Citrus Sinensis ID: 041723


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MWHHGTRKKKIATAAYGTASNAMKTLLQSPSLANLAEKLANLKVLHLGQVNTASTVPYASANLSSLFSLLSLIAYCKENFLPSLGNLTKLNDLYLFGNDFSGKVPDSLGDLLQLNYLTGEILVEIRKLTQLHILRLAENQLEGSVPSSIFELRNLRALDLSDNNLSGTGDLNMVLLNLESLTALVLSSNKLSLLAGTTVNTNLPNFTIIGSVHETLASSHIFCTTKIN
cEEcccccccccHHHHHHHHHccccccccccHHHHHHccccccEEEcccccccccccHHHHccccccccccccccccccccHHcccccccccEEcccccccccccHHHHcccccccccccccHHHHccccccccccccccccccccHHHHccccccccccccccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEccccccccccccccEEccc
cccccccccHHccHHHHHHHHHHHcccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccHHHEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccccHHHcccccccEEEcccccccccccHHHHHHccEEEcccccccccccHHHccccccc
mwhhgtrkkkiATAAYGTASNAMKTLLQSPSLANLAEKLANLKVLHLgqvntastvpyaSANLSSLFSLLSLIAYCKEnflpslgnltklndlylfgndfsgkvpdslgdllqlnylTGEILVEIRKLTQLHILRLAEnqlegsvpssiFELRNlraldlsdnnlsgtgdlNMVLLNLESLTALVLSSnklsllagttvntnlpnftIIGSVHETLASSHIFCTTKIN
mwhhgtrkkkiataayGTASNAMKTLLQSPSLANLAEKLANLKVLHLGQVNTASTVPYASANLSSLFSLLSLIAYCKENFLPSLGNLTKLNDLYLFGNDFSGKVPDSLGDLLQLNYLTGEILVEIRKLTQLHILRLAenqlegsvpSSIFELRNLRALDLSDNNLSGTGDLNMVLLNLESLTALVLSSNKLSLLAGTTVNTNLPNFTIIGSVHETLASSHIFCTTKIN
MWHHGTRKKKIATAAYGTASNAMKTLLQSPSlanlaeklanlkvlHLGQVNTASTVPYAsanlsslfsllslIAYCKENFLPSLGNLTKLNDLYLFGNDFSGKVPDSLGDLLQLNYLTGEILVEIRKLTQLHILRLAENQLEGSVPSSIFELRNLRALDLSDNNLSGTGDLNMVLLNLESLTALVLSSNKLSLLAGTTVNTNLPNFTIIGSVHETLASSHIFCTTKIN
**********************************LAEKLANLKVLHLGQVNTASTVPYASANLSSLFSLLSLIAYCKENFLPSLGNLTKLNDLYLFGNDFSGKVPDSLGDLLQLNYLTGEILVEIRKLTQLHILRLAENQLEGSVPSSIFELRNLRALDLSDNNLSGTGDLNMVLLNLESLTALVLSSNKLSLLAGTTVNTNLPNFTIIGSVHETLASSHIFCTT***
MWHHGTRKKKIATAAYGTASNAMKTLLQSPSLANLAEKLANLKVLHLGQVNTASTVPYASANLSSLFSLLSLIAYCKENFLPSLGNLTKLNDLYLFGNDFSGKVPDSLGDLLQLNYLTGEILVEIRKLTQLHILRLAENQLEGSVPSSIFELRNLRALDLSDNNLSGTGDLNMVLLNLESLTALVLSSNKLSLLAGTTVNTNLPNFTIIGSVHETLASSHIFCTTKIN
**********IATAAYGTASNAMKTLLQSPSLANLAEKLANLKVLHLGQVNTASTVPYASANLSSLFSLLSLIAYCKENFLPSLGNLTKLNDLYLFGNDFSGKVPDSLGDLLQLNYLTGEILVEIRKLTQLHILRLAENQLEGSVPSSIFELRNLRALDLSDNNLSGTGDLNMVLLNLESLTALVLSSNKLSLLAGTTVNTNLPNFTIIGSVHETLASSHIFCTTKIN
****GTRKKKIATAAYGTASNAMKTLLQSPSLANLAEKLANLKVLHLGQVNTASTVPYASANLSSLFSLLSLIAYCKENFLPSLGNLTKLNDLYLFGNDFSGKVPDSLGDLLQLNYLTGEILVEIRKLTQLHILRLAENQLEGSVPSSIFELRNLRALDLSDNNLSGTGDLNMVLLNLESLTALVLSSNKLSLLAGTTVNTNLPNFTIIGSVHETLASSHIFCT****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWHHGTRKKKIATAAYGTASNAMKTLLQSPSLANLAEKLANLKVLHLGQVNTASTVPYASANLSSLFSLLSLIAYCKENFLPSLGNLTKLNDLYLFGNDFSGKVPDSLGDLLQLNYLTGEILVEIRKLTQLHILRLAENQLEGSVPSSIFELRNLRALDLSDNNLSGTGDLNMVLLNLESLTALVLSSNKLSLLAGTTVNTNLPNFTIIGSVHETLASSHIFCTTKIN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query228 2.2.26 [Sep-21-2011]
Q9LP24 1120 Probable leucine-rich rep yes no 0.763 0.155 0.367 6e-16
P93194 1109 Receptor-like protein kin N/A no 0.482 0.099 0.45 1e-14
O49318 1124 Probable leucine-rich rep no no 0.662 0.134 0.370 9e-14
Q9C9H7 847 Receptor-like protein 12 no no 0.473 0.127 0.444 2e-13
Q9FRS6 1029 Leucine-rich repeat recep no no 0.820 0.181 0.327 2e-13
O82318 960 Probably inactive leucine no no 0.666 0.158 0.329 4e-13
C0LGQ5 1249 LRR receptor-like serine/ no no 0.75 0.136 0.338 9e-13
Q8L899 1207 Systemin receptor SR160 O N/A no 0.671 0.126 0.364 1e-12
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.671 0.126 0.364 1e-12
Q42371 976 LRR receptor-like serine/ no no 0.473 0.110 0.410 3e-12
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function desciption
 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 108/212 (50%), Gaps = 38/212 (17%)

Query: 29  SPSLANLAEKLANLKVLHLGQVNTASTVPYASANLSSLFSL-LS---------------- 71
           SPSL NL     NL VL+L Q    S +P    N+ S+  L LS                
Sbjct: 143 SPSLGNLK----NLTVLYLHQNYLTSVIPSELGNMESMTDLALSQNKLTGSIPSSLGNLK 198

Query: 72  --LIAYCKENFL-----PSLGNLTKLNDLYLFGNDFSGKVPDSLGDLLQL-------NYL 117
             ++ Y  EN+L     P LGN+  + DL L  N  +G +P +LG+L  L       NYL
Sbjct: 199 NLMVLYLYENYLTGVIPPELGNMESMTDLALSQNKLTGSIPSTLGNLKNLMVLYLYENYL 258

Query: 118 TGEILVEIRKLTQLHILRLAENQLEGSVPSSIFELRNLRALDLSDNNLSGTGDLNMVLLN 177
           TG I  EI  +  +  L L++N+L GS+PSS+  L+NL  L L  N L  TG +   L N
Sbjct: 259 TGVIPPEIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYL--TGGIPPKLGN 316

Query: 178 LESLTALVLSSNKLSLLAGTTVNTNLPNFTII 209
           +ES+  L LS+NKL+    +++  NL N TI+
Sbjct: 317 IESMIDLELSNNKLTGSIPSSLG-NLKNLTIL 347





