure