Citrus Sinensis ID: 041747
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 211 | ||||||
| 147815260 | 2471 | hypothetical protein VITISV_010987 [Viti | 0.981 | 0.083 | 0.485 | 2e-51 | |
| 225465083 | 920 | PREDICTED: probable disease resistance p | 0.985 | 0.226 | 0.514 | 3e-51 | |
| 359494505 | 796 | PREDICTED: probable disease resistance p | 0.985 | 0.261 | 0.483 | 1e-49 | |
| 359494493 | 855 | PREDICTED: probable disease resistance p | 0.990 | 0.244 | 0.502 | 2e-49 | |
| 297743218 | 927 | unnamed protein product [Vitis vinifera] | 0.981 | 0.223 | 0.495 | 3e-49 | |
| 147858210 | 892 | hypothetical protein VITISV_011750 [Viti | 0.990 | 0.234 | 0.502 | 3e-49 | |
| 225442515 | 904 | PREDICTED: probable disease resistance p | 0.981 | 0.228 | 0.495 | 5e-49 | |
| 451799006 | 1006 | disease resistance protein RPS5-like pro | 0.990 | 0.207 | 0.497 | 6e-49 | |
| 296082677 | 723 | unnamed protein product [Vitis vinifera] | 0.990 | 0.289 | 0.497 | 6e-49 | |
| 359494489 | 877 | PREDICTED: disease resistance protein RP | 0.990 | 0.238 | 0.497 | 6e-49 |
| >gi|147815260|emb|CAN74430.1| hypothetical protein VITISV_010987 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 207 bits (528), Expect = 2e-51, Method: Composition-based stats.
Identities = 102/210 (48%), Positives = 139/210 (66%), Gaps = 3/210 (1%)
Query: 1 MDCVSPVLDILTRLWDCTATNGSYIRHLKKNLNSLSEARRELEDLSEDVSRRVEEEEQQQ 60
MDCV+P++D+ TRLW C + + SY+ L++NL SL EL+++ EDV RRVE+ E++Q
Sbjct: 1627 MDCVTPIMDVATRLWSCASKHSSYVIDLQENLCSLRNEMEELKNVGEDVKRRVEDAEKRQ 1686
Query: 61 RKRKKVVQGWFDAVESQIKEVDVISRKGEQEVQKKCLGSCCIYNCYSGYKIGKKVINKIR 120
KR+ V GW +++ + +EV+ I KG+QE+QKKCL +CC NC YKIGK KI
Sbjct: 1687 MKRRNEVNGWLNSLTALEREVNEILEKGDQEIQKKCLRNCCTRNCRFSYKIGKMAREKIP 1746
Query: 121 DVKELIKKGEIFENLQVTYKLPRPTVDGMVMEETVGFDSMLDEVWGHIADYRCRIIGLYG 180
V EL KG F+ V LP VD ME++VG + M E+W + D + IIGLYG
Sbjct: 1747 AVSELKNKGH-FD--VVADILPSAPVDEKPMEKSVGLNLMFGEIWRWLEDEKVGIIGLYG 1803
Query: 181 IGGVGKTTLLKKLNNKFLDINHHFDLVIWV 210
+GGVGKTTL+KK+NN+FL FD+VIWV
Sbjct: 1804 MGGVGKTTLMKKINNEFLKTKLGFDVVIWV 1833
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225465083|ref|XP_002266249.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359494505|ref|XP_002266368.2| PREDICTED: probable disease resistance protein At5g63020 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359494493|ref|XP_002265648.2| PREDICTED: probable disease resistance protein At5g63020 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297743218|emb|CBI36085.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147858210|emb|CAN79676.1| hypothetical protein VITISV_011750 [Vitis vinifera] gi|451799002|gb|AGF69199.1| disease resistance protein RPS5-like protein 3 [Vitis labrusca] | Back alignment and taxonomy information |
|---|
| >gi|225442515|ref|XP_002278439.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|451799006|gb|AGF69201.1| disease resistance protein RPS5-like protein 5 [Vitis labrusca] | Back alignment and taxonomy information |
|---|
| >gi|296082677|emb|CBI21682.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359494489|ref|XP_002265529.2| PREDICTED: disease resistance protein RPS5-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 211 | ||||||
| TAIR|locus:2008440 | 899 | AT1G61180 [Arabidopsis thalian | 0.919 | 0.215 | 0.321 | 1.8e-19 | |
| TAIR|locus:2153474 | 874 | AT5G05400 [Arabidopsis thalian | 0.933 | 0.225 | 0.268 | 2.1e-19 | |
| TAIR|locus:2166320 | 888 | AT5G63020 [Arabidopsis thalian | 0.971 | 0.230 | 0.284 | 2.8e-19 | |
| TAIR|locus:2036214 | 851 | AT1G15890 [Arabidopsis thalian | 0.900 | 0.223 | 0.302 | 9e-19 | |
| TAIR|locus:2170892 | 848 | AT5G43730 [Arabidopsis thalian | 0.933 | 0.232 | 0.268 | 3.1e-18 | |
| TAIR|locus:2008510 | 967 | AT1G61190 "AT1G61190" [Arabido | 0.909 | 0.198 | 0.320 | 1.6e-17 | |
| TAIR|locus:2201986 | 885 | RFL1 "AT1G12210" [Arabidopsis | 0.905 | 0.215 | 0.308 | 3e-17 | |
| TAIR|locus:2201996 | 889 | RPS5 "AT1G12220" [Arabidopsis | 0.957 | 0.227 | 0.289 | 2.2e-16 | |
| TAIR|locus:2170902 | 862 | AT5G43740 [Arabidopsis thalian | 0.957 | 0.234 | 0.259 | 2.7e-16 | |
| TAIR|locus:2034765 | 884 | AT1G12290 [Arabidopsis thalian | 0.957 | 0.228 | 0.293 | 3.2e-15 |
| TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 244 (91.0 bits), Expect = 1.8e-19, P = 1.8e-19
Identities = 65/202 (32%), Positives = 98/202 (48%)
Query: 11 LTRLWDCTATNGSYIRHLKKNLNSLSEARRELEDLSEDVSXXXXXXXXXXXXXXXXXXGW 70
L R+++C SYIR L+KNL +L +L + +V W
Sbjct: 14 LNRIFNCLIGK-SYIRTLEKNLRALQREMEDLRAIQHEVQNKVARDEARHQRRLEAVQVW 72
Query: 71 FDAVES-QIKEVDVISRKGEQEVQKKCL-GSCCIYNCYSGYKIGKKVINKIRDVKELIKK 128
D V S I+ D++S E+QK CL G C Y C S YK GKKV + +VK+L +
Sbjct: 73 LDRVNSVDIECKDLLSVT-PVELQKLCLCGLCSKYVC-SSYKYGKKVFLLLEEVKKLNSE 130
Query: 129 GEIFENLQVTYKLPRPTVDGMVMEETVGFDSMLDEVWGHIADYRCRIIGLYGIGGVGXXX 188
G F+ +V+ PR V+ + T+G + ML++ W + + I+GL+G+GGVG
Sbjct: 131 GN-FD--EVSQPPPRSEVEERPTQPTIGQEDMLEKAWNRLMEDGVGIMGLHGMGGVGKTT 187
Query: 189 XXXXXXXXXXDINHHFDLVIWV 210
+I FD+VIW+
Sbjct: 188 LFKKIHNKFAEIGGTFDIVIWI 209
|
|
| TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170902 AT5G43740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 211 | |||
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 4e-09 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
Score = 54.6 bits (132), Expect = 4e-09
Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)
Query: 157 FDSMLDEVWGHI--ADYRCRIIGLYGIGGVGKTTLLKKLNNKFLDINHHFDLVIWV 210
+ M++ + + ++G+ G+GGVGKTTL K++ N + HFD V WV
Sbjct: 1 REDMIEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDD-SVGGHFDSVAWV 55
|
Length = 285 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.9 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.18 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 98.32 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 98.12 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 98.09 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 98.08 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 98.05 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 97.97 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 97.91 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 97.88 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 97.87 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 97.86 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 97.83 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 97.8 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 97.8 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 97.75 | |
| PTZ00202 | 550 | tuzin; Provisional | 97.74 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 97.66 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 97.65 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 97.65 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 97.65 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 97.6 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 97.57 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 97.55 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 97.54 | |
| PF12061 | 402 | DUF3542: Protein of unknown function (DUF3542); In | 97.53 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.52 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 97.51 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 97.49 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 97.49 | |
| PRK06696 | 223 | uridine kinase; Validated | 97.48 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 97.46 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 97.43 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 97.43 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 97.41 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 97.39 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 97.39 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 97.34 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 97.33 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 97.33 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 97.32 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 97.32 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.31 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 97.31 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 97.3 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 97.3 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 97.28 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 97.27 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 97.26 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 97.25 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 97.24 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 97.24 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 97.24 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 97.24 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 97.23 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 97.23 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 97.23 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 97.23 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 97.22 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 97.21 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 97.21 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 97.21 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 97.21 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 97.2 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 97.2 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 97.2 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 97.2 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 97.2 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 97.2 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 97.19 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 97.19 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.19 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.19 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 97.18 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 97.18 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 97.17 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 97.17 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 97.16 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 97.16 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 97.16 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 97.15 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 97.15 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 97.15 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 97.15 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 97.15 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 97.14 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 97.14 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 97.14 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 97.14 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 97.14 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.13 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 97.13 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 97.13 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 97.13 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 97.12 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 97.11 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 97.11 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 97.11 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 97.1 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 97.1 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 97.09 | |
| PRK08727 | 233 | hypothetical protein; Validated | 97.09 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 97.09 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 97.09 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 97.09 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 97.09 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 97.08 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 97.08 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 97.08 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 97.07 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 97.07 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 97.07 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 97.06 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 97.06 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 97.06 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 97.05 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 97.05 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.05 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 97.04 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 97.04 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 97.03 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 97.03 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 97.03 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 97.03 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 97.03 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 97.02 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 97.02 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 97.02 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 97.02 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 97.02 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 97.01 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.01 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 97.01 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 97.01 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 97.01 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 97.01 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 97.0 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 97.0 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 97.0 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 97.0 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 97.0 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 97.0 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 97.0 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 97.0 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 97.0 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 97.0 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 96.99 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 96.99 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 96.99 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 96.99 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 96.99 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 96.99 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 96.99 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 96.99 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 96.98 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.98 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 96.98 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 96.98 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 96.97 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 96.97 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 96.97 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 96.97 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 96.97 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 96.96 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 96.96 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 96.96 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.96 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 96.96 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 96.96 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 96.95 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 96.95 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 96.95 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 96.95 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 96.95 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 96.95 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 96.95 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 96.95 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 96.95 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 96.94 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.94 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 96.94 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 96.93 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 96.93 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.93 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 96.93 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 96.93 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 96.93 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.93 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.93 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 96.93 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 96.92 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 96.91 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 96.91 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 96.91 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 96.91 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 96.91 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.91 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 96.91 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.9 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 96.9 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.9 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 96.9 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 96.9 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 96.9 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 96.9 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 96.9 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.9 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 96.9 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 96.89 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.89 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 96.89 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 96.89 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 96.88 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 96.88 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 96.88 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 96.88 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 96.88 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.87 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 96.87 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 96.87 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 96.87 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 96.87 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 96.87 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 96.87 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 96.86 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 96.86 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 96.86 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 96.86 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 96.86 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 96.86 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 96.86 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 96.86 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 96.85 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 96.85 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.85 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 96.85 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 96.85 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 96.84 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 96.84 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 96.84 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 96.84 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 96.84 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 96.83 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 96.83 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 96.83 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 96.82 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 96.82 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 96.82 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 96.82 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.82 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 96.82 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 96.82 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 96.82 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.81 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 96.81 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 96.81 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 96.81 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.81 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 96.8 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 96.8 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 96.8 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 96.8 | |
| PLN02348 | 395 | phosphoribulokinase | 96.8 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 96.8 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 96.8 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 96.8 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 96.8 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 96.8 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 96.8 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 96.8 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.79 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 96.79 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 96.79 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 96.78 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 96.78 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 96.78 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 96.78 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 96.78 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.78 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.77 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 96.77 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 96.77 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 96.77 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 96.76 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 96.76 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 96.75 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 96.75 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 96.74 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 96.74 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 96.74 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 96.74 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 96.73 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.73 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 96.73 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 96.73 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 96.73 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 96.73 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.72 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 96.72 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 96.71 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 96.71 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 96.71 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.7 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 96.7 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 96.7 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 96.7 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.7 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 96.69 | |
| PRK09087 | 226 | hypothetical protein; Validated | 96.69 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 96.69 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 96.68 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 96.68 | |
| PLN02200 | 234 | adenylate kinase family protein | 96.68 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 96.67 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 96.67 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 96.67 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 96.67 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 96.66 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 96.66 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 96.66 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 96.66 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 96.66 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 96.66 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 96.66 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 96.66 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 96.65 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 96.65 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 96.65 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 96.64 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 96.64 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 96.64 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 96.63 | |
| PRK06620 | 214 | hypothetical protein; Validated | 96.63 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 96.63 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 96.63 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 96.63 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 96.63 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 96.63 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.63 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 96.62 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 96.62 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 96.61 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 96.61 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 96.61 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 96.6 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 96.6 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 96.6 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 96.6 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 96.6 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 96.6 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 96.6 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 96.6 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 96.58 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 96.58 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 96.58 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 96.57 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 96.57 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 96.57 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 96.57 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.56 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 96.56 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 96.56 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 96.55 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 96.55 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 96.55 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 96.55 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 96.55 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 96.54 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 96.54 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 96.54 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 96.54 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 96.54 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 96.53 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 96.53 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 96.53 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 96.53 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 96.53 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 96.53 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 96.52 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.52 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 96.52 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 96.51 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 96.51 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 96.51 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 96.51 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 96.5 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 96.49 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 96.49 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 96.49 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 96.49 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 96.49 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 96.49 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 96.49 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 96.48 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 96.48 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 96.48 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 96.48 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.48 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.47 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 96.47 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 96.47 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 96.47 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 96.46 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 96.46 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 96.46 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 96.45 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 96.45 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 96.45 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 96.45 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.44 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 96.44 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 96.44 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 96.44 | |
| TIGR03238 | 504 | dnd_assoc_3 dnd system-associated protein 3. cereu | 96.43 | |
| PF08298 | 358 | AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi | 96.43 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 96.43 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 96.42 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 96.42 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 96.42 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 96.4 | |
| PF05659 | 147 | RPW8: Arabidopsis broad-spectrum mildew resistance | 96.4 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 96.39 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 96.39 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 96.38 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 96.38 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 96.38 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 96.38 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 96.38 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 96.37 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 96.36 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 96.36 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 96.35 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 96.35 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.35 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 96.33 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 96.32 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 96.32 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 96.32 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 96.32 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 96.31 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.3 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 96.29 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 96.29 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 96.28 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 96.28 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 96.27 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 96.26 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 96.25 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 96.25 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 96.25 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 96.24 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 96.22 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 96.22 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 96.2 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 96.18 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 96.18 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 96.17 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 96.15 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 96.14 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 96.13 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 96.13 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 96.13 | |
| PRK08116 | 268 | hypothetical protein; Validated | 96.12 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 96.11 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 96.11 | |
| TIGR00991 | 313 | 3a0901s02IAP34 GTP-binding protein (Chloroplast En | 96.11 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 96.11 | |
| KOG0781 | 587 | consensus Signal recognition particle receptor, al | 96.1 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 96.1 | |
| COG4240 | 300 | Predicted kinase [General function prediction only | 96.09 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 96.09 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 96.08 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 96.06 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 96.05 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 96.05 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 96.05 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 96.04 | |
| PRK06526 | 254 | transposase; Provisional | 96.04 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 96.03 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 96.03 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 96.02 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 96.02 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 96.0 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 95.99 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 95.99 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 95.98 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 95.97 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 95.97 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 95.96 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 95.96 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 95.96 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 95.95 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 95.95 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 95.94 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 95.93 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 95.93 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 95.93 | |
| cd01853 | 249 | Toc34_like Toc34-like (Translocon at the Outer-env | 95.92 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 95.92 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 95.92 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=99.90 E-value=8.1e-23 Score=184.25 Aligned_cols=190 Identities=31% Similarity=0.503 Sum_probs=144.7
Q ss_pred hHhHHHHHhhhccchhhchhHhHHHHHHHHHHHHhHHHHHHHHHHHHHHhchhchhhHHHHHHHHHHHHHHHHHHhHhhH
Q 041747 10 ILTRLWDCTATNGSYIRHLKKNLNSLSEARRELEDLSEDVSRRVEEEEQQQRKRKKVVQGWFDAVESQIKEVDVISRKGE 89 (211)
Q Consensus 10 ~~~~l~~~~~~~~~~~~~~~~~v~~L~~~l~~l~~~l~~~~~~~~~ae~~~~~~~~~~~~Wl~~v~~~~~~~ed~ld~~~ 89 (211)
.++++++++.++...+.+.++++..|++++..|+.++.|+++. +.. ......|.+.++++.|++||+++.+.
T Consensus 8 ~~~~~~~~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~-------~~~-~~~~~~~~e~~~~~~~~~e~~~~~~~ 79 (889)
T KOG4658|consen 8 GVEKLDQLLNRESECLDGKDNYILELKENLKALQSALEDLDAK-------RDD-LERRVNWEEDVGDLVYLAEDIIWLFL 79 (889)
T ss_pred ehhhHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhh-------cch-HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 4567888899999999999999999999999999999995433 333 47788999999999999999999986
Q ss_pred HHHhc----------------hhcCCcccCCccchhhhHHHHHHHHHHHHHHHHcccccccccccc-cCCCCcccCCccc
Q 041747 90 QEVQK----------------KCLGSCCIYNCYSGYKIGKKVINKIRDVKELIKKGEIFENLQVTY-KLPRPTVDGMVME 152 (211)
Q Consensus 90 ~~~~~----------------~~~~~~~~~~~~~~~~~~~~i~~~~~~i~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~ 152 (211)
.+... -|....|..+...-+.+++++..+.+.++.+..+.. |. .+.. ..|+......+..
T Consensus 80 v~~~~~~~~~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~-~~--~~~~~~~~~~~~e~~~~~ 156 (889)
T KOG4658|consen 80 VEEIERKANDLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGV-FE--VVGESLDPREKVETRPIQ 156 (889)
T ss_pred HHHHHHHHhHHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccc-ee--cccccccchhhcccCCCC
Confidence 54321 233345555555666777878777777777665543 33 2221 1122222222211
Q ss_pred c-c-cchHHHHHHHHHhhccCCCeEEEEEcCCCCcHHHHHHHHHhhhhh-cCCCccEEEEeC
Q 041747 153 E-T-VGFDSMLDEVWGHIADYRCRIIGLYGIGGVGKTTLLKKLNNKFLD-INHHFDLVIWVA 211 (211)
Q Consensus 153 ~-~-~g~~~~~~~l~~~L~~~~~~vi~I~G~~GiGKTTLa~~i~~~~~~-v~~~F~~~~wv~ 211 (211)
. . ||.+..++++++.|.+++..++||+||||+||||||+.|||+. . ++.+||.+|||+
T Consensus 157 ~~~~VG~e~~~~kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~-~~v~~~Fd~~iWV~ 217 (889)
T KOG4658|consen 157 SESDVGLETMLEKLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKF-DEVGNHFDGVIWVV 217 (889)
T ss_pred ccccccHHHHHHHHHHHhccCCCCEEEEECCCcccHHHHHHHHhccc-chhcccCceEEEEE
Confidence 1 2 9999999999999999888999999999999999999999998 6 999999999995
|
|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >TIGR03238 dnd_assoc_3 dnd system-associated protein 3 | Back alignment and domain information |
|---|
| >PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG4240 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 211 | |||
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 3e-11 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 8e-07 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-06 |
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
Score = 60.8 bits (147), Expect = 3e-11
Identities = 24/180 (13%), Positives = 54/180 (30%), Gaps = 29/180 (16%)
Query: 40 RELEDLSEDVSRRVEEEEQQQRKRKKVVQGWFDAVESQIKEVDVISRKGEQEVQKKCLGS 99
+ED E + R + + + Q E+ + Q
Sbjct: 31 EGKNIFTEDH----SELISKMSTRLERIANFLRIYRRQASELGPLIDFFNYNNQSHL--- 83
Query: 100 CCIYNCYSGYKIGKKVINKIRDVKELIKKGEI--------FENLQVTYKLPRPTVDGMVM 151
+ I+ + +L++ I + + +P+ +
Sbjct: 84 ---------ADFLEDYIDFAINEPDLLRPVVIAPQFSRQMLDRKLLLGNVPKQMTCYIRE 134
Query: 152 EETVGFDSMLDEVWGHIADYRCRIIGLYGIGGVGKTTLLKK-LNNKFLDINHHFDLVIWV 210
LDE+ D + L+G G GK+ + + L+ I ++D ++W+
Sbjct: 135 YHVDRVIKKLDEM----CDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWL 190
|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| 3qfl_A | 115 | MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- | 99.64 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 99.45 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 99.13 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 99.09 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.06 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 98.26 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 98.19 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 98.17 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 98.16 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 98.12 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 98.11 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 98.06 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 98.06 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 97.95 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 97.95 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 97.93 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 97.84 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 97.83 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.81 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 97.72 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 97.71 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 97.69 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 97.66 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 97.66 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.64 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 97.63 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.62 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 97.6 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 97.6 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 97.58 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 97.57 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.56 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 97.56 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 97.54 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 97.52 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 97.52 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 97.51 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 97.51 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 97.51 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 97.49 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 97.48 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 97.48 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 97.46 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 97.45 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 97.44 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 97.44 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 97.43 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 97.43 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 97.42 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 97.41 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 97.41 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 97.41 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.4 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 97.38 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 97.38 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 97.38 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 97.37 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 97.37 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 97.36 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 97.36 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 97.34 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 97.34 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 97.34 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 97.34 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 97.34 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 97.34 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 97.33 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 97.33 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 97.32 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 97.32 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 97.32 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 97.32 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 97.31 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 97.31 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 97.31 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 97.29 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 97.29 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 97.29 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 97.28 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 97.28 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 97.28 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 97.28 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 97.28 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 97.27 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 97.27 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 97.27 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 97.27 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 97.26 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 97.26 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 97.26 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.25 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 97.24 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 97.22 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 97.22 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 97.21 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 97.2 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 97.2 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 97.19 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 97.18 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 97.18 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 97.18 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 97.17 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 97.16 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 97.16 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.16 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 97.15 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 97.14 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 97.12 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 97.11 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 97.11 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 97.1 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 97.1 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 97.1 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 97.07 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 97.05 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 97.05 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 97.03 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 97.03 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 97.03 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 97.01 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 97.0 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 96.99 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 96.99 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.99 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 96.99 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.98 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 96.98 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 96.98 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 96.98 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 96.98 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 96.97 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 96.96 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 96.95 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 96.95 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 96.95 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 96.95 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 96.94 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 96.94 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 96.93 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 96.93 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 96.92 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 96.92 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 96.91 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 96.91 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 96.91 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 96.9 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 96.88 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 96.88 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 96.87 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 96.86 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 96.84 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 96.84 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 96.83 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.83 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.82 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 96.82 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 96.82 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 96.8 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 96.79 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 96.79 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 96.79 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 96.78 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 96.77 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 96.77 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 96.77 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 96.77 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 96.76 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 96.76 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 96.74 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 96.73 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 96.71 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 96.71 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 96.69 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 96.69 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 96.68 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 96.68 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 96.68 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 96.67 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 96.67 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 96.67 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 96.67 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 96.65 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 96.65 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 96.65 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 96.64 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 96.63 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 96.62 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 96.61 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 96.6 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 96.58 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 96.56 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 96.56 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 96.55 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 96.53 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 96.53 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 96.49 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 96.49 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 96.49 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 96.49 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 96.46 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 96.44 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 96.42 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 96.41 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 96.41 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 96.4 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 96.38 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 96.37 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 96.37 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 96.36 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 96.36 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 96.36 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 96.33 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 96.32 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 96.31 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 96.3 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 96.3 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 96.29 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 96.28 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 96.26 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 96.24 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 96.24 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 96.23 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 96.21 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 96.21 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 96.21 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 96.2 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 96.2 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 96.17 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 96.17 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 96.17 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 96.14 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 96.14 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 96.13 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 96.12 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 96.12 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 96.12 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 96.11 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 96.1 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 96.08 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 96.06 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 96.05 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 96.05 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 96.04 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 96.04 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 96.03 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 96.02 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 96.02 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 96.01 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 96.01 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 95.99 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 95.99 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 95.98 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 95.98 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 95.98 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 95.97 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 95.91 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 95.9 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 95.9 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 95.87 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 95.86 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 95.86 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 95.85 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 95.85 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 95.85 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 95.84 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 95.8 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 95.79 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 95.78 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 95.78 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 95.77 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 95.77 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 95.75 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 95.72 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 95.71 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 95.69 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 95.67 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 95.67 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 95.67 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 95.65 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.63 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 95.61 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 95.6 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 95.59 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 95.59 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 95.57 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 95.57 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 95.56 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 94.53 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 95.53 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 95.53 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 95.52 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 95.51 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 95.49 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 95.46 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 95.44 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 95.39 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 95.39 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 95.37 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 95.36 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 95.31 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 95.3 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 95.29 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 95.24 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 95.22 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 95.21 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 95.2 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 95.2 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 95.19 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 95.18 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 95.17 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 95.12 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 95.08 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 95.04 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 95.01 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 94.91 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 94.88 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 94.88 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 94.86 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 94.79 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 94.79 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 94.77 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 94.76 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 94.75 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 94.69 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 94.66 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 94.52 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 94.51 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 94.5 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 94.47 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 94.45 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 94.43 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 94.34 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 94.34 | |
| 3q5d_A | 447 | Atlastin-1; G protein, GTPase, GDP/GTP binding, hy | 94.33 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 94.32 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 94.31 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 94.31 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 94.26 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 94.26 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 94.21 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 94.06 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 94.03 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 94.0 | |
| 3ez2_A | 398 | Plasmid partition protein A; type IA, DNA binding, | 93.99 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 93.95 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 93.92 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 93.89 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 93.89 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 93.85 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 93.83 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 93.81 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 93.79 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 93.76 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 93.75 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 93.74 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 93.74 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 93.62 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 93.57 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 93.55 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 93.47 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 93.47 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 93.33 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 93.26 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 93.19 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 93.0 | |
| 1of1_A | 376 | Thymidine kinase; transferase, antiviral drug, enz | 92.99 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 92.95 | |
| 3ez9_A | 403 | Para; DNA binding, winged-HTH, partition, biosynth | 92.88 | |
| 4ido_A | 457 | Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE | 92.85 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 92.83 | |
| 3vr4_A | 600 | V-type sodium ATPase catalytic subunit A; V-ATPase | 92.81 | |
| 3vr4_D | 465 | V-type sodium ATPase subunit D; V-ATPase, rotary m | 92.81 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 92.78 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 92.67 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 92.38 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 92.25 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 92.15 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 92.14 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 92.01 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 91.98 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 91.95 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 91.86 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 91.79 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 91.77 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 90.84 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 90.12 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 90.1 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 90.01 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 89.88 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 89.88 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 89.82 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 89.57 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 89.52 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 89.44 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 89.4 | |
| 1knx_A | 312 | Probable HPR(Ser) kinase/phosphatase; HPR kinase, | 89.35 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 89.3 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 89.21 | |
| 3czq_A | 304 | Putative polyphosphate kinase 2; structural genomi | 88.87 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 88.84 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 88.5 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 88.41 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 88.41 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 88.4 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 88.38 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 88.27 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 88.22 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 88.1 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 88.09 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 87.95 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 87.0 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 86.88 | |
| 1ii2_A | 524 | Phosphoenolpyruvate carboxykinase; phosphate bindi | 86.69 | |
| 2olr_A | 540 | Phosphoenolpyruvate carboxykinase; carbon dioxide, | 86.29 | |
| 1j3b_A | 529 | ATP-dependent phosphoenolpyruvate carboxykinase; a | 86.12 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 85.83 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 85.47 | |
| 1ytm_A | 532 | Phosphoenolpyruvate carboxykinase [ATP], phosphoen | 85.29 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 84.5 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 84.14 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 83.87 | |
| 3c5h_A | 255 | Glucocorticoid receptor DNA-binding factor 1; RAS, | 82.53 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 82.38 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 81.44 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 80.74 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 80.63 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 80.61 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 80.09 |
| >3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} | Back alignment and structure |
|---|
Probab=99.64 E-value=8.1e-16 Score=106.22 Aligned_cols=80 Identities=13% Similarity=0.136 Sum_probs=70.8
Q ss_pred hHhhHhHHHHHhhhccchhhchhHhHHHHHHHHHHHHhHHHHHHHHHHHHHHhc-hhchhhHHHHHHHHHHHHHHHHHHh
Q 041747 7 VLDILTRLWDCTATNGSYIRHLKKNLNSLSEARRELEDLSEDVSRRVEEEEQQQ-RKRKKVVQGWFDAVESQIKEVDVIS 85 (211)
Q Consensus 7 v~~~~~~l~~~~~~~~~~~~~~~~~v~~L~~~l~~l~~~l~~~~~~~~~ae~~~-~~~~~~~~~Wl~~v~~~~~~~ed~l 85 (211)
+.++++||.+++.+++..+.+++++++.|+++|+.|+++|.| ++... ...++.++.|+++||+++||+||+|
T Consensus 3 v~~ll~KL~~ll~~E~~l~~gv~~~i~~Lk~eL~~m~a~L~d-------a~~~~~~~~d~~vk~W~~~vrdlaYD~ED~i 75 (115)
T 3qfl_A 3 ISNLIPKLGELLTEEFKLHKGVKKNIEDLGKELESMNAALIK-------IGEVPREQLDSQDKLWADEVRELSYVIEDVV 75 (115)
T ss_dssp TCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HTTSCGGGCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHH-------HHHhccccCCHHHHHHHHHHHHHHHHHHHHH
Confidence 445899999999999999999999999999999999999998 55442 2236899999999999999999999
Q ss_pred HhhHHHHh
Q 041747 86 RKGEQEVQ 93 (211)
Q Consensus 86 d~~~~~~~ 93 (211)
|+|.++..
T Consensus 76 D~f~~~~~ 83 (115)
T 3qfl_A 76 DKFLVQVD 83 (115)
T ss_dssp HHHHHHHH
T ss_pred HHHHHHhc
Confidence 99998764
|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
| >3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A | Back alignment and structure |
|---|
| >4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* | Back alignment and structure |
|---|
| >3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >1ii2_A Phosphoenolpyruvate carboxykinase; phosphate binding loop, lyase; 2.00A {Trypanosoma cruzi} SCOP: c.91.1.1 c.109.1.1 | Back alignment and structure |
|---|
| >2olr_A Phosphoenolpyruvate carboxykinase; carbon dioxide, lyase; HET: ATP; 1.60A {Escherichia coli K12} SCOP: c.91.1.1 c.109.1.1 PDB: 1k3c_A* 1k3d_A* 1aq2_A* 2olq_A* 1os1_A* 2pxz_X* 1ayl_A* 2py7_X* 1oen_A 1ylh_A* 1ygg_A* | Back alignment and structure |
|---|
| >1j3b_A ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, T thermophilus; 2.00A {Thermus thermophilus} SCOP: c.91.1.1 c.109.1.1 PDB: 1xkv_A* 2pc9_A* | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ytm_A Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyruvate; domain closure, nucleotide binding; HET: ATP; 2.20A {Anaerobiospirillum succiniciproducens} PDB: 1yvy_A | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 211 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 8e-07 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 46.0 bits (108), Expect = 8e-07
Identities = 12/60 (20%), Positives = 26/60 (43%), Gaps = 4/60 (6%)
Query: 155 VGFDSMLDEVWGH---IADYRCRIIGLYGIGGVGKTTLLKK-LNNKFLDINHHFDLVIWV 210
+ +D V + D + L+G G GK+ + + L+ I ++D ++W+
Sbjct: 23 YIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWL 82
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 99.57 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 98.29 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 98.26 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 98.17 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 98.12 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 98.09 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 98.06 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 98.05 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.05 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 97.95 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 97.94 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 97.94 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.89 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 97.87 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.81 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.69 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 97.65 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 97.52 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 97.52 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 97.38 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 97.35 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 97.35 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 97.34 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 97.34 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 97.33 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 97.32 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 97.32 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 97.28 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 97.26 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 97.26 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 97.26 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 97.25 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 97.24 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.23 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 97.23 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 97.22 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 97.21 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 97.19 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 97.16 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 97.16 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 97.1 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 97.08 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 97.06 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 97.06 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 97.04 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 97.03 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 96.9 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 96.86 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.85 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.76 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 96.73 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.66 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 96.58 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 96.53 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.35 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.34 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 96.34 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 96.3 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 96.25 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 96.21 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 95.91 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 95.8 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 95.65 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 95.55 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 95.46 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 95.24 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 95.12 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 95.06 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 95.05 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 94.98 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 94.93 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 94.91 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 94.86 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 94.74 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 94.64 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 94.52 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 94.52 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 94.44 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 94.18 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 94.16 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 94.12 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 93.87 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 93.74 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 93.72 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 93.41 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 93.23 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 93.22 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 93.1 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 93.07 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 92.93 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 92.22 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 91.93 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 91.17 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 90.8 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 89.5 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 88.97 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 87.22 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 87.01 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 86.88 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 85.28 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 85.01 | |
| d1o5za2 | 296 | Folylpolyglutamate synthetase {Thermotoga maritima | 84.29 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 83.49 | |
| d2gc6a2 | 296 | Folylpolyglutamate synthetase {Lactobacillus casei | 82.95 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 82.27 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 81.44 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 80.32 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.57 E-value=1.2e-15 Score=119.46 Aligned_cols=60 Identities=18% Similarity=0.252 Sum_probs=51.7
Q ss_pred ccccchHHHHHHHHHhhcc---CCCeEEEEEcCCCCcHHHHHHHHHhhhh-hcCCCccEEEEeC
Q 041747 152 EETVGFDSMLDEVWGHIAD---YRCRIIGLYGIGGVGKTTLLKKLNNKFL-DINHHFDLVIWVA 211 (211)
Q Consensus 152 ~~~~g~~~~~~~l~~~L~~---~~~~vi~I~G~~GiGKTTLa~~i~~~~~-~v~~~F~~~~wv~ 211 (211)
+.++||+.++++|+.+|.+ +...+|+|+||||+||||||+.+|++.. .+..+|++++||+
T Consensus 20 ~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~ 83 (277)
T d2a5yb3 20 MTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLK 83 (277)
T ss_dssp CCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEE
T ss_pred CceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEE
Confidence 4478999999999999963 5688999999999999999999999751 2677899999984
|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|