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=2 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query228
359490156 886 PREDICTED: receptor-like protein 12-like 0.732 0.188 0.347 3e-18
147804670 1004 hypothetical protein VITISV_022039 [Viti 0.732 0.166 0.387 1e-16
359485822 993 PREDICTED: receptor-like protein 12-like 0.552 0.126 0.462 1e-16
359485824 973 PREDICTED: receptor-like protein 12-like 0.741 0.173 0.363 2e-15
224140511 894 predicted protein [Populus trichocarpa] 0.640 0.163 0.372 2e-15
390979602 743 hypothetical protein [Cryptomeria japoni 0.649 0.199 0.415 1e-14
225429912 967 PREDICTED: probably inactive leucine-ric 0.671 0.158 0.369 2e-14
147790309 838 hypothetical protein VITISV_009745 [Viti 0.662 0.180 0.382 2e-14
296085003 566 unnamed protein product [Vitis vinifera] 0.75 0.302 0.379 3e-14
224128143 923 predicted protein [Populus trichocarpa] 0.828 0.204 0.342 3e-14
>gi|359490156|ref|XP_003634044.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 83/239 (34%), Positives = 111/239 (46%), Gaps = 72/239 (30%)

Query: 27  LQSPSLANLAEKLANLKVLHLGQVNTASTVPYASANLSSL------------------FS 68
           LQ P L  L + L +LK LHL QVN +ST+P+  ANLSSL                  F 
Sbjct: 163 LQKPGLRYLVQNLTHLKELHLRQVNISSTIPHELANLSSLRTLFLRECGLHGEFPMNIFQ 222

Query: 69  LLSL----IAYCKE--NFLPSLGNLTKLNDLYLFGNDFSGK------------------- 103
           L SL    + Y  +   +LP     + L  LYL G  FSG+                   
Sbjct: 223 LPSLQFLSVRYNPDLIGYLPEFQETSPLKLLYLSGTSFSGELPTSIGRLGSLTKLDISSC 282

Query: 104 -----VPDSLGDLLQLNYL-------TGEILVEIRKLTQLHILRLAENQLEGSVPSSIFE 151
                VP  LG L QL+YL       +G+I   +  LT+L  L L+ N LEG +P+S+FE
Sbjct: 283 NFTGLVPSPLGHLSQLSYLDLSNNFFSGQIPSSMANLTRLTFLDLSLNNLEGGIPTSLFE 342

Query: 152 LRNLRALDLSDNNLSGTGDLNMVLLNLESLTALVLSSNKLSLLAGTTVNTNLPNFTIIG 210
           L NL+ L ++DN+L+GT +L                 N+LSLL  T  N  LP F ++G
Sbjct: 343 LVNLQYLSVADNSLNGTVEL-----------------NRLSLLGYTRTNVTLPKFKLLG 384




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147804670|emb|CAN66864.1| hypothetical protein VITISV_022039 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485822|ref|XP_003633342.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485824|ref|XP_003633343.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140511|ref|XP_002323626.1| predicted protein [Populus trichocarpa] gi|222868256|gb|EEF05387.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|390979602|dbj|BAM21552.1| hypothetical protein [Cryptomeria japonica] Back     alignment and taxonomy information
>gi|225429912|ref|XP_002281133.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 [Vitis vinifera] gi|296081832|emb|CBI20837.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147790309|emb|CAN61202.1| hypothetical protein VITISV_009745 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085003|emb|CBI28418.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224128143|ref|XP_002329092.1| predicted protein [Populus trichocarpa] gi|222869761|gb|EEF06892.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query228
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.587 0.119 0.395 3.9e-16
UNIPROTKB|P93194 1109 INRPK1 "Receptor-like protein 0.469 0.096 0.461 1.7e-15
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.473 0.127 0.444 1.7e-14
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.482 0.097 0.408 3.2e-14
TAIR|locus:2009288 966 AT1G34420 [Arabidopsis thalian 0.5 0.118 0.428 3.4e-14
UNIPROTKB|O24435 813 O24435 "Receptor kinase-like p 0.526 0.147 0.426 3.4e-14
TAIR|locus:2025545 1029 AT1G08590 [Arabidopsis thalian 0.627 0.138 0.367 3.7e-14
TAIR|locus:2144392 957 RLP53 "receptor like protein 5 0.600 0.143 0.385 5.4e-14
TAIR|locus:2005507 976 ER "ERECTA" [Arabidopsis thali 0.473 0.110 0.410 5.6e-14
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.587 0.142 0.36 1.8e-13
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 214 (80.4 bits), Expect = 3.9e-16, P = 3.9e-16
 Identities = 59/149 (39%), Positives = 84/149 (56%)

Query:    73 IAYCKENFL-----PSLGNLTKLNDLYLFGNDFSGKVPDSLGDLLQL-------NYLTGE 120
             + Y  EN+L     P LGN+  + DL L  N  +G +P +LG+L  L       NYLTG 
Sbjct:   202 VLYLYENYLTGVIPPELGNMESMTDLALSQNKLTGSIPSTLGNLKNLMVLYLYENYLTGV 261

Query:   121 ILVEIRKLTQLHILRLAENQLEGSVPSSIFELRNLRALDLSDNNLSGTGDLNMVLLNLES 180
             I  EI  +  +  L L++N+L GS+PSS+  L+NL  L L  N L  TG +   L N+ES
Sbjct:   262 IPPEIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYL--TGGIPPKLGNIES 319

Query:   181 LTALVLSSNKLSLLAGTTVNTNLPNFTII 209
             +  L LS+NKL+    +++  NL N TI+
Sbjct:   320 MIDLELSNNKLTGSIPSSLG-NLKNLTIL 347


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0009814 "defense response, incompatible interaction" evidence=RCA
UNIPROTKB|P93194 INRPK1 "Receptor-like protein kinase" [Ipomoea nil (taxid:35883)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009288 AT1G34420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2025545 AT1G08590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005507 ER "ERECTA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query228
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-19
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-15
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-04
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 84.9 bits (210), Expect = 5e-19
 Identities = 59/161 (36%), Positives = 89/161 (55%), Gaps = 11/161 (6%)

Query: 40  ANLKVLHLGQVNTASTVPYASANLSSLFSLLSLIAYCKENFLPS-LGNLTKLNDLYLFGN 98
           ++LKVL LG       +P +  NL+SL   L+L +      +P  LG +  L  +YL  N
Sbjct: 164 SSLKVLDLGGNVLVGKIPNSLTNLTSL-EFLTLASNQLVGQIPRELGQMKSLKWIYLGYN 222

Query: 99  DFSGKVPDSLGDLLQLNYL-------TGEILVEIRKLTQLHILRLAENQLEGSVPSSIFE 151
           + SG++P  +G L  LN+L       TG I   +  L  L  L L +N+L G +P SIF 
Sbjct: 223 NLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFS 282

Query: 152 LRNLRALDLSDNNLSGTGDLNMVLLNLESLTALVLSSNKLS 192
           L+ L +LDLSDN+LS  G++  +++ L++L  L L SN  +
Sbjct: 283 LQKLISLDLSDNSLS--GEIPELVIQLQNLEILHLFSNNFT 321


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 228
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.92
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.82
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.8
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.79
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.74
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.72
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.63
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.52
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.51
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.51
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.51
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.51
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.5
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.47
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.46
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.45
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.42
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.37
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.27
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.27
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.2
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.17
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.16
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.12
PLN03150623 hypothetical protein; Provisional 99.1
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.06
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.05
PLN03150623 hypothetical protein; Provisional 98.98
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.96
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.96
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.88
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.87
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.85
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.74
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.53
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.43
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.36
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.36
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.34
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.32
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.22
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.22
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.2
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.11
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.1
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.04
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.03
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.97
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.96
PRK15386 426 type III secretion protein GogB; Provisional 97.95
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.93
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.78
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.7
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.49
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.36
PRK15386 426 type III secretion protein GogB; Provisional 97.24
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.17
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.93
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.92
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.33
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.25
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.77
KOG4308 478 consensus LRR-containing protein [Function unknown 95.41
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.29
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.57
KOG4308 478 consensus LRR-containing protein [Function unknown 93.04
KOG1947482 consensus Leucine rich repeat proteins, some prote 91.68
smart0037026 LRR Leucine-rich repeats, outliers. 91.39
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.39
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.38
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.59
KOG4341483 consensus F-box protein containing LRR [General fu 89.14
KOG1947 482 consensus Leucine rich repeat proteins, some prote 88.85
KOG4341483 consensus F-box protein containing LRR [General fu 88.69
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.43
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 86.47
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.38
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.29
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.92  E-value=5.6e-25  Score=204.57  Aligned_cols=211  Identities=29%  Similarity=0.388  Sum_probs=150.4

Q ss_pred             CcCCcccccchhhhcccccccccccCCCC----hHHHHhccCCCCeeecCCccCCCCcchhccCCcchHHHHHhhhhcCC
Q 041723            3 HHGTRKKKIATAAYGTASNAMKTLLQSPS----LANLAEKLANLKVLHLGQVNTASTVPYASANLSSLFSLLSLIAYCKE   78 (228)
Q Consensus         3 ~~~~~~~~~~~~~~~~l~~l~~l~l~~~~----l~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~~~l~~~~~   78 (228)
                      +++|.+....+..++.+++|++|++++|.    +|+.+.++++|++|++++|.+.+..|..+..+++|++|+  +++|.+
T Consensus       147 Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~--L~~n~l  224 (968)
T PLN00113        147 LSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIY--LGYNNL  224 (968)
T ss_pred             CcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEE--CcCCcc
Confidence            44555555566667777777777777765    466677777777777777777766777777777777777  777777


Q ss_pred             -CCCc-cccCCCCCcEEEeeCCcCCCCCCChhhccccc-------cccccccchhhhcCCCCCEEeccCCcccccCcccc
Q 041723           79 -NFLP-SLGNLTKLNDLYLFGNDFSGKVPDSLGDLLQL-------NYLTGEILVEIRKLTQLHILRLAENQLEGSVPSSI  149 (228)
Q Consensus        79 -~~~p-~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~~-------~~l~~~~~~~~~~l~~L~~L~ls~n~l~~~~~~~~  149 (228)
                       +.+| .++.+++|++|++++|.+++.+|..++.++.+       +.+.+.+|..++.+++|+.|++++|.+.+.+|..+
T Consensus       225 ~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~  304 (968)
T PLN00113        225 SGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELV  304 (968)
T ss_pred             CCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhH
Confidence             4566 67777777777777777776777766666553       23445667777777777777777777776677777


Q ss_pred             ccCCCCCEEEccCCccccCCCcchhhhcCCCCCEEEccCCccccccCccccCCCCCccccccccccccc
Q 041723          150 FELRNLRALDLSDNNLSGTGDLNMVLLNLESLTALVLSSNKLSLLAGTTVNTNLPNFTIIGSVHETLAS  218 (228)
Q Consensus       150 ~~l~~L~~L~l~~n~~~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~l~l~~n~~~~  218 (228)
                      ..+++|+.|++++|.+++  .+|..+..+++|+.|++++|.+++..|.. +..+++|+.+++++|++++
T Consensus       305 ~~l~~L~~L~l~~n~~~~--~~~~~~~~l~~L~~L~L~~n~l~~~~p~~-l~~~~~L~~L~Ls~n~l~~  370 (968)
T PLN00113        305 IQLQNLEILHLFSNNFTG--KIPVALTSLPRLQVLQLWSNKFSGEIPKN-LGKHNNLTVLDLSTNNLTG  370 (968)
T ss_pred             cCCCCCcEEECCCCccCC--cCChhHhcCCCCCEEECcCCCCcCcCChH-HhCCCCCcEEECCCCeeEe
Confidence            777777777777777776  66777777777777777777777776766 6777777777777777764



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query228
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-09
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 4e-09
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-06
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 58.2 bits (139), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 46/118 (38%), Positives = 62/118 (52%), Gaps = 9/118 (7%) Query: 82 PSLGNLTKLNDLYLFGNDFSGKVPDSLGDL-------LQLNYLTGEILVEIRKLTQLHIL 134 P+L N ++L L+L N SG +P SLG L L LN L GEI E+ + L L Sbjct: 409 PTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETL 468 Query: 135 RLAENQLEGSVPSSIFELRNLRALDLSDNNLSGTGDLNMVLLNLESLTALVLSSNKLS 192 L N L G +PS + NL + LS+N L TG++ + LE+L L LS+N S Sbjct: 469 ILDFNDLTGEIPSGLSNCTNLNWISLSNNRL--TGEIPKWIGRLENLAILKLSNNSFS 524
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query228
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-25
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-23
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-22
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-21
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-20
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-19
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-17
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 9e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-09
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-08
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 7e-08
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-09
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-08
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-09
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-09
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-07
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-06
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-08
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-06
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-05
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-05
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score = 99.5 bits (249), Expect = 3e-25
 Identities = 45/170 (26%), Positives = 73/170 (42%), Gaps = 26/170 (15%)

Query: 38  KLANLKVLHLGQVNTASTVPYASANLSSLFSL-LSLIAYCKENFL-----PSLGNLTKLN 91
           KL  L  L++   N +  +P   + + +L +L  S       N L     PS+ +L  L 
Sbjct: 99  KLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFS------YNALSGTLPPSISSLPNLV 152

Query: 92  DLYLFGNDFSGKVPDSLGDLLQL--------NYLTGEILVEIRKLTQLHILRLAENQLEG 143
            +   GN  SG +PDS G   +L        N LTG+I      L  L  + L+ N LEG
Sbjct: 153 GITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEG 211

Query: 144 SVPSSIFELRNLRALDLSDNNLSGT-GDLNMVLLNLESLTALVLSSNKLS 192
                    +N + + L+ N+L+   G +       ++L  L L +N++ 
Sbjct: 212 DASVLFGSDKNTQKIHLAKNSLAFDLGKVG----LSKNLNGLDLRNNRIY 257


>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query228
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.92
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.9
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.9
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.89
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.89
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.89
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.89
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.89
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.89
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.88
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.88
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.88
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.87
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.86
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.86
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.86
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.86
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.86
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.85
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.83
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.83
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.82
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.81
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.8
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.8
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.79
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.76
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.75
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.75
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.75
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.74
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.74
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.72
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.7
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.69
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.68
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.64
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.63
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.61
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.6
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.51
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.5
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.48
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.46
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.43
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.38
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.37
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.35
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.29
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.29
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.17
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.09
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.89
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.68
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.55
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.48
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.4
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.3
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.28
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.16
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.96
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.96
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.87
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.78
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.5
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.39
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.34
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.47
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.45
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.22
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.95  E-value=1.9e-28  Score=221.46  Aligned_cols=210  Identities=21%  Similarity=0.193  Sum_probs=147.8

Q ss_pred             cCCcccccchhhhcccccccccccCCCC----hHHHHhccCCCCeeecCCccCCCCcchhccCCcchHHHHHhhhhcCC-
Q 041723            4 HGTRKKKIATAAYGTASNAMKTLLQSPS----LANLAEKLANLKVLHLGQVNTASTVPYASANLSSLFSLLSLIAYCKE-   78 (228)
Q Consensus         4 ~~~~~~~~~~~~~~~l~~l~~l~l~~~~----l~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~~~l~~~~~-   78 (228)
                      ++|++....+..++.+++|+++++++|.    +|..+..+++|++|++++|.+.+..|..+..+++|++|+  +++|.+ 
T Consensus       450 ~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~--L~~N~l~  527 (768)
T 3rgz_A          450 WLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILK--LSNNSFS  527 (768)
T ss_dssp             CSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEE--CCSSCCE
T ss_pred             CCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEE--CCCCccc
Confidence            3444444444445555555555555554    344555555555555555555555555555555555555  555555 


Q ss_pred             CCCc-cccCCCCCcEEEeeCCcCCCCCCChhhcccc--------------------------------------------
Q 041723           79 NFLP-SLGNLTKLNDLYLFGNDFSGKVPDSLGDLLQ--------------------------------------------  113 (228)
Q Consensus        79 ~~~p-~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~--------------------------------------------  113 (228)
                      +.+| .++.+++|+.|++++|.++|.+|..++....                                            
T Consensus       528 ~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  607 (768)
T 3rgz_A          528 GNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRL  607 (768)
T ss_dssp             EECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGG
T ss_pred             CcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhcc
Confidence            3455 5555555555555555555555554433211                                            


Q ss_pred             ---------ccccccccchhhhcCCCCCEEeccCCcccccCccccccCCCCCEEEccCCccccCCCcchhhhcCCCCCEE
Q 041723          114 ---------LNYLTGEILVEIRKLTQLHILRLAENQLEGSVPSSIFELRNLRALDLSDNNLSGTGDLNMVLLNLESLTAL  184 (228)
Q Consensus       114 ---------~~~l~~~~~~~~~~l~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~p~~~~~l~~L~~L  184 (228)
                               .+.+.+..|..++.+++|+.|++++|.+++.+|..++.++.|+.|++++|.+++  .+|..++.+++|++|
T Consensus       608 ~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g--~ip~~l~~L~~L~~L  685 (768)
T 3rgz_A          608 STRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISG--SIPDEVGDLRGLNIL  685 (768)
T ss_dssp             GGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCS--CCCGGGGGCTTCCEE
T ss_pred             ccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCC--CCChHHhCCCCCCEE
Confidence                     022334455566677889999999999999999999999999999999999998  899999999999999


Q ss_pred             EccCCccccccCccccCCCCCccccccccccccc
Q 041723          185 VLSSNKLSLLAGTTVNTNLPNFTIIGSVHETLAS  218 (228)
Q Consensus       185 ~L~~n~l~~~~~~~~~~~l~~L~~l~l~~n~~~~  218 (228)
                      +|++|++++.+|.. +.+++.|++|++++|++++
T Consensus       686 dLs~N~l~g~ip~~-l~~l~~L~~L~ls~N~l~g  718 (768)
T 3rgz_A          686 DLSSNKLDGRIPQA-MSALTMLTEIDLSNNNLSG  718 (768)
T ss_dssp             ECCSSCCEECCCGG-GGGCCCCSEEECCSSEEEE
T ss_pred             ECCCCcccCcCChH-HhCCCCCCEEECcCCcccc
Confidence            99999999999999 9999999999999999875



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 228
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 9e-04
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 51.3 bits (121), Expect = 2e-08
 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 136 LAENQLEGSVPSSIFELRNLRALDLSDNNLSGTGDLNMVLLNLESLTALVLSSNKL 191
           L  N++ G++P  + +L+ L +L++S NNL G         NL+       ++NK 
Sbjct: 251 LRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP---QGGNLQRFDVSAYANNKC 303


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query228
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.78
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.59
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.57
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.55
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.51
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.46
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.43
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.39
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.34
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.29
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.22
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.2
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.15
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.14
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.07
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.77
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.46
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.24
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.54
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.45
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.71
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.92  E-value=2.8e-26  Score=184.73  Aligned_cols=210  Identities=25%  Similarity=0.311  Sum_probs=167.2

Q ss_pred             CcCCccccc--chhhhcccccccccccCC-CC----hHHHHhccCCCCeeecCCccCCCCcchhccCCcchHHHHHhhhh
Q 041723            3 HHGTRKKKI--ATAAYGTASNAMKTLLQS-PS----LANLAEKLANLKVLHLGQVNTASTVPYASANLSSLFSLLSLIAY   75 (228)
Q Consensus         3 ~~~~~~~~~--~~~~~~~l~~l~~l~l~~-~~----l~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~~~l~~   75 (228)
                      ++++.+...  .+..++.+++|++|++++ |.    +|+.++++++|++|++++|++.+..+..+..+.+|+.++  +++
T Consensus        57 L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~--l~~  134 (313)
T d1ogqa_          57 LSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLD--FSY  134 (313)
T ss_dssp             EECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEE--CCS
T ss_pred             CCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccc--ccc
Confidence            344544442  357888888999998876 43    788888899999999998888887788888888888888  888


Q ss_pred             cCC-CCCc-cccCCCCCcEEEeeCCcCCCCCCChhhcccc--------cc-----------------------ccccccc
Q 041723           76 CKE-NFLP-SLGNLTKLNDLYLFGNDFSGKVPDSLGDLLQ--------LN-----------------------YLTGEIL  122 (228)
Q Consensus        76 ~~~-~~~p-~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~--------~~-----------------------~l~~~~~  122 (228)
                      |.+ ..+| .+..++.++++++++|.+.+.+|+.++.+..        .+                       ...+..|
T Consensus       135 N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~~~~~  214 (313)
T d1ogqa_         135 NALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDAS  214 (313)
T ss_dssp             SEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECCG
T ss_pred             ccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            887 6777 8888899999999999888788877766544        11                       1224556


Q ss_pred             hhhhcCCCCCEEeccCCcccccCccccccCCCCCEEEccCCccccCCCcchhhhcCCCCCEEEccCCccccccCccccCC
Q 041723          123 VEIRKLTQLHILRLAENQLEGSVPSSIFELRNLRALDLSDNNLSGTGDLNMVLLNLESLTALVLSSNKLSLLAGTTVNTN  202 (228)
Q Consensus       123 ~~~~~l~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~  202 (228)
                      ..++.+++++.++++++.+.+.+ ..++.+++|+.|++++|.+++  .+|.++.++++|++|+|++|+++|.+|.  +++
T Consensus       215 ~~~~~~~~l~~l~~~~~~l~~~~-~~~~~~~~L~~L~Ls~N~l~g--~iP~~l~~L~~L~~L~Ls~N~l~g~iP~--~~~  289 (313)
T d1ogqa_         215 VLFGSDKNTQKIHLAKNSLAFDL-GKVGLSKNLNGLDLRNNRIYG--TLPQGLTQLKFLHSLNVSFNNLCGEIPQ--GGN  289 (313)
T ss_dssp             GGCCTTSCCSEEECCSSEECCBG-GGCCCCTTCCEEECCSSCCEE--CCCGGGGGCTTCCEEECCSSEEEEECCC--STT
T ss_pred             ccccccccccccccccccccccc-cccccccccccccCccCeecc--cCChHHhCCCCCCEEECcCCcccccCCC--ccc
Confidence            66677788999999999988654 468888999999999999998  8999999999999999999999988774  678


Q ss_pred             CCCcccccccccc-cccC
Q 041723          203 LPNFTIIGSVHET-LASS  219 (228)
Q Consensus       203 l~~L~~l~l~~n~-~~~~  219 (228)
                      +.+|+.+++++|+ +.+.
T Consensus       290 L~~L~~l~l~~N~~l~g~  307 (313)
T d1ogqa_         290 LQRFDVSAYANNKCLCGS  307 (313)
T ss_dssp             GGGSCGGGTCSSSEEEST
T ss_pred             CCCCCHHHhCCCccccCC
Confidence            8999999998886 4544



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure