Citrus Sinensis ID: 041671

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290------
MLLLWLMLLLLSSLAAASSWNVKPGSGCQEKCGHVTVPYPFGINDPMCAMNMNFFLNCSRRDSPPKLMIGDLEVFNLSIENGSMIASIFTSRRCYDGLGHRTSDYNDAYVKLGHRPLRFSDTRNKLTAIGCDTSAYMGDPDGSFWSGCISICTNESAKLNESSCSGIGCCQTPLPKSLKSLELTLRSVHNHEDMGEFMQCDYALLADETFNIAEFRASEDKSSSNVTIEWVVEEKNCPDDPNSKVDGCGDNTNCYYSENGKGYRCKCKQGFQGNPYLGCVDIDECLDKEKYHCEGK
cHHHHHHHHHHHHHHHccccccccccccccccccEEccccccccccccccccccEEEcccccccccccccccEEEEEEEEccEEEEEEEEEEEEEcccccccccccccccccccccEEEEccccEEEEEEcEEEEEccccccccEEEEEEEccccccccccccccccccccccccccccEEEEEEEcccccccccccEEEEEEEEccccccccccccccccccccEEEEEEEEcccccccccccccccccccEEEEccccccEEEccccccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHccccccccccccccccccEcccccccccccccccccEEEEEcccccccccccccEEEEEEEccccEEEEEcccccHcccccccccccccccEEccccccEEEEccccEEEEEEcccEEEEEcccccEEEEEEEEccccccccccccccccccccccccccccEEEEEEEcccccccccccccccEEEEEEccccccccccccccccccEEEEEEEcccccccccccccEEEcccccEEcccccccEEEEccccccccccccccccHHcccccccccccc
MLLLWLMLLLLSSLAaasswnvkpgsgcqekcghvtvpypfgindpmcAMNMNFflncsrrdsppklmigdlEVFNLSIENGSMIASIFTsrrcydglghrtsdyndayvklghrplrfsdtrnkltaigcdtsaymgdpdgsfwsgCISIctnesaklnesscsgigccqtplpkslkSLELTLRSVHNHEDMGEFMQCDYALLADETFNIAEfrasedksssnvTIEWVVEekncpddpnskvdgcgdntncyysengkgyrckckqgfqgnpylgcvdidecldkekyhcegk
MLLLWLMLLLLSSLAAASSWNVKPGSGCQEKCGHVTVPYPFGINDPMCAMNMNFFLNCSRRDSPPKLMIGDLEVFNLSIENGSMIASIFTSRRCYDGLGHRTSDYNDAYVKLGhrplrfsdtrnKLTAIGCDTSAYMGDPDGSFWSGCISICTNESAKLNESSCSGIGCCQTPLPKSLKSLELTLRSVHNHEDMGEFMQCDYALLADETFNIAEfrasedksssnVTIEWVVeekncpddpnskvdgcgdNTNCYYSENGKGYRCKCKQGFQGNPYLGCVDIDECLDKekyhcegk
mlllwlmllllsslaaasswNVKPGSGCQEKCGHVTVPYPFGINDPMCAMNMNFFLNCSRRDSPPKLMIGDLEVFNLSIENGSMIASIFTSRRCYDGLGHRTSDYNDAYVKLGHRPLRFSDTRNKLTAIGCDTSAYMGDPDGSFWSGCISICTNESAKLNESSCSGIGCCQTPLPKSLKSLELTLRSVHNHEDMGEFMQCDYALLADETFNIAEFRASEDKSSSNVTIEWVVEEKNCPDDPNSKVDGCGDNTNCYYSENGKGYRCKCKQGFQGNPYLGCVDIDECLDKEKYHCEGK
*LLLWLMLLLLSSLAAASSWNVKPGSGCQEKCGHVTVPYPFGINDPMCAMNMNFFLNCSRRDSPPKLMIGDLEVFNLSIENGSMIASIFTSRRCYDGLGHRTSDYNDAYVKLGHRPLRFSDTRNKLTAIGCDTSAYMGDPDGSFWSGCISICTNESAKLNESSCSGIGCCQTPLPKSLKSLELTLRSVHNHEDMGEFMQCDYALLADETFNIAEFR*********VTIEWVVEE**********VDGCGDNTNCYYSENGKGYRCKCKQGFQGNPYLGCVDIDECLDKEKY*****
MLLLWLMLLLLSSLA****************CGHVTVPYPFGINDPMCAMNMNFFLNCSRRDSPPKLMIGDLEVFNLSIENGSMIASIFTSRRCYDGLGHRTSDYNDAYVKLGHRPLRFSDTRNKLTAIGCDTSAYMGDPDGSFWSGCISICTNESAKLNESSCSGIGCCQTPLPKSLKSLELTLRSVHNHEDMGEFMQCDYALLADETFNIAEFRASEDKSSSNVTIEWVVEEKNCPDDPNSKVDGCGDNTNCYYSENGKGYRCKCKQGFQGNPYLGCVDIDECLDKE**HC***
MLLLWLMLLLLSSLAAASSWNVKPGSGCQEKCGHVTVPYPFGINDPMCAMNMNFFLNCSRRDSPPKLMIGDLEVFNLSIENGSMIASIFTSRRCYDGLGHRTSDYNDAYVKLGHRPLRFSDTRNKLTAIGCDTSAYMGDPDGSFWSGCISICTNESAKLNESSCSGIGCCQTPLPKSLKSLELTLRSVHNHEDMGEFMQCDYALLADETFNIAEFRA********VTIEWVVEEKNCPDDPNSKVDGCGDNTNCYYSENGKGYRCKCKQGFQGNPYLGCVDIDECLDKEKYHCEGK
MLLLWLMLLLLSSLAAASSWNVKPGSGCQEKCGHVTVPYPFGINDPMCAMNMNFFLNCSRRDSPPKLMIGDLEVFNLSIENGSMIASIFTSRRCYDGLGHRTSDYNDAYVKLGHRPLRFSDTRNKLTAIGCDTSAYMGDPDGSFWSGCISICTNESAKLNESSCSGIGCCQTPLPKSLKSLELTLRSVHNHEDMGEFMQCDYALLADETFNIAEFRASEDKSSSNVTIEWVVEEKNCPDDPNSKVDGCGDNTNCYYSENGKGYRCKCKQGFQGNPYLGCVDIDECLDKEKYHC***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLLWLMLLLLSSLAAASSWNVKPGSGCQEKCGHVTVPYPFGINDPMCAMNMNFFLNCSRRDSPPKLMIGDLEVFNLSIENGSMIASIFTSRRCYDGLGHRTSDYNDAYVKLGHRPLRFSDTRNKLTAIGCDTSAYMGDPDGSFWSGCISICTNESAKLNESSCSGIGCCQTPLPKSLKSLELTLRSVHNHEDMGEFMQCDYALLADETFNIAEFRASEDKSSSNVTIEWVVEEKNCPDDPNSKVDGCGDNTNCYYSENGKGYRCKCKQGFQGNPYLGCVDIDECLDKEKYHCEGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query296 2.2.26 [Sep-21-2011]
Q9LMP1 732 Wall-associated receptor yes no 0.898 0.363 0.356 3e-38
Q39191 735 Wall-associated receptor no no 0.854 0.344 0.320 4e-26
Q9LMN7 733 Wall-associated receptor no no 0.918 0.371 0.309 9e-26
Q9LMN8 741 Wall-associated receptor no no 0.905 0.361 0.299 6e-21
Q9LMN6 738 Wall-associated receptor no no 0.847 0.340 0.332 7e-21
Q9SA25 720 Wall-associated receptor no no 0.915 0.376 0.312 1e-20
Q7X8C5 748 Wall-associated receptor no no 0.949 0.375 0.270 2e-15
Q8RY17 751 Wall-associated receptor no no 0.925 0.364 0.260 3e-13
Q9S9M2 761 Wall-associated receptor no no 0.915 0.356 0.281 3e-13
Q9S9M3 730 Wall-associated receptor no no 0.918 0.372 0.267 8e-13
>sp|Q9LMP1|WAK2_ARATH Wall-associated receptor kinase 2 OS=Arabidopsis thaliana GN=WAK2 PE=1 SV=1 Back     alignment and function desciption
 Score =  159 bits (402), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 104/292 (35%), Positives = 153/292 (52%), Gaps = 26/292 (8%)

Query: 6   LMLLLLSSLAAASSWNVKPGSGCQEKCGHVTVPYPFGINDPMCAM--NMNFFLNCSRRDS 63
           L ++ +  LA       +P   CQ +CG+V V YPFG   P C    + +F L C+ ++ 
Sbjct: 7   LFVVAVFYLAYTQLVKGQPRKECQTRCGNVAVEYPFG-TSPGCYYPGDESFNLTCNEQE- 64

Query: 64  PPKLMIGDLEVFNLSIENGSMIASIFTSRRCYDGLGHRTSDYNDAYVKLGHRPLRFSDTR 123
             KL  G++ V N+S+ +G +   +  SR CYD  G +T DY      LG+  L      
Sbjct: 65  --KLFFGNMPVINMSL-SGQLRVRLVRSRVCYDSQGKQT-DYIAQRTTLGNFTL---SEL 117

Query: 124 NKLTAIGCDTSAYMGDPDGSFWS-GCISICTNESAKLNESSCSGIGCCQTPLPKSLKSLE 182
           N+ T +GC++ A++       +S GCISIC  +SA     SCSG GCCQ P+P+    + 
Sbjct: 118 NRFTVVGCNSYAFLRTSGVEKYSTGCISIC--DSATTKNGSCSGEGCCQIPVPRGYSFVR 175

Query: 183 LTLRSVHNHEDMGEFMQCDYALLADETFNIAEFRASED------KSSSNVTIEWVVEEKN 236
           +   S HNH  +  F  C YA L ++   + +F A ED       ++  V ++W + +K 
Sbjct: 176 VKPHSFHNHPTVHLFNPCTYAFLVED--GMFDFHALEDLNNLRNVTTFPVVLDWSIGDKT 233

Query: 237 CPDDPNSKVDGCGDNTNCYYSENGKGYRCKCKQGFQGNPYL--GCVDIDECL 286
           C       V  CG N+ C+ S  G GY CKC +GF+GNPYL  GC DI+EC+
Sbjct: 234 CKQVEYRGV--CGGNSTCFDSTGGTGYNCKCLEGFEGNPYLPNGCQDINECI 283
Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. Binding to pectin may have significance in the control of cell expansion, morphogenesis and development.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: -
>sp|Q39191|WAK1_ARATH Wall-associated receptor kinase 1 OS=Arabidopsis thaliana GN=WAK1 PE=1 SV=2 Back     alignment and function description
>sp|Q9LMN7|WAK5_ARATH Wall-associated receptor kinase 5 OS=Arabidopsis thaliana GN=WAK5 PE=2 SV=1 Back     alignment and function description
>sp|Q9LMN8|WAK3_ARATH Wall-associated receptor kinase 3 OS=Arabidopsis thaliana GN=WAK3 PE=2 SV=2 Back     alignment and function description
>sp|Q9LMN6|WAK4_ARATH Wall-associated receptor kinase 4 OS=Arabidopsis thaliana GN=WAK4 PE=2 SV=1 Back     alignment and function description
>sp|Q9SA25|WAKLG_ARATH Wall-associated receptor kinase-like 8 OS=Arabidopsis thaliana GN=WAKL8 PE=2 SV=1 Back     alignment and function description
>sp|Q7X8C5|WAKLB_ARATH Wall-associated receptor kinase-like 2 OS=Arabidopsis thaliana GN=WAKL2 PE=2 SV=1 Back     alignment and function description
>sp|Q8RY17|WAKLI_ARATH Wall-associated receptor kinase-like 22 OS=Arabidopsis thaliana GN=WAKL22 PE=2 SV=1 Back     alignment and function description
>sp|Q9S9M2|WAKLD_ARATH Wall-associated receptor kinase-like 4 OS=Arabidopsis thaliana GN=WAKL4 PE=2 SV=2 Back     alignment and function description
>sp|Q9S9M3|WAKLC_ARATH Wall-associated receptor kinase-like 3 OS=Arabidopsis thaliana GN=WAKL3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query296
255573259 771 serine-threonine protein kinase, plant-t 0.979 0.376 0.47 1e-65
255573255 739 kinase, putative [Ricinus communis] gi|2 0.881 0.353 0.477 5e-65
224132156 667 predicted protein [Populus trichocarpa] 0.969 0.430 0.441 5e-64
224132160 667 predicted protein [Populus trichocarpa] 0.969 0.430 0.438 2e-63
224102951 749 predicted protein [Populus trichocarpa] 0.986 0.389 0.435 2e-62
224102953 633 predicted protein [Populus trichocarpa] 0.908 0.424 0.458 9e-62
224132194 717 predicted protein [Populus trichocarpa] 0.972 0.401 0.422 5e-59
224132202 721 predicted protein [Populus trichocarpa] 0.949 0.389 0.435 1e-57
224132144 646 predicted protein [Populus trichocarpa] 0.871 0.399 0.448 7e-57
359492355 745 PREDICTED: wall-associated receptor kina 0.966 0.383 0.393 2e-48
>gi|255573259|ref|XP_002527558.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223533050|gb|EEF34810.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  256 bits (653), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 141/300 (47%), Positives = 187/300 (62%), Gaps = 10/300 (3%)

Query: 2   LLLWLMLLLLSSLAAASSW-NVKPGSGCQEKCGHVTVPYPFGINDPMCAMNMNFFLNCSR 60
           LL W  +  ++    + S  NVKP   CQEKCG+V+V YPFGI++P CA N  F L C+ 
Sbjct: 57  LLFWQCIYHMTVAEDSDSLSNVKPD--CQEKCGNVSVFYPFGIDNPDCAFNEFFLLTCNY 114

Query: 61  RDSPPKLMIGDLEVFNLSIENGSMIASIFTSRRCYDGLGHRTSDYNDAYVKLGHRPLRFS 120
             +P +LMIG++ V ++S++ G     I  +  CYD    +   + D  + LG  P RFS
Sbjct: 115 SYTP-ELMIGNIPVLDISVQEGVFSVDIENAYECYDSRSGQIYSF-DQIITLGDGPFRFS 172

Query: 121 DTRNKLTAIGCDTSAYMGDPDGSFWSGCISICTNESAKLNESSCSGIGCCQTPLPKSLKS 180
           D RNKLTA GCD+ A+M D +G F SGC+S+C        ESSC G GCCQT +P+SLK+
Sbjct: 173 DIRNKLTATGCDSLAFMTDAEGDFGSGCVSLCNGPVNFTKESSCGGYGCCQTSIPQSLKT 232

Query: 181 LELTLRSVHNHEDMGEFMQCDYALLADE-TFNIAEFRA--SEDK-SSSNVTIEWVVEEKN 236
           L ++L S ++  ++ +F  C +A LAD+  FN++      SED+  SS   IEWVVEEK 
Sbjct: 233 LNISLTSPNSRMNVWDFNPCGFAFLADQRNFNVSNLNLTYSEDEFISSTSVIEWVVEEKT 292

Query: 237 CPDDPNSKVDGCGDNTNCYYSENGKGYRCKCKQGFQGNPYL-GCVDIDECLDKEKYHCEG 295
           C D   S    C  NT+C YSENG+GYRC CK+GF GNPY+ GC DIDEC D  KY C+G
Sbjct: 293 CGDANKSDSYACRRNTDCIYSENGQGYRCSCKEGFAGNPYIEGCEDIDECNDPLKYPCQG 352

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255573255|ref|XP_002527556.1| kinase, putative [Ricinus communis] gi|223533048|gb|EEF34808.1| kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224132156|ref|XP_002328199.1| predicted protein [Populus trichocarpa] gi|222837714|gb|EEE76079.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224132160|ref|XP_002328200.1| predicted protein [Populus trichocarpa] gi|222837715|gb|EEE76080.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102951|ref|XP_002312867.1| predicted protein [Populus trichocarpa] gi|222849275|gb|EEE86822.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102953|ref|XP_002312868.1| predicted protein [Populus trichocarpa] gi|222849276|gb|EEE86823.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224132194|ref|XP_002328208.1| predicted protein [Populus trichocarpa] gi|222837723|gb|EEE76088.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224132202|ref|XP_002328210.1| predicted protein [Populus trichocarpa] gi|222837725|gb|EEE76090.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224132144|ref|XP_002328196.1| predicted protein [Populus trichocarpa] gi|222837711|gb|EEE76076.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359492355|ref|XP_002284688.2| PREDICTED: wall-associated receptor kinase 2-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query296
TAIR|locus:2014912 732 WAK2 "wall-associated kinase 2 0.861 0.348 0.372 2e-42
TAIR|locus:2014902 735 WAK1 "cell wall-associated kin 0.851 0.342 0.322 5.3e-33
TAIR|locus:2014962 733 WAK5 "wall associated kinase 5 0.837 0.338 0.327 1.7e-31
TAIR|locus:2014897 741 WAK3 "wall associated kinase 3 0.858 0.342 0.317 1.1e-28
TAIR|locus:2014952 738 WAK4 "wall associated kinase 4 0.851 0.341 0.326 1.1e-27
TAIR|locus:2032875 720 AT1G16260 [Arabidopsis thalian 0.854 0.351 0.319 7.1e-23
TAIR|locus:2200562 748 WAKL2 "wall associated kinase- 0.875 0.346 0.268 7.8e-20
TAIR|locus:2030988 764 AT1G17910 [Arabidopsis thalian 0.466 0.180 0.283 3e-17
TAIR|locus:2019843 769 WAKL10 "WALL ASSOCIATED KINASE 0.439 0.169 0.292 1.1e-14
TAIR|locus:2126316 786 AT4G31100 [Arabidopsis thalian 0.418 0.157 0.263 2.3e-14
TAIR|locus:2014912 WAK2 "wall-associated kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 454 (164.9 bits), Expect = 2.0e-42, P = 2.0e-42
 Identities = 105/282 (37%), Positives = 156/282 (55%)

Query:    23 KPGSGCQEKCGHVTVPYPFGINDPMCAM--NMNFFLNCSRRDSPPKLMIGDLEVFNLSIE 80
             +P   CQ +CG+V V YPFG + P C    + +F L C+ ++   KL  G++ V N+S+ 
Sbjct:    24 QPRKECQTRCGNVAVEYPFGTS-PGCYYPGDESFNLTCNEQE---KLFFGNMPVINMSL- 78

Query:    81 NGSMIASIFTSRRCYDGLGHRTSDYNDAYVKLGHRPLRFSDTRNKLTAIGCDTSAYMGDP 140
             +G +   +  SR CYD  G +T DY      LG+  L  S+  N+ T +GC++ A++   
Sbjct:    79 SGQLRVRLVRSRVCYDSQGKQT-DYIAQRTTLGNFTL--SEL-NRFTVVGCNSYAFLRTS 134

Query:   141 DGSFWS-GCISICTNESAKLNESSCSGIGCCQTPLPKSLKSLELTLRSVHNHEDMGEFMQ 199
                 +S GCISIC  +SA     SCSG GCCQ P+P+    + +   S HNH  +  F  
Sbjct:   135 GVEKYSTGCISIC--DSATTKNGSCSGEGCCQIPVPRGYSFVRVKPHSFHNHPTVHLFNP 192

Query:   200 CDYALLADETFNIAEFRASEDKSS-SNVT-----IEWVVEEKNCPDDPNSKVDGCGDNTN 253
             C YA L ++   + +F A ED ++  NVT     ++W + +K C       V  CG N+ 
Sbjct:   193 CTYAFLVED--GMFDFHALEDLNNLRNVTTFPVVLDWSIGDKTCKQVEYRGV--CGGNST 248

Query:   254 CYYSENGKGYRCKCKQGFQGNPYL--GCVDIDECLDKEKYHC 293
             C+ S  G GY CKC +GF+GNPYL  GC DI+EC+   +++C
Sbjct:   249 CFDSTGGTGYNCKCLEGFEGNPYLPNGCQDINECISS-RHNC 289
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009751 "response to salicylic acid stimulus" evidence=IDA
GO:0009311 "oligosaccharide metabolic process" evidence=IMP
GO:0009826 "unidimensional cell growth" evidence=IMP
GO:0009992 "cellular water homeostasis" evidence=IMP;IDA
GO:0009793 "embryo development ending in seed dormancy" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0016226 "iron-sulfur cluster assembly" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0048481 "ovule development" evidence=RCA
TAIR|locus:2014902 WAK1 "cell wall-associated kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014962 WAK5 "wall associated kinase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014897 WAK3 "wall associated kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014952 WAK4 "wall associated kinase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032875 AT1G16260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200562 WAKL2 "wall associated kinase-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030988 AT1G17910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019843 WAKL10 "WALL ASSOCIATED KINASE (WAK)-LIKE 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126316 AT4G31100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query296
pfam13947106 pfam13947, GUB_WAK_bind, Wall-associated receptor 2e-27
>gnl|CDD|222467 pfam13947, GUB_WAK_bind, Wall-associated receptor kinase galacturonan-binding Back     alignment and domain information 
 Score =  102 bits (256), Expect = 2e-27
 Identities = 42/109 (38%), Positives = 65/109 (59%), Gaps = 7/109 (6%)

Query: 27  GCQEKCGHVTVPYPFGINDPMCAMNMNFFLNCSRRDSPPKLMIGD--LEVFNLSIENGSM 84
           GC ++CG+V++PYPFGI  P CA +  F L C+   SPP+L++G+   EV ++S+ NG++
Sbjct: 3   GCPDRCGNVSIPYPFGI-GPGCARDPGFELTCNNTTSPPRLLLGNGNYEVLSISLANGTV 61

Query: 85  IASIFTSRRCYDGLGHRTSDYNDAYVKLGHRPLRFSDTRNKLTAIGCDT 133
                 S  CY+  G RT + + +       P  FS +RNK   +GC+T
Sbjct: 62  RVLDPISSNCYNSSGKRTDNGSLSL----GGPFFFSSSRNKFVVVGCNT 106

This cysteine-rich GUB_WAK_bind domain is the extracellular part of this serine/threonine kinase that binds to the cell-wall pectins. Length = 106

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 296
PF13947106 GUB_WAK_bind: Wall-associated receptor kinase gala 99.96
PF08488103 WAK: Wall-associated kinase; InterPro: IPR013695 T 99.71
PF1266224 cEGF: Complement Clr-like EGF-like 97.78
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 96.97
PF0000832 EGF: EGF-like domain This is a sub-family of the P 96.13
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 95.19
cd0005336 EGF Epidermal growth factor domain, found in epide 94.85
smart0018135 EGF Epidermal growth factor-like domain. 94.03
smart0017939 EGF_CA Calcium-binding EGF-like domain. 92.28
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 91.93
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 86.46
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 81.03
>PF13947 GUB_WAK_bind: Wall-associated receptor kinase galacturonan-binding Back     alignment and domain information 
Probab=99.96  E-value=5.6e-29  Score=197.99  Aligned_cols=104  Identities=41%  Similarity=0.864  Sum_probs=90.5

Q ss_pred             CCCCCCCCCCeeecCCCCCCCCCCCCCCCCeeeccCCCCCCcccc--ccEEEEEEeecCCeeEEEEeeccccccCCCCcc
Q 041671           25 GSGCQEKCGHVTVPYPFGINDPMCAMNMNFFLNCSRRDSPPKLMI--GDLEVFNLSIENGSMIASIFTSRRCYDGLGHRT  102 (296)
Q Consensus        25 ~~~C~~~CG~v~IpYPFGig~~~C~~~~~F~ltC~~~~~~p~l~l--~~~~V~~Is~~~~~v~v~~~~~~~C~~~~~~~~  102 (296)
                      +++||++||||+|||||||+ ++|+++++|+|+|++++++|+|++  ++|||++|++++++|+|.+++.+.|+....   
T Consensus         1 ~~~C~~~CGnv~IpYPFgi~-~~C~~~~~F~L~C~~~~~~~~l~l~~~~~~V~~I~~~~~~i~v~~~~~~~~~~~~~---   76 (106)
T PF13947_consen    1 KPGCPSSCGNVSIPYPFGIG-PGCGRDPGFELTCNNNTSPPKLLLSSGNYEVLSISYENGTIRVSDPISSNCYSSSS---   76 (106)
T ss_pred             CCCCCCccCCEeecCCCccC-CCCCCCCCcEEECCCCCCCceeEecCCcEEEEEEecCCCEEEEEeccccceecCCC---
Confidence            57899999999999999999 999999999999999877889887  789999999999999999999888887653   


Q ss_pred             ccccCcceecCCcCeeeecCCCeEEEEcccc
Q 041671          103 SDYNDAYVKLGHRPLRFSDTRNKLTAIGCDT  133 (296)
Q Consensus       103 ~~~~~~~~~l~~~pf~~S~~~N~~~~~GC~~  133 (296)
                      .......+++.+ ||.+|+.+|+|+++||++
T Consensus        77 ~~~~~~~~~~~~-~~~~s~~~N~~~~~GC~t  106 (106)
T PF13947_consen   77 SNSSNSNLSLNG-PFFFSSSSNKFTVVGCNT  106 (106)
T ss_pred             CcccccEEeecC-CceEccCCcEEEEECCCC
Confidence            222234566666 899999999999999985

>PF08488 WAK: Wall-associated kinase; InterPro: IPR013695 This domain is found together with the eukaryotic protein kinase domain IPR000719 from INTERPRO in plant wall-associated kinases (WAKs) and related proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query296
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 1e-04
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 2e-04
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 3e-04
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 4e-04
2bou_A143 EGF-like module containing mucin-like hormone rece 7e-04
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
 Score = 40.0 bits (94), Expect = 1e-04
 Identities = 19/61 (31%), Positives = 21/61 (34%), Gaps = 9/61 (14%)

Query: 236 NCPDDPNSKVDGCGDNTNCYYSENG---------KGYRCKCKQGFQGNPYLGCVDIDECL 286
           + P   N    G      C  +  G          GY C C  GFQ      C DIDEC 
Sbjct: 14  DIPTTENLYFQGAMGTNECLDNNGGCSYVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQ 73

Query: 287 D 287
           D
Sbjct: 74  D 74
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query296
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 97.58
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 97.34
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 97.13
2bou_A143 EGF-like module containing mucin-like hormone rece 97.07
2bou_A143 EGF-like module containing mucin-like hormone rece 96.94
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 96.49
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 96.37
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 96.14
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 96.08
2k2s_B61 Micronemal protein 6; microneme protein complex, c 95.75
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 95.44
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 95.24
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 95.22
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 95.07
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 94.94
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 94.68
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 94.41
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 94.4
2vh0_B134 Activated factor XA light chain; serine protease, 94.16
1uzk_A 162 Fibrillin-1; glycoprotein, extra-cellular matrix, 94.16
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 94.15
1aut_L114 Activated protein C; serine proteinase, plasma cal 94.07
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 93.98
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 93.84
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 93.74
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 93.61
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 93.5
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 93.42
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 93.26
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 93.08
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 92.82
1a3p_A45 Epidermal growth factor; disulfide connectivities, 92.75
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 92.75
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 92.6
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 92.33
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 91.89
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 91.89
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 91.5
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 91.32
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 91.22
1nql_B53 Epidermal growth factor; cell surface receptor, ty 91.14
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 91.06
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 89.38
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 88.32
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 87.94
2wph_E59 Coagulation factor IXA light chain; serine proteas 87.7
3fby_A 551 COMP, cartilage oligomeric matrix protein; signatu 86.8
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 85.46
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 84.47
1aut_L114 Activated protein C; serine proteinase, plasma cal 84.28
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 83.38
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 82.95
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 81.38
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 80.62
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
Probab=97.58  E-value=1.6e-05  Score=59.40  Aligned_cols=37  Identities=32%  Similarity=0.944  Sum_probs=31.6

Q ss_pred             CCCCCCceeecCCCCceeEeeCCCCcCCCcc--CCccCcccc
Q 041671          247 GCGDNTNCYYSENGKGYRCKCKQGFQGNPYL--GCVDIDECL  286 (296)
Q Consensus       247 aC~~nS~C~d~~~g~GY~C~C~~Gy~GNPYl--GC~didEC~  286 (296)
                      .| .|..|++...  +|+|.|.+||+++++.  .|+|||||.
T Consensus        12 ~C-~~g~C~n~~g--~y~C~C~~Gy~~~~~~g~~C~dideC~   50 (86)
T 1lmj_A           12 LC-GRGQCVNTPG--DFECKCDEGYESGFMMMKNCMDIDECQ   50 (86)
T ss_dssp             TT-TTSCEEEETT--EEEECCCSSEEECTTTSSSEEECCHHH
T ss_pred             CC-CCCEEECCCC--CEEeeCCCCcCccCCCCCccCCccccc
Confidence            47 4568988764  8999999999999886  899999995
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query296
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.42
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 96.39
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 95.89
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 95.8
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 95.7
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 95.6
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 95.45
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.34
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 95.29
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 95.09
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 94.98
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 94.95
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 94.84
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 94.83
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 94.72
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 94.47
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 94.25
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 93.99
d1i0ua241 Low density lipoprotein (LDL) receptor, different 93.51
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 93.49
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 93.47
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 92.01
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 91.68
d1nt0a345 Mannose-binding protein associated serine protease 90.93
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 90.1
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 88.03
d1szba245 Mannose-binding protein associated serine protease 87.68
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 86.24
d3bpse140 Low density lipoprotein (LDL) receptor, different 86.11
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 85.16
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 85.09
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 84.78
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-like domain of nidogen-1
domain: EGF-like domain of nidogen-1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=97.42  E-value=2.6e-05  Score=48.64  Aligned_cols=29  Identities=24%  Similarity=0.699  Sum_probs=25.0

Q ss_pred             cCCCCCCceeecCCCCceeEeeCCCCcCCCc
Q 041671          246 DGCGDNTNCYYSENGKGYRCKCKQGFQGNPY  276 (296)
Q Consensus       246 yaC~~nS~C~d~~~g~GY~C~C~~Gy~GNPY  276 (296)
                      ..|..|+.|+|.. | +|+|.|++||.||.+
T Consensus         7 ~~C~~~A~C~Nt~-G-sy~C~C~~Gy~GdG~   35 (40)
T d1gl4a2           7 HQCSVHAECRDYA-T-GFCCRCVANYTGNGR   35 (40)
T ss_dssp             GGSCTTEEEEECS-S-CEEEEECTTEEECSS
T ss_pred             CCCCCCCEeecCC-C-CeEeECCCCCcCCCC
Confidence            4688899999875 3 899999999999975
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure