Citrus Sinensis ID: 041762

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------
MLLGKTTAVSAKSEKVAPEVKRRVVVTGLGAVTPLGDDAHLFYTKLLEGVSGISQIEGFDCSELPTRIAGEIKTLSTDGLVPPKHAKRADNYLIYALIAGKKALADAGITEQVSGELNKNRCGVLIGTAMGSMRALKDGIDAIKISYKKMTCATGNCCILTAANHIIEGDADMMLCGGSDGVIIPECIAGFIACNNLSRRNSDPTKASRPWDSDHDGFVMGEGAGVMLLEELDHAKRRRANIYAEFKGGSSTYAYHISEPRLNALGAMACMEKALTNSGVSGEIYRT
cccccccccccccccccccccccEEEccccccccccccHHHHHHHHHcccccccccccccccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEccccccHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEHHHHHHHHcccEEEEEEccccccccccccccccccHHHHHHHHHHHHHcccccccccc
cEEEEccccccccccccccccccEEEEEEEEEEccEEcHHHHHHHHHcccccEEEccccccccccccEEEccccccHHHHccccHHHHccHHHHHHHHHHHHHHHHccccHHHHcccccccEEEEEccccccHHHHHHccEEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEEEEEccccHHHHHHHHHcccEccccccHHHHccccEcccccEcEEcEEEEEEEEEHHHHHHHcccccEEEEEEEEEcccEccccccccHHHHHHHHHHHHHccccHHHccc
mllgkttavsaksekvapevKRRVVVTGlgavtplgddaHLFYTKLLEgvsgisqiegfdcselptriageiktlstdglvppkhakradNYLIYALIAGKKAladagiteqvsgelnknrcGVLIGTAMGSMRALKDGIDAIKISYKKmtcatgncciLTAANhiiegdadmmlcggsdgviipECIAGfiacnnlsrrnsdptkasrpwdsdhdgfvmgeGAGVMLLEELDHAKRRRANIYAefkggsstyayhiseprlNALGAMACMEKAltnsgvsgeiyrt
mllgkttavsaksekvapevkrrvVVTGlgavtplgddAHLFYTKLLEGVSGISQIEGFDCSELPTRIAGEIktlstdglvppkhAKRADNYLIYALIAGKKALADAGITeqvsgelnknrCGVLIGTAMGSMRALKDGIDAIKISYKKMTCATGNCCILTAANHIIEGDADMMLCGGSDGVIIPECIAGFIACNNLSRRNSDPTkasrpwdsdhdgFVMGEGAGVMLLEELDHAKRRRANIYAefkggsstyaYHISEPRLNALGAMACMEKaltnsgvsgeiyrt
MLLGKTTAVSAKSEKVAPEVKRRVVVTGLGAVTPLGDDAHLFYTKLLEGVSGISQIEGFDCSELPTRIAGEIKTLSTDGLVPPKHAKRADNYLIYALIAGKKALADAGITEQVSGELNKNRCGVLIGTAMGSMRALKDGIDAIKISYKKMTCATGNCCILTAANHIIEGDADMMLCGGSDGVIIPECIAGFIACNNLSRRNSDPTKASRPWDSDHDGFVMGEGAGVMLLEELDHAKRRRANIYAEFKGGSSTYAYHISEPRLNALGAMACMEKALTNSGVSGEIYRT
*******************VKRRVVVTGLGAVTPLGDDAHLFYTKLLEGVSGISQIEGFDCSELPTRIAGEIKTLSTDGLVPPKHAKRADNYLIYALIAGKKALADAGITEQVSGELNKNRCGVLIGTAMGSMRALKDGIDAIKISYKKMTCATGNCCILTAANHIIEGDADMMLCGGSDGVIIPECIAGFIACNNL*******************GFVMGEGAGVMLLEELDHAKRRRANIYAEFKGGSSTYAYHISEPRLNALGAMACMEKAL************
***********************VVVTGLGAVTPLGDDAHLFYTKLLEGVSGISQIEGFDCSELPTRIAGEIKTLSTDGLVPPKHAKRADNYLIYALIAGKKALADAGITEQVSGELNKNRCGVLIGTAMGSMRALKDGIDAIKISYKKMTCATGNCCILTAANHIIEGDADMMLCGGSDGVIIPECIAGFIACNNLSRRNSDPTKASRPWDSDHDGFVMGEGAGVMLLEELDHAKRRRANIYAEFKGGSSTYAYHISEPRLNALGAMACMEKALTNSGVSGE****
*****************PEVKRRVVVTGLGAVTPLGDDAHLFYTKLLEGVSGISQIEGFDCSELPTRIAGEIKTLSTDGLVPPKHAKRADNYLIYALIAGKKALADAGITEQVSGELNKNRCGVLIGTAMGSMRALKDGIDAIKISYKKMTCATGNCCILTAANHIIEGDADMMLCGGSDGVIIPECIAGFIACNNLSRR**********WDSDHDGFVMGEGAGVMLLEELDHAKRRRANIYAEFKGGSSTYAYHISEPRLNALGAMACMEKALTNSGVSGEIYRT
*LL***TA**********EVKRRVVVTGLGAVTPLGDDAHLFYTKLLEGVSGISQIEGFDCSELPTRIAGEIKTLSTDGLVPPKHAKRADNYLIYALIAGKKALADAGITEQVSGELNKNRCGVLIGTAMGSMRALKDGIDAIKISYKKMTCATGNCCILTAANHIIEGDADMMLCGGSDGVIIPECIAGFIACNNLSRRNSDPTKASRPWDSDHDGFVMGEGAGVMLLEELDHAKRRRANIYAEFKGGSSTYAYHISEPRLNALGAMACMEKALTNSGVSG*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLGKTTAVSAKSEKVAPEVKRRVVVTGLGAVTPLGDDAHLFYTKLLEGVSGISQIEGFDCSELPTRIAGEIKTLSTDGLVPPKHAKRADNYLIYALIAGKKALADAGITEQVSGELNKNRCGVLIGTAMGSMRALKDGIDAIKISYKKMTCATGNCCILTAANHIIEGDADMMLCGGSDGVIIPECIAGFIACNNLSRRNSDPTKASRPWDSDHDGFVMGEGAGVMLLEELDHAKRRRANIYAEFKGGSSTYAYHISEPRLNALGAMACMEKALTNSGVSGEIYRT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query287 2.2.26 [Sep-21-2011]
Q9C9P4 541 3-oxoacyl-[acyl-carrier-p yes no 0.951 0.504 0.562 5e-95
P52410 473 3-oxoacyl-[acyl-carrier-p no no 0.958 0.581 0.408 3e-63
P23902 462 3-oxoacyl-[acyl-carrier-p N/A no 0.916 0.569 0.397 2e-59
Q9KQH9 414 3-oxoacyl-[acyl-carrier-p yes no 0.905 0.628 0.390 1e-47
P73283 416 3-oxoacyl-[acyl-carrier-p N/A no 0.909 0.627 0.382 6e-46
Q83E37 414 3-oxoacyl-[acyl-carrier-p yes no 0.905 0.628 0.367 9e-46
P55338 415 3-oxoacyl-[acyl-carrier-p yes no 0.895 0.619 0.385 5e-45
O34340 413 3-oxoacyl-[acyl-carrier-p yes no 0.895 0.622 0.361 3e-43
P56902 421 3-oxoacyl-[acyl-carrier-p yes no 0.898 0.612 0.364 2e-38
P0AAI8 413 3-oxoacyl-[acyl-carrier-p yes no 0.832 0.578 0.371 2e-38
>sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 Back     alignment and function desciption
 Score =  347 bits (890), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 213/306 (69%), Gaps = 33/306 (10%)

Query: 11  AKSEKVAPEVKRRVVVTGLGAVTPLGDDAHLFYTKLLEGVSGISQIEGFDCSELPTRIAG 70
           A   K  P  +RRVVVTG+G  T LG D H FY  LL+G SGISQIE FDCSE PTRIAG
Sbjct: 119 AAVNKKPPTEQRRVVVTGMGVETSLGHDPHTFYENLLQGNSGISQIENFDCSEFPTRIAG 178

Query: 71  EIKTLSTDGLVPPKHAKRADNYLIYALIAGKKALADAGITEQVSGELNKNRCGVLIGTAM 130
           EIK+ ST+G V PK +KR D +++Y L AGKKALAD G+T++V  E +K +CGVLIG+AM
Sbjct: 179 EIKSFSTEGWVAPKLSKRMDKFMLYLLTAGKKALADGGVTDEVMAEFDKTKCGVLIGSAM 238

Query: 131 GSMRALKDGIDAIKISYKKMT--------------------------------CATGNCC 158
           G M+   D I+A++ISYKKM                                 CAT N C
Sbjct: 239 GGMKVFYDAIEALRISYKKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNFC 298

Query: 159 ILTAANHIIEGDADMMLCGGSDGVIIPECIAGFIACNNLSRRNSDPTKASRPWDSDHDGF 218
           IL +ANHII+G+AD+MLCGGSD VIIP  + GF+AC  LS+RN+DPTKASRPWD++ DGF
Sbjct: 299 ILNSANHIIKGEADVMLCGGSDAVIIPIGLGGFVACRALSQRNNDPTKASRPWDTNRDGF 358

Query: 219 VMGEGAGVMLLEELDHAKRRRANIYAEFKGGSSTY-AYHISEPRLNALGAMACMEKALTN 277
           VMGEGAGV+LLEEL+HAK+R A IYAEF GGS T  AYH++EP  +  G + C+E+AL +
Sbjct: 359 VMGEGAGVLLLEELEHAKKRGATIYAEFLGGSFTCDAYHMTEPHPDGAGVILCIERALAS 418

Query: 278 SGVSGE 283
           +G+S E
Sbjct: 419 AGISKE 424
Essential protein that catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Specific for elongation from C-16 and C-16 to unsaturated C-18 fatty acids. Confers resistance to low temperatures by maintaining chloroplast membranes integrity. Involved in the regulation of fatty acids ratios during seed metabolism. Required for embryo development, especially at the transition from the globular to the heart stage.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 4EC: 1
>sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=1 SV=2 Back     alignment and function description
>sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 Back     alignment and function description
>sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=3 SV=3 Back     alignment and function description
>sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 Back     alignment and function description
>sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 Back     alignment and function description
>sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 Back     alignment and function description
>sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=3 SV=1 Back     alignment and function description
>sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 Back     alignment and function description
>sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query287
224068526 493 predicted protein [Populus trichocarpa] 0.982 0.572 0.573 5e-96
408384466 554 beta-ketoacyl-ACP synthase II [Camelina 0.951 0.492 0.575 7e-95
408384468 556 beta-ketoacyl-ACP synthase II [Camelina 0.951 0.491 0.575 8e-95
408384464 553 beta-ketoacyl-ACP synthase II [Camelina 0.951 0.493 0.575 8e-95
2921211 530 beta-ketoacyl-ACP synthase II [Perilla f 0.986 0.533 0.566 1e-94
224141567 497 predicted protein [Populus trichocarpa] 0.916 0.529 0.581 2e-94
346995771 573 beta-ketoacyl-ACP synthase II [Jatropha 0.982 0.492 0.557 3e-94
294666 535 chloroplast beta-ketoacyl-ACP synthase p 0.975 0.523 0.567 5e-94
255550355 554 46 kDa ketoavyl-ACP synthase [Ricinus co 0.975 0.505 0.567 6e-94
19698877 541 putative 3-ketoacyl-ACP synthase [Arabid 0.951 0.504 0.562 3e-93
>gi|224068526|ref|XP_002326139.1| predicted protein [Populus trichocarpa] gi|222833332|gb|EEE71809.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  357 bits (915), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 184/321 (57%), Positives = 222/321 (69%), Gaps = 39/321 (12%)

Query: 2   LLGKTTAVSAKSEKVA-----PEVK-RRVVVTGLGAVTPLGDDAHLFYTKLLEGVSGISQ 55
           +LG+  AV+ +  K       P  K +RVVVTGLG V+PLG +  +FY  LLEGVSG+SQ
Sbjct: 56  ILGQAMAVAVQPTKEVETKKKPHTKQKRVVVTGLGVVSPLGHEPDVFYNNLLEGVSGVSQ 115

Query: 56  IEGFDCSELPTRIAGEIKTLSTDGLVPPKHAKRADNYLIYALIAGKKALADAGITEQVSG 115
           IE FDC++  TRIAGEIK++STDG V PK AKR D +++Y LIAGKKALAD GITE V  
Sbjct: 116 IEAFDCAQFSTRIAGEIKSISTDGWVSPKLAKRMDKFMLYMLIAGKKALADGGITEDVMD 175

Query: 116 ELNKNRCGVLIGTAMGSMRALKDGIDAIKISYKKMT------------------------ 151
           ELNK +CGVLIG+AMG M+   D I+A++ISYKK+                         
Sbjct: 176 ELNKAKCGVLIGSAMGGMKVFNDAIEALRISYKKVNPFCVPFATTNMGSAMLAMDLGWMG 235

Query: 152 --------CATGNCCILTAANHIIEGDADMMLCGGSDGVIIPECIAGFIACNNLSRRNSD 203
                   CATGN CIL AANHII G+AD+MLCGGSD  IIP  + GF+AC  LS+RN D
Sbjct: 236 PNYSISTACATGNFCILNAANHIIRGEADVMLCGGSDSAIIPIGLGGFVACRALSQRNDD 295

Query: 204 PTKASRPWDSDHDGFVMGEGAGVMLLEELDHAKRRRANIYAEFKGGSSTY-AYHISEPRL 262
           PTKASRPWD + DGFVMGEGAGV+LLEEL+HAK+R ANIYAEF GGS T  AYH++EPR 
Sbjct: 296 PTKASRPWDMNRDGFVMGEGAGVLLLEELEHAKKRGANIYAEFLGGSFTCDAYHMTEPRP 355

Query: 263 NALGAMACMEKALTNSGVSGE 283
           +  G + C+EKAL  SGV+ E
Sbjct: 356 DGAGVILCIEKALAQSGVAKE 376

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|408384466|gb|AFU61918.1| beta-ketoacyl-ACP synthase II [Camelina sativa] Back     alignment and taxonomy information
>gi|408384468|gb|AFU61919.1| beta-ketoacyl-ACP synthase II [Camelina sativa] Back     alignment and taxonomy information
>gi|408384464|gb|AFU61917.1| beta-ketoacyl-ACP synthase II [Camelina sativa] Back     alignment and taxonomy information
>gi|2921211|gb|AAC04692.1| beta-ketoacyl-ACP synthase II [Perilla frutescens] Back     alignment and taxonomy information
>gi|224141567|ref|XP_002324139.1| predicted protein [Populus trichocarpa] gi|222865573|gb|EEF02704.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|346995771|gb|ABJ90469.2| beta-ketoacyl-ACP synthase II [Jatropha curcas] Back     alignment and taxonomy information
>gi|294666|gb|AAA33872.1| chloroplast beta-ketoacyl-ACP synthase precursor [Ricinus communis] gi|148645269|gb|ABR01158.1| plastid 3-keto-acyl-ACP synthase II [Ricinus communis] Back     alignment and taxonomy information
>gi|255550355|ref|XP_002516228.1| 46 kDa ketoavyl-ACP synthase [Ricinus communis] gi|223544714|gb|EEF46230.1| 46 kDa ketoavyl-ACP synthase [Ricinus communis] Back     alignment and taxonomy information
>gi|19698877|gb|AAL91174.1| putative 3-ketoacyl-ACP synthase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query287
TIGR_CMR|GSU_1605 410 GSU_1605 "3-oxoacyl-(acyl-carr 0.550 0.385 0.434 2.6e-49
TIGR_CMR|SO_2774 412 SO_2774 "3-oxoacyl-(acyl-carri 0.442 0.308 0.5 3.7e-48
TIGR_CMR|CBU_0497 414 CBU_0497 "3-oxoacyl-acyl carri 0.554 0.384 0.444 2e-47
TAIR|locus:2027252 541 FAB1 "fatty acid biosynthesis 0.742 0.393 0.495 1.1e-46
UNIPROTKB|P0AAI5 413 fabF "FabF" [Escherichia coli 0.449 0.312 0.476 1.4e-46
UNIPROTKB|Q71XG4 413 fabF "3-oxoacyl-[acyl-carrier- 0.526 0.365 0.420 2e-45
TIGR_CMR|CPS_2299 412 CPS_2299 "3-oxoacyl-[acyl-carr 0.449 0.313 0.476 5.3e-45
TIGR_CMR|CHY_1445 412 CHY_1445 "3-oxoacyl-(acyl-carr 0.459 0.320 0.436 2.3e-44
TIGR_CMR|ECH_0882 422 ECH_0882 "3-oxoacyl-(acyl-carr 0.459 0.312 0.455 4e-43
TIGR_CMR|SPO_2271 421 SPO_2271 "3-oxoacyl-(acyl carr 0.543 0.370 0.45 1.8e-42
TIGR_CMR|GSU_1605 GSU_1605 "3-oxoacyl-(acyl-carrier-protein) synthase II" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
 Score = 309 (113.8 bits), Expect = 2.6e-49, Sum P(2) = 2.6e-49
 Identities = 70/161 (43%), Positives = 95/161 (59%)

Query:   124 VLIGTAMGSMRALKDGIDAIKISYKKMTCATGNCCILTAANHIIEGDADMMLCGGSDGVI 183
             ++I  A G + ++K G     +S     CATG   I  A + I  GDAD M+ GG++  +
Sbjct:   136 LIINLAPGHI-SIKYGAKGPNLS-SVSACATGTHSIGDAYHMIKRGDADAMIAGGTESTV 193

Query:   184 IPECIAGFIACNNLSRRNSDPTKASRPWDSDHDGFVMGEGAGVMLLEELDHAKRRRANIY 243
              P  I GF     LS RN DPT ASRP++ + DGFV+ EGAG+++LEE + AK+R A IY
Sbjct:   194 TPLGIGGFAVMKALSTRNDDPTAASRPFEKNRDGFVLAEGAGIVVLEEYEAAKKRGAKIY 253

Query:   244 AEFKG-GSSTYAYHISEPRLNALGAMACMEKALTNSGVSGE 283
             AE  G G +  AYH++ P     GA  CM+ AL N+GV  E
Sbjct:   254 AEIVGYGLTGDAYHLTAPAPEGEGAARCMKMALNNAGVRPE 294
GO:0004315 "3-oxoacyl-[acyl-carrier-protein
GO:0006633 "fatty acid biosynthetic process" evidence=ISS
TIGR_CMR|SO_2774 SO_2774 "3-oxoacyl-(acyl-carrier-protein) synthase II" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0497 CBU_0497 "3-oxoacyl-acyl carrier protein synthase II" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TAIR|locus:2027252 FAB1 "fatty acid biosynthesis 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P0AAI5 fabF "FabF" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q71XG4 fabF "3-oxoacyl-[acyl-carrier-protein] synthase 2" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2299 CPS_2299 "3-oxoacyl-[acyl-carrier-protein] synthase II" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1445 CHY_1445 "3-oxoacyl-(acyl-carrier-protein) synthase II" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0882 ECH_0882 "3-oxoacyl-(acyl-carrier-protein) synthase II" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2271 SPO_2271 "3-oxoacyl-(acyl carrier protein) synthase II" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query287
PLN02787 540 PLN02787, PLN02787, 3-oxoacyl-[acyl-carrier-protei 1e-132
cd00834 406 cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier prot 2e-98
TIGR03150 407 TIGR03150, fabF, beta-ketoacyl-acyl-carrier-protei 2e-93
PRK07314 411 PRK07314, PRK07314, 3-oxoacyl-(acyl carrier protei 2e-88
PRK06333 424 PRK06333, PRK06333, 3-oxoacyl-(acyl carrier protei 6e-83
COG0304 412 COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) sy 4e-77
PTZ00050 421 PTZ00050, PTZ00050, 3-oxoacyl-acyl carrier protein 1e-58
PRK08722 414 PRK08722, PRK08722, 3-oxoacyl-(acyl carrier protei 3e-56
PRK08439 406 PRK08439, PRK08439, 3-oxoacyl-(acyl carrier protei 2e-53
PLN02836 437 PLN02836, PLN02836, 3-oxoacyl-[acyl-carrier-protei 1e-52
pfam00109243 pfam00109, ketoacyl-synt, Beta-ketoacyl synthase, 1e-43
PRK07910 418 PRK07910, PRK07910, 3-oxoacyl-(acyl carrier protei 2e-40
PRK09116 405 PRK09116, PRK09116, 3-oxoacyl-(acyl carrier protei 1e-39
PRK07967 406 PRK07967, PRK07967, 3-oxoacyl-(acyl carrier protei 3e-35
cd00828 407 cd00828, elong_cond_enzymes, "elongating" condensi 3e-30
PRK14691 342 PRK14691, PRK14691, 3-oxoacyl-(acyl carrier protei 1e-24
PRK05952 381 PRK05952, PRK05952, 3-oxoacyl-(acyl carrier protei 2e-21
PRK06501 425 PRK06501, PRK06501, 3-oxoacyl-(acyl carrier protei 9e-21
cd00825 332 cd00825, decarbox_cond_enzymes, decarboxylating co 1e-16
cd00833 421 cd00833, PKS, polyketide synthases (PKSs) polymeri 4e-16
cd00832 399 cd00832, CLF, Chain-length factor (CLF) is a facto 7e-13
PRK07103 410 PRK07103, PRK07103, polyketide beta-ketoacyl:acyl 1e-12
cd00832 399 cd00832, CLF, Chain-length factor (CLF) is a facto 4e-12
smart00825298 smart00825, PKS_KS, Beta-ketoacyl synthase 2e-11
COG3321 1061 COG3321, COG3321, Polyketide synthase modules and 1e-09
PRK06501 425 PRK06501, PRK06501, 3-oxoacyl-(acyl carrier protei 2e-09
PRK09185 392 PRK09185, PRK09185, 3-oxoacyl-(acyl carrier protei 5e-09
cd00327254 cd00327, cond_enzymes, Condensing enzymes; Family 2e-06
TIGR02813 2582 TIGR02813, omega_3_PfaA, polyketide-type polyunsat 1e-05
PRK07103 410 PRK07103, PRK07103, polyketide beta-ketoacyl:acyl 9e-05
cd00829 375 cd00829, SCP-x_thiolase, Thiolase domain associate 6e-04
PRK06519398 PRK06519, PRK06519, 3-oxoacyl-(acyl carrier protei 0.004
>gnl|CDD|215421 PLN02787, PLN02787, 3-oxoacyl-[acyl-carrier-protein] synthase II Back     alignment and domain information 
 Score =  385 bits (991), Expect = e-132
 Identities = 183/319 (57%), Positives = 216/319 (67%), Gaps = 39/319 (12%)

Query: 4   GKTTAVSAKSEKVAPEVK------RRVVVTGLGAVTPLGDDAHLFYTKLLEGVSGISQIE 57
           GK  AV+ + EK     K      RRVVVTG+G V+PLG D  +FY  LLEGVSGIS+IE
Sbjct: 105 GKAMAVAVQPEKEVETKKKPLTKQRRVVVTGMGVVSPLGHDPDVFYNNLLEGVSGISEIE 164

Query: 58  GFDCSELPTRIAGEIKTLSTDGLVPPKHAKRADNYLIYALIAGKKALADAGITEQVSGEL 117
            FDCS+ PTRIAGEIK+ STDG V PK +KR D +++Y L AGKKALAD GITE V  EL
Sbjct: 165 RFDCSQFPTRIAGEIKSFSTDGWVAPKLSKRMDKFMLYLLTAGKKALADGGITEDVMKEL 224

Query: 118 NKNRCGVLIGTAMGSMRALKDGIDAIKISYKKM--------------------------- 150
           +K +CGVLIG+AMG M+   D I+A++ISY+KM                           
Sbjct: 225 DKTKCGVLIGSAMGGMKVFNDAIEALRISYRKMNPFCVPFATTNMGSAMLAMDLGWMGPN 284

Query: 151 -----TCATGNCCILTAANHIIEGDADMMLCGGSDGVIIPECIAGFIACNNLSRRNSDPT 205
                 CAT N CIL AANHII G+AD+MLCGGSD  IIP  + GF+AC  LS+RN DPT
Sbjct: 285 YSISTACATSNFCILNAANHIIRGEADVMLCGGSDAAIIPIGLGGFVACRALSQRNDDPT 344

Query: 206 KASRPWDSDHDGFVMGEGAGVMLLEELDHAKRRRANIYAEFKGGSSTY-AYHISEPRLNA 264
           KASRPWD + DGFVMGEGAGV+LLEEL+HAK+R ANIYAEF GGS T  AYH++EP    
Sbjct: 345 KASRPWDMNRDGFVMGEGAGVLLLEELEHAKKRGANIYAEFLGGSFTCDAYHMTEPHPEG 404

Query: 265 LGAMACMEKALTNSGVSGE 283
            G + C+EKAL  SGVS E
Sbjct: 405 AGVILCIEKALAQSGVSKE 423

Length = 540
>gnl|CDD|238430 cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>gnl|CDD|200247 TIGR03150, fabF, beta-ketoacyl-acyl-carrier-protein synthase II Back     alignment and domain information
>gnl|CDD|235987 PRK07314, PRK07314, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|235781 PRK06333, PRK06333, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|223381 COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|240245 PTZ00050, PTZ00050, 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>gnl|CDD|181539 PRK08722, PRK08722, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|236265 PRK08439, PRK08439, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|215449 PLN02836, PLN02836, 3-oxoacyl-[acyl-carrier-protein] synthase Back     alignment and domain information
>gnl|CDD|215723 pfam00109, ketoacyl-synt, Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>gnl|CDD|236129 PRK07910, PRK07910, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|181657 PRK09116, PRK09116, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|181184 PRK07967, PRK07967, 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>gnl|CDD|238424 cd00828, elong_cond_enzymes, "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>gnl|CDD|173154 PRK14691, PRK14691, 3-oxoacyl-(acyl carrier protein) synthase II; Provisional Back     alignment and domain information
>gnl|CDD|235653 PRK05952, PRK05952, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|235817 PRK06501, PRK06501, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|238421 cd00825, decarbox_cond_enzymes, decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>gnl|CDD|238429 cd00833, PKS, polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>gnl|CDD|238428 cd00832, CLF, Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>gnl|CDD|180839 PRK07103, PRK07103, polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>gnl|CDD|238428 cd00832, CLF, Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>gnl|CDD|214836 smart00825, PKS_KS, Beta-ketoacyl synthase Back     alignment and domain information
>gnl|CDD|225858 COG3321, COG3321, Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|235817 PRK06501, PRK06501, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|236398 PRK09185, PRK09185, 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>gnl|CDD|238201 cd00327, cond_enzymes, Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>gnl|CDD|234022 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>gnl|CDD|180839 PRK07103, PRK07103, polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>gnl|CDD|238425 cd00829, SCP-x_thiolase, Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>gnl|CDD|235819 PRK06519, PRK06519, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 287
KOG1394 440 consensus 3-oxoacyl-(acyl-carrier-protein) synthas 100.0
PLN02787 540 3-oxoacyl-[acyl-carrier-protein] synthase II 100.0
PRK08722 414 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK06333 424 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK07314 411 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
COG0304 412 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li 100.0
cd00832 399 CLF Chain-length factor (CLF) is a factor required 100.0
TIGR03150 407 fabF beta-ketoacyl-acyl-carrier-protein synthase I 100.0
PRK09116 405 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK08439 406 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK07910 418 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PLN02836 437 3-oxoacyl-[acyl-carrier-protein] synthase 100.0
PRK07103 410 polyketide beta-ketoacyl:acyl carrier protein synt 100.0
PRK07967 406 3-oxoacyl-(acyl carrier protein) synthase I; Revie 100.0
cd00834 406 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) 100.0
cd00828 407 elong_cond_enzymes "elongating" condensing enzymes 100.0
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 100.0
COG3321 1061 Polyketide synthase modules and related proteins [ 100.0
PTZ00050 421 3-oxoacyl-acyl carrier protein synthase; Provision 100.0
PRK06519398 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK05952 381 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
cd00833 421 PKS polyketide synthases (PKSs) polymerize simple 100.0
PRK06501 425 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
smart00825 424 PKS_KS Beta-ketoacyl synthase. The structure of be 100.0
PRK09185 392 3-oxoacyl-(acyl carrier protein) synthase I; Revie 100.0
PF00109254 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal 100.0
PRK14691 342 3-oxoacyl-(acyl carrier protein) synthase II; Prov 100.0
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 99.96
PRK06147348 3-oxoacyl-(acyl carrier protein) synthase; Validat 99.95
cd00825 332 decarbox_cond_enzymes decarboxylating condensing e 99.89
cd00327254 cond_enzymes Condensing enzymes; Family of enzymes 99.75
PRK07108392 acetyl-CoA acetyltransferase; Provisional 99.7
PRK05656393 acetyl-CoA acetyltransferase; Provisional 99.7
PRK06633392 acetyl-CoA acetyltransferase; Provisional 99.69
PRK08131401 acetyl-CoA acetyltransferase; Provisional 99.69
PRK13359400 beta-ketoadipyl CoA thiolase; Provisional 99.68
PRK07661391 acetyl-CoA acetyltransferase; Provisional 99.67
PRK09051394 beta-ketothiolase; Provisional 99.67
PRK09052399 acetyl-CoA acetyltransferase; Provisional 99.67
PRK08242402 acetyl-CoA acetyltransferase; Validated 99.67
PRK06445394 acetyl-CoA acetyltransferase; Provisional 99.66
cd00829 375 SCP-x_thiolase Thiolase domain associated with ste 99.66
PRK12578 385 acetyl-CoA acetyltransferase; Provisional 99.66
TIGR02430400 pcaF beta-ketoadipyl CoA thiolase. Members of this 99.65
PLN02287452 3-ketoacyl-CoA thiolase 99.65
cd00751386 thiolase Thiolase are ubiquitous enzymes that cata 99.65
PRK06954397 acetyl-CoA acetyltransferase; Provisional 99.65
PRK07850387 acetyl-CoA acetyltransferase; Provisional 99.65
PRK06064 389 acetyl-CoA acetyltransferase; Provisional 99.65
TIGR02445385 fadA fatty oxidation complex, beta subunit FadA. T 99.65
PRK05790393 putative acyltransferase; Provisional 99.64
PRK09050401 beta-ketoadipyl CoA thiolase; Validated 99.64
PRK06205404 acetyl-CoA acetyltransferase; Provisional 99.64
TIGR01930386 AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi 99.64
PRK07851406 acetyl-CoA acetyltransferase; Provisional 99.63
PRK08235393 acetyl-CoA acetyltransferase; Provisional 99.62
PRK06158 384 thiolase; Provisional 99.62
PRK07515372 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.61
PRK06366388 acetyl-CoA acetyltransferase; Provisional 99.6
PRK08256 391 lipid-transfer protein; Provisional 99.6
COG0332323 FabH 3-oxoacyl-[acyl-carrier-protein] 99.6
PRK08947387 fadA 3-ketoacyl-CoA thiolase; Reviewed 99.6
PRK07516 389 acetyl-CoA acetyltransferase; Provisional 99.6
PLN02644394 acetyl-CoA C-acetyltransferase 99.59
PRK06025417 acetyl-CoA acetyltransferase; Provisional 99.59
PRK08170426 acetyl-CoA acetyltransferase; Provisional 99.59
PRK06504390 acetyl-CoA acetyltransferase; Provisional 99.59
PRK08142 388 acetyl-CoA acetyltransferase; Provisional 99.59
PRK06289 403 acetyl-CoA acetyltransferase; Provisional 99.59
PRK08963428 fadI 3-ketoacyl-CoA thiolase; Reviewed 99.57
PTZ00455 438 3-ketoacyl-CoA thiolase; Provisional 99.56
TIGR02446430 FadI fatty oxidation complex, beta subunit FadI. T 99.56
PRK06157 398 acetyl-CoA acetyltransferase; Validated 99.55
PRK08313 386 acetyl-CoA acetyltransferase; Provisional 99.55
PRK06365 430 acetyl-CoA acetyltransferase; Provisional 99.55
KOG1390396 consensus Acetyl-CoA acetyltransferase [Lipid tran 99.55
PRK06065 392 acetyl-CoA acetyltransferase; Provisional 99.55
PRK06816 378 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.55
PRK07801382 acetyl-CoA acetyltransferase; Provisional 99.54
cd00826 393 nondecarbox_cond_enzymes nondecarboxylating conden 99.53
PRK06690361 acetyl-CoA acetyltransferase; Provisional 99.53
PRK06059 399 lipid-transfer protein; Provisional 99.51
PRK06066 385 acetyl-CoA acetyltransferase; Provisional 99.51
PRK07855386 lipid-transfer protein; Provisional 99.47
PRK09352319 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.45
PRK07204 329 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.44
TIGR02845 327 spore_V_AD stage V sporulation protein AD. Bacillu 99.43
PRK09268 427 acetyl-CoA acetyltransferase; Provisional 99.43
PRK09258338 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.41
PRK07937352 lipid-transfer protein; Provisional 99.4
KOG1389435 consensus 3-oxoacyl CoA thiolase [Lipid transport 99.4
KOG1391396 consensus Acetyl-CoA acetyltransferase [Lipid tran 99.38
PRK12879325 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.37
cd00830320 KAS_III Ketoacyl-acyl carrier protein synthase III 99.36
CHL00203 326 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr 99.35
PRK08257 498 acetyl-CoA acetyltransferase; Validated 99.35
TIGR00747318 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III 99.34
PLN02326 379 3-oxoacyl-[acyl-carrier-protein] synthase III 99.34
PRK08304 337 stage V sporulation protein AD; Validated 99.29
PRK06840 339 hypothetical protein; Validated 99.2
KOG1406 408 consensus Peroxisomal 3-ketoacyl-CoA-thiolase P-44 99.2
PLN03169391 chalcone synthase family protein; Provisional 99.19
TIGR00748 345 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase 99.19
PRK12404 334 stage V sporulation protein AD; Provisional 99.17
PLN03172393 chalcone synthase family protein; Provisional 99.14
PLN03170401 chalcone synthase; Provisional 99.14
PRK04262 347 hypothetical protein; Provisional 99.14
PRK05963 326 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.12
cd00827 324 init_cond_enzymes "initiating" condensing enzymes 99.11
cd00831361 CHS_like Chalcone and stilbene synthases; plant-sp 99.11
PLN03173391 chalcone synthase; Provisional 99.08
PRK12880 353 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.08
PLN03171 399 chalcone synthase-like protein; Provisional 99.08
PLN03168 389 chalcone synthase; Provisional 98.86
PLN02577 459 hydroxymethylglutaryl-CoA synthase 98.83
PF00108264 Thiolase_N: Thiolase, N-terminal domain; InterPro: 98.82
PLN02932 478 3-ketoacyl-CoA synthase 98.65
TIGR01835 379 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synt 98.61
PLN02854 521 3-ketoacyl-CoA synthase 98.59
PLN02192 511 3-ketoacyl-CoA synthase 98.53
PLN02377 502 3-ketoacyl-CoA synthase 98.52
PF08392290 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase- 98.52
KOG1392465 consensus Acetyl-CoA acetyltransferase [Lipid tran 98.5
COG3425 377 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi 98.47
PLN00415 466 3-ketoacyl-CoA synthase 98.43
COG3424356 BcsA Predicted naringenin-chalcone synthase [Secon 98.3
COG0183 392 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis 98.23
PF07451 329 SpoVAD: Stage V sporulation protein AD (SpoVAD); I 98.22
PF00195226 Chal_sti_synt_N: Chalcone and stilbene synthases, 98.1
TIGR01833 454 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synth 98.09
PF0854580 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP) 98.08
PF13723218 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-termina 97.73
PF02801119 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-termina 97.44
PF01154174 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A s 97.03
PF02803123 Thiolase_C: Thiolase, C-terminal domain; InterPro: 95.62
PF02801119 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-termina 82.24
>KOG1394 consensus 3-oxoacyl-(acyl-carrier-protein) synthase (I and II) [Lipid transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=5e-52  Score=350.22  Aligned_cols=268  Identities=46%  Similarity=0.748  Sum_probs=249.7

Q ss_pred             CCCCceEEEeccccCCCCCCHHHHHHHHHcCCCcceeCCCCCCCCCCCceeeecCCCCCCCCCCchhhccCChHHHHHHH
Q 041762           19 EVKRRVVVTGLGAVTPLGDDAHLFYTKLLEGVSGISQIEGFDCSELPTRIAGEIKTLSTDGLVPPKHAKRADNYLIYALI   98 (287)
Q Consensus        19 ~~~~~v~I~G~g~~~~~g~~~~~~~~~l~~g~~~~~~~~~~~~~~~~~~~~~~i~~~d~~~~~~~~~~~~~~~~~~l~~~   98 (287)
                      ..+++|+|||+|+++|+|.+..++|++|.+|++++..++.++...+|...+++||.|+.+.|+++...++|++..++++.
T Consensus        21 ~~~rRVVITGmG~VTplG~~v~~~w~~Ll~GesGI~~l~~~d~k~~p~~v~g~Ip~f~~e~~~s~~~~r~ms~~~~~al~  100 (440)
T KOG1394|consen   21 SRMRRVVITGMGAVTPLGNGVHTSWRNLLSGESGISSLEGPDYKSIPFTVAGKIPRFSVEDYVSKGDERRMSKFTKLALT  100 (440)
T ss_pred             CcceeEEEeccceeecCCCChHHHHHHhhccccCcccccccccccCcchheeeccccccccccchhhhhhhhHHHHHHHH
Confidence            33789999999999999999999999999999999999888888999999999999999999999999999999999999


Q ss_pred             HHHHHHHHcCCCCccccccCCCeEEEEEcCcCCcHHHHHHHHHHH-hccCCccc--------------------------
Q 041762           99 AGKKALADAGITEQVSGELNKNRCGVLIGTAMGSMRALKDGIDAI-KISYKKMT--------------------------  151 (287)
Q Consensus        99 a~~~al~~agi~~~~i~~~~~~~~gv~~g~~~~~~~~~~~~~~~~-~~~~~~~~--------------------------  151 (287)
                      ++.+||+++++.+...+..+.+++||.+|+++++...+....+.+ ..+++.++                          
T Consensus       101 aa~eAL~da~~~~~~~~e~dk~~~GV~iGtgmg~l~~i~e~a~~~~~~g~rrvsPffVPkil~NM~ag~vsm~~gl~Gpn  180 (440)
T KOG1394|consen  101 AAEEALKDAGLLDVNLSEEDKEKTGVLIGTGMGDLEDIYETAQNLSEKGYRRVSPFFVPKILTNMAAGYVSMKYGLRGPN  180 (440)
T ss_pred             HHHHHHHhcCCCCcccchhhhhhhceEeccccccHHHHHHHHHHHHHhcccccCccccchhhcccccchhhhhhcCcCCc
Confidence            999999999999875556688999999999999988776655554 22233222                          


Q ss_pred             ------chhhHHHHHHHHHHHHcCCCCEEEEeecCCCCCHHHHHhhHhcCCCCCCCCCCCCCCcCCCCCCCcccccceEE
Q 041762          152 ------CATGNCCILTAANHIIEGDADMMLCGGSDGVIIPECIAGFIACNNLSRRNSDPTKASRPWDSDHDGFVMGEGAG  225 (287)
Q Consensus       152 ------caS~~~Al~~A~~~I~~G~~d~vlv~g~d~~~~~~~~~~~~~~~~l~~~~~~~~~~~~pf~~~~~g~~~geGaa  225 (287)
                            |++|..+|..|.+.|+.|++|++|+||+|..+.|..+.+|...+.|++.+.+|...+||||.+++||+.|||++
T Consensus       181 hsvSTACATg~h~igda~n~Ir~GdaDvmlAGgsE~~I~PlslaGF~r~RALSt~nd~P~~aSRPfD~~RdGFVmGEGag  260 (440)
T KOG1394|consen  181 HSVSTACATGNHCIGDAFNFIRLGDADVMLAGGSEACINPLSLAGFSRARALSTRNDNPQKASRPFDKKRDGFVMGEGAG  260 (440)
T ss_pred             hhhHhhhhhccchHHHHHHHHHhCccceeeccCcceeecchhhhhHHHHHHhhhcCCCccccCCCCccCCCceeecccee
Confidence                  99999999999999999999999999999999999999999999999988889999999999999999999999


Q ss_pred             EEEecchHHHHhcCCcEeEEEEEeeecC-CCCCCCCCCChHHHHHHHHHHHHHcCCCCCCCC
Q 041762          226 VMLLEELDHAKRRRANIYAEFKGGSSTY-AYHISEPRLNALGAMACMEKALTNSGVSGEIYR  286 (287)
Q Consensus       226 avvL~~~~~A~~~g~~~~a~i~g~~~~~-~~~~~~~~~~~~~~~~a~~~al~~agl~~~dId  286 (287)
                      ++|||+.|+|++||++||++++|++.+. ++|++.|+++|.+...+|++||++|||.|+|||
T Consensus       261 vlvlEelEHA~~RgA~I~AE~lGygls~Da~HiT~P~~dG~Ga~~am~raL~~Agl~pe~i~  322 (440)
T KOG1394|consen  261 VLVLEELEHAKKRGAPIYAEVLGYGLSSDAYHITSPDPDGAGAVLAMERALKDAGLSPEDID  322 (440)
T ss_pred             EEehHhHHHHHHcCCceeHHhhcCcccccccccCCCCCCcchHHHHHHHHHHHcCCChhhcC
Confidence            9999999999999999999999999999 999999999999999999999999999999997

>PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II Back     alignment and domain information
>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II Back     alignment and domain information
>PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase Back     alignment and domain information
>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>smart00825 PKS_KS Beta-ketoacyl synthase Back     alignment and domain information
>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PF00109 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal domain; InterPro: IPR014030 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>PRK07108 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08131 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>PRK12578 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR02430 pcaF beta-ketoadipyl CoA thiolase Back     alignment and domain information
>PLN02287 3-ketoacyl-CoA thiolase Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06064 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR02445 fadA fatty oxidation complex, beta subunit FadA Back     alignment and domain information
>PRK05790 putative acyltransferase; Provisional Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08256 lipid-transfer protein; Provisional Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK07516 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PLN02644 acetyl-CoA C-acetyltransferase Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06504 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08142 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06289 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PTZ00455 3-ketoacyl-CoA thiolase; Provisional Back     alignment and domain information
>TIGR02446 FadI fatty oxidation complex, beta subunit FadI Back     alignment and domain information
>PRK06157 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06365 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>KOG1390 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK06690 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06059 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06066 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>TIGR02845 spore_V_AD stage V sporulation protein AD Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK07937 lipid-transfer protein; Provisional Back     alignment and domain information
>KOG1389 consensus 3-oxoacyl CoA thiolase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1391 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III Back     alignment and domain information
>PRK08304 stage V sporulation protein AD; Validated Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>KOG1406 consensus Peroxisomal 3-ketoacyl-CoA-thiolase P-44/SCP2 [Lipid transport and metabolism] Back     alignment and domain information
>PLN03169 chalcone synthase family protein; Provisional Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>PRK12404 stage V sporulation protein AD; Provisional Back     alignment and domain information
>PLN03172 chalcone synthase family protein; Provisional Back     alignment and domain information
>PLN03170 chalcone synthase; Provisional Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>PLN03173 chalcone synthase; Provisional Back     alignment and domain information
>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PLN03171 chalcone synthase-like protein; Provisional Back     alignment and domain information
>PLN03168 chalcone synthase; Provisional Back     alignment and domain information
>PLN02577 hydroxymethylglutaryl-CoA synthase Back     alignment and domain information
>PF00108 Thiolase_N: Thiolase, N-terminal domain; InterPro: IPR020616 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>PLN02932 3-ketoacyl-CoA synthase Back     alignment and domain information
>TIGR01835 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade Back     alignment and domain information
>PLN02854 3-ketoacyl-CoA synthase Back     alignment and domain information
>PLN02192 3-ketoacyl-CoA synthase Back     alignment and domain information
>PLN02377 3-ketoacyl-CoA synthase Back     alignment and domain information
>PF08392 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase-like protein; InterPro: IPR013601 This domain is found in proteins that are described as 3-ketoacyl-CoA synthases, type III polyketide synthases, fatty acid elongases and fatty acid condensing enzymes, and are found in both prokaryotic and eukaryotic (mainly plant) species Back     alignment and domain information
>KOG1392 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>PLN00415 3-ketoacyl-CoA synthase Back     alignment and domain information
>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>PF07451 SpoVAD: Stage V sporulation protein AD (SpoVAD); InterPro: IPR010894 This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long Back     alignment and domain information
>PF00195 Chal_sti_synt_N: Chalcone and stilbene synthases, N-terminal domain; InterPro: IPR001099 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2 Back     alignment and domain information
>TIGR01833 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade Back     alignment and domain information
>PF08545 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III; InterPro: IPR013751 Fatty acid synthesis (FAS) is a vital aspect of cellular physiology which can occur by two distinct pathways Back     alignment and domain information
>PF13723 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>PF02801 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain; InterPro: IPR014031 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>PF01154 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A synthase N terminal; InterPro: IPR013528 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase Back     alignment and domain information
>PF02803 Thiolase_C: Thiolase, C-terminal domain; InterPro: IPR020617 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>PF02801 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain; InterPro: IPR014031 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query287
1j3n_A 408 Crystal Structure Of 3-Oxoacyl-(Acyl-Carrier Protei 4e-48
1e5m_A 416 Beta Ketoacyl Acyl Carrier Protein Synthase Ii (Kas 4e-47
3o04_A 413 Crystal Structure Of The Beta-Keto-Acyl Carrier Pro 1e-39
1b3n_A 412 Beta-Ketoacyl Carrier Protein Synthase As A Drug Ta 2e-39
2gfy_A 427 Structure Of E. Coli Fabf(K335a) Mutant With Covale 2e-39
2gfw_A 427 Structure Of Wild Type E. Coli Fabf (Kasii) Length 2e-39
3kzu_A 428 Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protei 3e-39
2alm_A 431 Crystal Structure Analysis Of A Mutant Beta-Ketoacy 1e-38
1ox0_A 430 The Crystal Structure Of Beta-Ketoacyl-[acyl Carrie 2e-38
3hnz_A 427 Structure Of E. Coli Fabf(C163a) In Complex With Pl 2e-38
2gqd_A 437 The Crystal Structure Of B-Ketoacyl-Acp Synthase Ii 2e-38
2gfv_A 427 Structure Of E. Coli Fabf (Kasii) C163q Mutant Leng 2e-38
2rjt_A 428 Crystal Structure Analysis Of A Surface Entropy Red 7e-38
3e60_A 424 Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protei 9e-37
2iwy_A 438 Human Mitochondrial Beta-ketoacyl Acp Synthase Leng 2e-35
2c9h_A 444 Structure Of Mitochondrial Beta-Ketoacyl Synthase L 1e-34
1w0i_A 431 Arabidopsis Thaliana Mitochondrial Kas Length = 431 5e-31
4ddo_A 451 Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protei 7e-27
4f32_A 451 Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protei 2e-26
2byw_A 418 Structure Of Escherichia Coli Beta-Ketoacyl (Acyl C 3e-25
1dd8_A 406 Crystal Structure Of Beta-Ketoacyl-[acyl Carrier Pr 3e-25
2byz_A 418 Structure Of E. Coli Kas I H298q Mutant In Complex 7e-25
2byy_A 418 E. Coli Kas I H298e Mutation Length = 418 8e-25
1h4f_A 406 E. Coli Beta-Ketoacyl [acyl Carrier Protein] Syntha 9e-25
1fj4_A 406 The Structure Of Beta-Ketoacyl-[acyl Carrier Protei 9e-25
1tqy_A 424 The Actinorhodin KetosynthaseCHAIN LENGTH FACTOR Le 1e-24
1f91_A 406 Beta-Ketoacyl-[acyl-Carrier-Protein] Synthase I In 1e-24
1ek4_A 418 Beta-Ketoacyl [acyl Carrier Protein] Synthase I In 2e-24
2vb7_C 406 Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli, Ap 5e-24
4ewg_A 412 Crystal Structure Of A Beta-Ketoacyl Synthase From 1e-23
3lrf_A 428 Crystal Structure Of Beta-Ketoacyl Synthase From Br 4e-23
3u0f_A 411 The Structure Of Beta-Ketoacyl Synthase From Brucel 5e-23
2gp6_A 434 X-Ray Crystal Structure Of Mycobacterium Tuberculos 2e-22
2wgd_A 416 Crystal Structure Of Kasa Of Mycobacterium Tubercul 3e-20
2wgf_A 416 Crystal Structure Of Mycobacterium Tuberculosis C17 4e-19
3oyt_A 410 1.84 Angstrom Resolution Crystal Structure Of 3-Oxo 4e-17
1tqy_B 415 The Actinorhodin KetosynthaseCHAIN LENGTH FACTOR Le 2e-14
>pdb|1J3N|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl-Carrier Protein) Synthase Ii From Thermus Thermophilus Hb8 Length = 408 Back     alignment and structure 
Iteration: 1

 Score =  188 bits (477), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 156/296 (52%), Gaps = 38/296 (12%)
Query: 22  RRVVVTGLGAVTPLGDDAHLFYTKLLEGVSGISQIEGFDCSELPTRIAGEIKTLSTDGLV 81
           RRVVVTGLGA+TP+G     F+   L G SG+  I  FD S LP RIA E+  +     +
Sbjct: 2   RRVVVTGLGALTPIGVGQEAFHKAQLAGKSGVRPITRFDASALPVRIAAEVD-VDPGAYL 60
Query: 82  PPKHAKRADNYLIYALIAGKKALADAGITEQVSGELNKNRCGVLIGTAMGSMRA------ 135
             K  +R D ++ YALIA + AL DAG+  +   +L+  R G L+GT +G M        
Sbjct: 61  DRKELRRLDRFVQYALIAAQLALEDAGLKPE---DLDPERVGTLVGTGIGGMETWEAQSR 117
Query: 136 --LKDGIDAIKISYKKM-------------------------TCATGNCCILTAANHIIE 168
             L+ G + I   +  M                          CATG   + +A   I  
Sbjct: 118 VFLERGPNRISPFFIPMMIANMASAHIAMRYGFTGPSSTVVTACATGADALGSALRMIQL 177
Query: 169 GDADMMLCGGSDGVIIPECIAGFIACNNLSRRNSDPTKASRPWDSDHDGFVMGEGAGVML 228
           G+AD++L GG++  I P  I  F     LS RN +P KASRP+    DGFVMGEGAGV++
Sbjct: 178 GEADLVLAGGTEAAITPMAIGAFAVMRALSTRNEEPEKASRPFTLSRDGFVMGEGAGVLV 237
Query: 229 LEELDHAKRRRANIYAEFKG-GSSTYAYHISEPRLNALGAMACMEKALTNSGVSGE 283
           LE  +HAK+R A IYAE  G G S  A+HI+EP     GA   M +AL ++G++ E
Sbjct: 238 LEAYEHAKKRGARIYAELVGFGRSADAHHITEPHPEGKGAALAMARALKDAGIAPE 293
>pdb|1E5M|A Chain A, Beta Ketoacyl Acyl Carrier Protein Synthase Ii (Kasii) From Synechocystis Sp Length = 416 Back     alignment and structure
>pdb|3O04|A Chain A, Crystal Structure Of The Beta-Keto-Acyl Carrier Protein Synthase Ii (Lmo2201) From Listeria Monocytogenes Length = 413 Back     alignment and structure
>pdb|1B3N|A Chain A, Beta-Ketoacyl Carrier Protein Synthase As A Drug Target, Implications From The Crystal Structure Of A Complex With The Inhibitor Cerulenin. Length = 412 Back     alignment and structure
>pdb|2GFY|A Chain A, Structure Of E. Coli Fabf(K335a) Mutant With Covalently Linked Dodecanoic Acid Length = 427 Back     alignment and structure
>pdb|2GFW|A Chain A, Structure Of Wild Type E. Coli Fabf (Kasii) Length = 427 Back     alignment and structure
>pdb|3KZU|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Synthase Ii From Brucella Melitensis Length = 428 Back     alignment and structure
>pdb|2ALM|A Chain A, Crystal Structure Analysis Of A Mutant Beta-Ketoacyl-[acyl Carrier Protein] Synthase Ii From Streptococcus Pneumoniae Length = 431 Back     alignment and structure
>pdb|1OX0|A Chain A, The Crystal Structure Of Beta-Ketoacyl-[acyl Carrier Protein] Synthase Ii From Streptococcus Pneumoniae Length = 430 Back     alignment and structure
>pdb|3HNZ|A Chain A, Structure Of E. Coli Fabf(C163a) In Complex With Platensimycin Length = 427 Back     alignment and structure
>pdb|2GQD|A Chain A, The Crystal Structure Of B-Ketoacyl-Acp Synthase Ii (Fabf) From Staphylococcus Aureus Length = 437 Back     alignment and structure
>pdb|2GFV|A Chain A, Structure Of E. Coli Fabf (Kasii) C163q Mutant Length = 427 Back     alignment and structure
>pdb|2RJT|A Chain A, Crystal Structure Analysis Of A Surface Entropy Reduction Mutant Of S. Pneumoniae Fabf Length = 428 Back     alignment and structure
>pdb|3E60|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Synthase Ii From Bartonella Henselae Length = 424 Back     alignment and structure
>pdb|2IWY|A Chain A, Human Mitochondrial Beta-ketoacyl Acp Synthase Length = 438 Back     alignment and structure
>pdb|2C9H|A Chain A, Structure Of Mitochondrial Beta-Ketoacyl Synthase Length = 444 Back     alignment and structure
>pdb|1W0I|A Chain A, Arabidopsis Thaliana Mitochondrial Kas Length = 431 Back     alignment and structure
>pdb|4DDO|A Chain A, Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Synthase Ii From Burkholderia Vietnamiensis Length = 451 Back     alignment and structure
>pdb|4F32|A Chain A, Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Synthase Ii From Burkholderia Vietnamiensis In Complex With Platencin Length = 451 Back     alignment and structure
>pdb|2BYW|A Chain A, Structure Of Escherichia Coli Beta-Ketoacyl (Acyl Carrier Protein) Synthase I Lys328ala Mutant Length = 418 Back     alignment and structure
>pdb|1DD8|A Chain A, Crystal Structure Of Beta-Ketoacyl-[acyl Carrier Protein] Synthase I From Escherichia Coli Length = 406 Back     alignment and structure
>pdb|2BYZ|A Chain A, Structure Of E. Coli Kas I H298q Mutant In Complex With C12 Fatty Acid Length = 418 Back     alignment and structure
>pdb|2BYY|A Chain A, E. Coli Kas I H298e Mutation Length = 418 Back     alignment and structure
>pdb|1H4F|A Chain A, E. Coli Beta-Ketoacyl [acyl Carrier Protein] Synthase I K328r Length = 406 Back     alignment and structure
>pdb|1FJ4|A Chain A, The Structure Of Beta-Ketoacyl-[acyl Carrier Protein] Synthase I In Complex With Thiolactomycin, Implications For Drug Design Length = 406 Back     alignment and structure
>pdb|1TQY|A Chain A, The Actinorhodin KetosynthaseCHAIN LENGTH FACTOR Length = 424 Back     alignment and structure
>pdb|1F91|A Chain A, Beta-Ketoacyl-[acyl-Carrier-Protein] Synthase I In Complex With C10 Fatty Acid Substrate Length = 406 Back     alignment and structure
>pdb|1EK4|A Chain A, Beta-Ketoacyl [acyl Carrier Protein] Synthase I In Complex With Dodecanoic Acid To 1.85 Resolution Length = 418 Back     alignment and structure
>pdb|2VB7|C Chain C, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli, Apo Structure After Soak In Peg Solution Length = 406 Back     alignment and structure
>pdb|4EWG|A Chain A, Crystal Structure Of A Beta-Ketoacyl Synthase From Burkholderia Phymatum Stm815 Length = 412 Back     alignment and structure
>pdb|3LRF|A Chain A, Crystal Structure Of Beta-Ketoacyl Synthase From Brucella Melitensis Length = 428 Back     alignment and structure
>pdb|3U0F|A Chain A, The Structure Of Beta-Ketoacyl Synthase From Brucella Melitensis Bound To The Fragment 7-Hydroxycoumarin Length = 411 Back     alignment and structure
>pdb|2GP6|A Chain A, X-Ray Crystal Structure Of Mycobacterium Tuberculosis Beta- Ketoacyl Acyl Carrier Protein Synthase Ii (Mtkasb) Length = 434 Back     alignment and structure
>pdb|2WGD|A Chain A, Crystal Structure Of Kasa Of Mycobacterium Tuberculosis Length = 416 Back     alignment and structure
>pdb|2WGF|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis C171q Kasa Variant Length = 416 Back     alignment and structure
>pdb|3OYT|A Chain A, 1.84 Angstrom Resolution Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Synthase I (Fabb) From Yersinia Pestis Co92 Length = 410 Back     alignment and structure
>pdb|1TQY|B Chain B, The Actinorhodin KetosynthaseCHAIN LENGTH FACTOR Length = 415 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query287
1e5m_A 416 KAS II, beta ketoacyl acyl carrier protein synthas 3e-97
3ho9_A 427 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, 8e-97
1ox0_A 430 Beta ketoacyl-acyl carrier protein synthase; trans 3e-95
3o04_A 413 LMO2201 protein, beta-keto-acyl carrier protein sy 7e-95
2iwz_A 438 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho 8e-95
4ddo_A 451 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci 9e-95
3kzu_A 428 3-oxoacyl-(acyl-carrier-protein) synthase II; seat 1e-94
1tqy_A 424 Beta-ketoacyl synthase/acyl transferase; alpha-bet 1e-94
2gqd_A 437 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli 2e-94
1j3n_A 408 3-oxoacyl-(acyl-carrier protein) synthase II; cond 2e-94
2wge_A 416 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta 2e-93
4ewg_A 412 Beta-ketoacyl synthase; ssgcid, structural genomic 3e-92
2gp6_A 434 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol 5e-92
1tqy_B 415 Actinorhodin polyketide putative beta-ketoacyl SY; 3e-90
2ix4_A 431 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke 3e-89
3mqd_A 428 Beta-ketoacyl synthase; ssgcid, ALS collaborative 1e-84
2vba_A 406 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop 7e-84
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 2e-79
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 3e-04
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 1e-58
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 8e-58
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 2e-06
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 2e-04
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 3e-04
>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 Length = 416 Back     alignment and structure
 Score =  290 bits (746), Expect = 3e-97
 Identities = 112/297 (37%), Positives = 155/297 (52%), Gaps = 37/297 (12%)

Query: 21  KRRVVVTGLGAVTPLGDDAHLFYTKLLEGVSGISQIEGFDCSELPTRIAGEIKTLSTDGL 80
           K+RVVVTGLGA+TP+G+    ++  L+EG +GI  I  FD S+   R  GE+K       
Sbjct: 6   KKRVVVTGLGAITPIGNTLQDYWQGLMEGRNGIGPITRFDASDQACRFGGEVKDFDATQF 65

Query: 81  VPPKHAKRADNYLIYALIAGKKALADAGITEQVSGELNKNRCGVLIGTAMGSMRALKD-- 138
           +  K AKR D +  +A+ A ++A+ DA +      ELN +  GVLIGT +G ++ L+D  
Sbjct: 66  LDRKEAKRMDRFCHFAVCASQQAINDAKLVI---NELNADEIGVLIGTGIGGLKVLEDQQ 122

Query: 139 -------------------------GIDAIKISYKKMT------CATGNCCILTAANHII 167
                                    G+ AI +  K         CA G+  I  A   + 
Sbjct: 123 TILLDKGPSRCSPFMIPMMIANMASGLTAINLGAKGPNNCTVTACAAGSNAIGDAFRLVQ 182

Query: 168 EGDADMMLCGGSDGVIIPECIAGFIACNNLSRRNSDPTKASRPWDSDHDGFVMGEGAGVM 227
            G A  M+CGG++  I P   AGF +   LS RN DP  ASRP+D D DGFVMGEG+G++
Sbjct: 183 NGYAKAMICGGTEAAITPLSYAGFASARALSFRNDDPLHASRPFDKDRDGFVMGEGSGIL 242

Query: 228 LLEELDHAKRRRANIYAEFKG-GSSTYAYHISEPRLNALGAMACMEKALTNSGVSGE 283
           +LEEL+ A  R A IY E  G   +  AYHI+ P  +  GA   +  AL +SG+  E
Sbjct: 243 ILEELESALARGAKIYGEMVGYAMTCDAYHITAPVPDGRGATRAIAWALKDSGLKPE 299
>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A Length = 427 Back     alignment and structure
>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A Length = 430 Back     alignment and structure
>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} Length = 413 Back     alignment and structure
>2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A Length = 438 Back     alignment and structure
>4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* Length = 451 Back     alignment and structure
>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Length = 428 Back     alignment and structure
>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Length = 424 Back     alignment and structure
>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} Length = 437 Back     alignment and structure
>1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Length = 408 Back     alignment and structure
>2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* Length = 416 Back     alignment and structure
>4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} Length = 412 Back     alignment and structure
>2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} Length = 434 Back     alignment and structure
>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Length = 415 Back     alignment and structure
>2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A Length = 431 Back     alignment and structure
>3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* Length = 428 Back     alignment and structure
>2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... Length = 406 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Length = 915 Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Length = 917 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query287
3ho9_A 427 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, 100.0
1e5m_A 416 KAS II, beta ketoacyl acyl carrier protein synthas 100.0
2gqd_A 437 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli 100.0
3kzu_A 428 3-oxoacyl-(acyl-carrier-protein) synthase II; seat 100.0
3o04_A 413 LMO2201 protein, beta-keto-acyl carrier protein sy 100.0
4ewg_A 412 Beta-ketoacyl synthase; ssgcid, structural genomic 100.0
1j3n_A 408 3-oxoacyl-(acyl-carrier protein) synthase II; cond 100.0
1ox0_A 430 Beta ketoacyl-acyl carrier protein synthase; trans 100.0
1tqy_A 424 Beta-ketoacyl synthase/acyl transferase; alpha-bet 100.0
4ddo_A 451 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci 100.0
2iwz_A 438 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho 100.0
2gp6_A 434 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol 100.0
1tqy_B 415 Actinorhodin polyketide putative beta-ketoacyl SY; 100.0
2wge_A 416 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta 100.0
2vba_A 406 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop 100.0
3mqd_A 428 Beta-ketoacyl synthase; ssgcid, ALS collaborative 100.0
2ix4_A 431 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke 100.0
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 100.0
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 100.0
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 100.0
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 100.0
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.98
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.98
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.97
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.97
1wl4_A397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 99.87
2iik_A418 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m 99.87
1wdk_C390 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame 99.86
2vu1_A392 Acetyl-COA acetyltransferase; acyltransferase, PHB 99.85
2wu9_A 442 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o 99.83
2ib8_A395 Acetyl-COA acetyltransferase; thiolase fold, potas 99.83
3goa_A387 3-ketoacyl-COA thiolase; metabolism, fatty acid, p 99.83
1afw_A393 3-ketoacetyl-COA thiolase; fatty acid metabolism; 99.83
3ss6_A394 Acetyl-COA acetyltransferase; structural genomics, 99.82
1ulq_A401 Putative acetyl-COA acetyltransferase; structural 99.82
4dd5_A396 Acetyl-COA acetyltransferase; structural genomics, 99.82
4e1l_A395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 99.81
3svk_A407 Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, 99.79
3tsy_A979 Fusion protein 4-coumarate--COA ligase 1, resvera 99.77
2ebd_A309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 99.76
1mzj_A339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 99.74
2h84_A374 Steely1; thiolase-fold, type III polyketide syntha 99.73
1ub7_A322 3-oxoacyl-[acyl-carrier protein] synthase; fatty a 99.73
1hnj_A317 Beta-ketoacyl-acyl carrier protein synthase III; F 99.73
1u0m_A 382 Putative polyketide synthase; type III polyketide 99.71
1u6e_A335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 99.69
4egv_A 520 Acetyl-COA acetyltransferase; NEW SUB-family, thio 99.68
2x3e_A331 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, 99.68
1zow_A313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 99.65
1ted_A393 PKS18; thiolase fold, substrate binding tunnel, tr 99.64
3s21_A345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 99.64
4dfe_A333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 99.63
3led_A 392 3-oxoacyl-acyl carrier protein synthase III; struc 99.51
2d3m_A406 Pentaketide chromone synthase; chalcone synthase, 99.49
1ee0_A402 2-pyrone synthase; polyketide synthase, thiolase f 99.45
3lma_A 347 Stage V sporulation protein AD (spovad); NESG, str 99.44
3il3_A323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 99.44
3a5r_A387 Benzalacetone synthase; chalcone synthase, type II 99.44
3gwa_A 365 3-oxoacyl-(acyl-carrier-protein) synthase III; str 99.42
3h78_A 359 PQS biosynthetic enzyme; PQSD, anthranilic acid, a 99.37
3s3l_A 357 CERJ; acyltransferase, FABH homologue, KS III homo 99.37
2f82_A 450 HMG-COA synthase; HMGS1, transferase; 2.10A {Brass 99.35
2p0u_A413 Stilbenecarboxylate synthase 2; polyketide synthas 99.33
3e1h_A 465 PKSIIINC, putative uncharacterized protein; resorc 99.33
3awk_A 402 Chalcone synthase-like polyketide synthase; type I 99.31
3oit_A 387 OS07G0271500 protein; type III polyketide synthase 99.31
4efi_A 354 3-oxoacyl-(acyl-carrier protein) synthase; structu 99.29
1xpm_A 396 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s 99.28
3euo_A379 Type III pentaketide synthase; alpha helix, acyltr 99.28
4ewp_A 350 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans 99.28
1xes_A413 Dihydropinosylvin synthase; native structure, tran 99.28
3ov2_A 393 Curcumin synthase; type III polyketide synthase, t 99.27
1i88_A389 CHS2, chalcone synthase 2; polyketide synthase, tr 99.27
3il6_A321 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 99.26
3v4n_A 388 HMG-COA synthase; hydroxymethylglutaryl-COA syntha 99.12
2v4w_A 460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 99.11
3sqz_A 425 Putative hydroxymethylglutaryl-COA synthase; thiol 99.07
3v7i_A413 Putative polyketide synthase; type III polyketide 99.02
2p8u_A 478 Hydroxymethylglutaryl-COA synthase, cytoplasmic; h 98.88
2wya_A 460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 98.8
>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A Back     alignment and structure
Probab=100.00  E-value=3.3e-46  Score=340.67  Aligned_cols=268  Identities=38%  Similarity=0.656  Sum_probs=235.4

Q ss_pred             CCCCCCCceEEEeccccCCCCCCHHHHHHHHHcCCCcceeCCCCCCCCCCCceeeecCCCCCCCCCCchhhccCChHHHH
Q 041762           16 VAPEVKRRVVVTGLGAVTPLGDDAHLFYTKLLEGVSGISQIEGFDCSELPTRIAGEIKTLSTDGLVPPKHAKRADNYLIY   95 (287)
Q Consensus        16 ~~~~~~~~v~I~G~g~~~~~g~~~~~~~~~l~~g~~~~~~~~~~~~~~~~~~~~~~i~~~d~~~~~~~~~~~~~~~~~~l   95 (287)
                      .++..+++|+|||+|+++|+|.+.++||++|++|++++.++++|+...++.++++.+++||+..||++++.++|||+++|
T Consensus        12 ~~~~~~~~v~I~G~g~~~p~g~~~~~~w~~l~~g~~~i~~~~~~~~~~~~~~~~~~v~~fd~~~~i~~~~~~~~d~~~~l   91 (427)
T 3ho9_A           12 SACVSKRRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKDFNCEDIISRKEQRKMDAFIQY   91 (427)
T ss_dssp             -----CCCEEEEEEEEEBTTBSSHHHHHHHHHTTCCCEEECCSSCCTTCSCCEEECCSSCCCTTTSCHHHHTTSCHHHHH
T ss_pred             CCCCCCCCEEEEeeeEECCCCCCHHHHHHHHHcCCCceeeCCccccccCccceeeEcCCCChhhcCCHHHHhhCCHHHHH
Confidence            34556678999999999999999999999999999999999999988899999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHcCCCCccccccCCCeEEEEEcCcCCcHHHHHHHHHHH-----------------------------hcc
Q 041762           96 ALIAGKKALADAGITEQVSGELNKNRCGVLIGTAMGSMRALKDGIDAI-----------------------------KIS  146 (287)
Q Consensus        96 ~~~a~~~al~~agi~~~~i~~~~~~~~gv~~g~~~~~~~~~~~~~~~~-----------------------------~~~  146 (287)
                      +++++++||+|||+++.+   ++..++|+++|++.++....+.....+                             ...
T Consensus        92 ~l~aa~~AL~dAGl~~~~---i~~~~~gv~vg~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~is~~lgl~  168 (427)
T 3ho9_A           92 GIVAGVQAMQDSGLEITE---ENATRIGAAIGSGIGGLGLIEENHTSLMNGGPRKISPFFVPSTIVNMVAGHLTIMYGLR  168 (427)
T ss_dssp             HHHHHHHHHHHHTCCCCT---TTGGGEEEEEECSSCCHHHHHHHHHHHHHHCGGGSCTTHHHHHSTTHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHCCCCccc---ccccceEEEEccccccHHHHHHHHHHHHhcCccccCcceeccccchHHHHHHHHHhCCC
Confidence            999999999999999764   566899999999877665444333222                             111


Q ss_pred             CCccc----chhhHHHHHHHHHHHHcCCCCEEEEeecCCCCCHHHHHhhHhcCCCCCCCCCCCCCCcCCCCCCCcccccc
Q 041762          147 YKKMT----CATGNCCILTAANHIIEGDADMMLCGGSDGVIIPECIAGFIACNNLSRRNSDPTKASRPWDSDHDGFVMGE  222 (287)
Q Consensus       147 ~~~~~----caS~~~Al~~A~~~I~~G~~d~vlv~g~d~~~~~~~~~~~~~~~~l~~~~~~~~~~~~pf~~~~~g~~~ge  222 (287)
                      ...++    |+|++.||..|+++|++|++|++||||+|.+..+..+..|...+.++.....+...++||+.+++|+++||
T Consensus       169 Gp~~~v~taCsS~l~Al~~A~~~I~~G~~d~aLvgG~e~~~~p~~~~~~~~~~~ls~~~~~~~~~~~pfd~~~~G~v~ge  248 (427)
T 3ho9_A          169 GPSISIATAATSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTRNDNPQAASRPWDKERDGFVLGD  248 (427)
T ss_dssp             SCEECCCCGGGHHHHHHHHHHHHHHHTSCSEEEEEEEECCCSHHHHHHHHHTTCBCCCTTCHHHHCCTTBTTCCSBCBBC
T ss_pred             CCeecccchhHHHHHHHHHHHHHHHcCCCCEEEEeeecccCCHHHHHHHHhccCcccCCCCCCcccCCccCCCCCceeee
Confidence            11111    99999999999999999999999999999988999999999999998765556668999999999999999


Q ss_pred             eEEEEEecchHHHHhcCCcEeEEEEEeeecC-CCCCCCCCCChHHHHHHHHHHHHHcCCCCCCCC
Q 041762          223 GAGVMLLEELDHAKRRRANIYAEFKGGSSTY-AYHISEPRLNALGAMACMEKALTNSGVSGEIYR  286 (287)
Q Consensus       223 GaaavvL~~~~~A~~~g~~~~a~i~g~~~~~-~~~~~~~~~~~~~~~~a~~~al~~agl~~~dId  286 (287)
                      ||+++||++.++|+++|.+++++|.|++.++ +++++.|.+.+.++.++++++|+++||+|+|||
T Consensus       249 GAaavvL~~~~~A~~~g~~i~a~i~g~~~~~dg~~~~~p~~~~~~~~~ai~~al~~Agl~~~dId  313 (427)
T 3ho9_A          249 GAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPENGAGAALAMANALRDAGIEASQIG  313 (427)
T ss_dssp             EEEEEEEEEHHHHHHTTCCCCEEEEEEEEEECCSBTTBCCTTCHHHHHHHHHHHHHHTCCGGGCC
T ss_pred             eEEEEEEccHHHHHHCCCcEEEEEEEEeecCCCCCcCCCCCCHHHHHHHHHHHHHHcCCCHHHcc
Confidence            9999999999999999999999999999988 888888888899999999999999999999998
>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Back     alignment and structure
>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} Back     alignment and structure
>4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} Back     alignment and structure
>1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A Back     alignment and structure
>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* Back     alignment and structure
>2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A Back     alignment and structure
>2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* Back     alignment and structure
>2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... Back     alignment and structure
>3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* Back     alignment and structure
>2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Back     alignment and structure
>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Back     alignment and structure
>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Back     alignment and structure
>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Back     alignment and structure
>2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Back     alignment and structure
>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Back     alignment and structure
>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Back     alignment and structure
>1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Back     alignment and structure
>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Back     alignment and structure
>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Back     alignment and structure
>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Back     alignment and structure
>4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} Back     alignment and structure
>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Back     alignment and structure
>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Back     alignment and structure
>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} Back     alignment and structure
>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Back     alignment and structure
>3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A Back     alignment and structure
>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A Back     alignment and structure
>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Back     alignment and structure
>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Back     alignment and structure
>2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A* Back     alignment and structure
>3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} Back     alignment and structure
>3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A Back     alignment and structure
>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} Back     alignment and structure
>1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* Back     alignment and structure
>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} Back     alignment and structure
>1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A Back     alignment and structure
>3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A Back     alignment and structure
>3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* Back     alignment and structure
>3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A* Back     alignment and structure
>3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} Back     alignment and structure
>2p8u_A Hydroxymethylglutaryl-COA synthase, cytoplasmic; hydromethylglutaryl COA, mevalonate pathway, structural GENO structural genomics consortium, SGC; HET: COA; 2.00A {Homo sapiens} Back     alignment and structure
>2wya_A Hydroxymethylglutaryl-COA synthase, mitochondrial; steroid biosynthesis, cholesterol biosynthesis, mitochondrion, phosphoprotein; HET: HMG; 1.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 287
d1j3na1249 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II { 2e-51
d2gfva1250 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II { 2e-48
d1e5ma1250 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II { 2e-47
d2vbaa1253 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {E 2e-38
d1ox0a1256 c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II 1e-37
d2ix4a1270 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II 1e-35
d1tqya1216 c.95.1.1 (A:3-218) Actinorhodin polyketide putativ 3e-22
d1tqyb1208 c.95.1.1 (B:2-209) Actinorhodin polyketide putativ 5e-18
d1tqya2 205 c.95.1.1 (A:219-423) Actinorhodin polyketide putat 6e-15
d1tqyb2 194 c.95.1.1 (B:210-403) Actinorhodin polyketide putat 1e-14
>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Length = 249 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Thiolase-related
domain: Beta-ketoacyl-ACP synthase II
species: Thermus thermophilus [TaxId: 274]

 Score =  167 bits (423), Expect = 2e-51
 Identities = 96/252 (38%), Positives = 128/252 (50%), Gaps = 37/252 (14%)

Query: 22  RRVVVTGLGAVTPLGDDAHLFYTKLLEGVSGISQIEGFDCSELPTRIAGEIKTLSTDGLV 81
           RRVVVTGLGA+TP+G     F+   L G SG+  I  FD S LP RIA E+        +
Sbjct: 2   RRVVVTGLGALTPIGVGQEAFHKAQLAGKSGVRPITRFDASALPVRIAAEVDVDPGAY-L 60

Query: 82  PPKHAKRADNYLIYALIAGKKALADAGITEQVSGELNKNRCGVLIGTAMGSMRAL----- 136
             K  +R D ++ YALIA + AL DAG+  +   +L+  R G L+GT +G M        
Sbjct: 61  DRKELRRLDRFVQYALIAAQLALEDAGLKPE---DLDPERVGTLVGTGIGGMETWEAQSR 117

Query: 137 ---KDGIDAIKISYKKMT-------------------------CATGNCCILTAANHIIE 168
              + G + I   +  M                          CATG   + +A   I  
Sbjct: 118 VFLERGPNRISPFFIPMMIANMASAHIAMRYGFTGPSSTVVTACATGADALGSALRMIQL 177

Query: 169 GDADMMLCGGSDGVIIPECIAGFIACNNLSRRNSDPTKASRPWDSDHDGFVMGEGAGVML 228
           G+AD++L GG++  I P  I  F     LS RN +P KASRP+    DGFVMGEGAGV++
Sbjct: 178 GEADLVLAGGTEAAITPMAIGAFAVMRALSTRNEEPEKASRPFTLSRDGFVMGEGAGVLV 237

Query: 229 LEELDHAKRRRA 240
           LE  +HAK+R A
Sbjct: 238 LEAYEHAKKRGA 249
>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Length = 250 Back     information, alignment and structure
>d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Length = 250 Back     information, alignment and structure
>d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Length = 253 Back     information, alignment and structure
>d1ox0a1 c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Length = 256 Back     information, alignment and structure
>d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Length = 270 Back     information, alignment and structure
>d1tqya1 c.95.1.1 (A:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Length = 216 Back     information, alignment and structure
>d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Length = 208 Back     information, alignment and structure
>d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Length = 205 Back     information, alignment and structure
>d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Length = 194 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query287
d2gfva1250 Beta-ketoacyl-ACP synthase II {Escherichia coli [T 100.0
d1j3na1249 Beta-ketoacyl-ACP synthase II {Thermus thermophilu 100.0
d1ox0a1256 Beta-ketoacyl-ACP synthase II {Streptococcus pneum 100.0
d1e5ma1250 Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ 100.0
d2vbaa1253 Beta-ketoacyl-ACP synthase I {Escherichia coli [Ta 100.0
d2ix4a1270 Beta-ketoacyl-ACP synthase II {Thale cress (Arabid 100.0
d1tqyb1208 Actinorhodin polyketide putative beta-ketoacyl syn 99.96
d1tqya1216 Actinorhodin polyketide putative beta-ketoacyl syn 99.96
d1tqya2 205 Actinorhodin polyketide putative beta-ketoacyl syn 99.62
d1tqyb2 194 Actinorhodin polyketide putative beta-ketoacyl syn 99.52
d1teda_372 Polyketide synthase PKS18 {Mycobacterium tuberculo 99.22
d1m3ka1268 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 99.16
d1ulqa1273 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 99.15
d1mzja1181 Priming beta-ketosynthase from the r1128 polyketid 99.13
d1wdkc1262 Fatty oxidation complex beta subunit (3-ketoacyl-C 99.07
d1u6ea1184 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 99.03
d1ub7a1172 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 98.98
d1hnja1174 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 98.95
d1afwa1269 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 98.94
d1bi5a1235 Chalcone synthase {Alfalfa (Medicago sativa) [TaxI 98.94
d1u0ma1200 Putative polyketide synthase SCO1206 {Streptomyces 98.91
d1xpma1166 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Stap 98.45
d1afwa2124 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 96.8
d1wdkc2128 Fatty oxidation complex beta subunit (3-ketoacyl-C 96.51
d1ulqa2125 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 96.13
d1m3ka2124 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 96.02
>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Thiolase-related
domain: Beta-ketoacyl-ACP synthase II
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.5e-41  Score=286.95  Aligned_cols=217  Identities=41%  Similarity=0.706  Sum_probs=192.7

Q ss_pred             CCceEEEeccccCCCCCCHHHHHHHHHcCCCcceeCCCCCCCCCCCceeeecCCCCCCCCCCchhhccCChHHHHHHHHH
Q 041762           21 KRRVVVTGLGAVTPLGDDAHLFYTKLLEGVSGISQIEGFDCSELPTRIAGEIKTLSTDGLVPPKHAKRADNYLIYALIAG  100 (287)
Q Consensus        21 ~~~v~I~G~g~~~~~g~~~~~~~~~l~~g~~~~~~~~~~~~~~~~~~~~~~i~~~d~~~~~~~~~~~~~~~~~~l~~~a~  100 (287)
                      .++|+|||||+++|+|.+.++||++|.+|++++.++++|+.+.++..+++.+++|+...++++++.+++||.+++++.++
T Consensus         1 ~rrVaItG~G~vtp~G~~~~~~w~~L~~G~s~i~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~d~~~~~~l~aa   80 (250)
T d2gfva1           1 KRRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKDFNCEDIISRKEQRKMDAFIQYGIVAG   80 (250)
T ss_dssp             CCCEEEEEEEEEBTTBSSHHHHHHHHHTTCCCEEECCSSCCTTCSCCEEECCTTCCCTTTSCHHHHTTSCHHHHHHHHHH
T ss_pred             CCeEEEECCeeECCCcCCHHHHHHHHHcCCCeeecCCcccccccCCccceecccchhhhhhhhHHHhhcCHHHHHHHHHH
Confidence            36899999999999999999999999999999999999999999999999999999888899999999999999999999


Q ss_pred             HHHHHHcCCCCccccccCCCeEEEEEcCcCCcHHHHHHHHHHH------hccCCccc-----------------------
Q 041762          101 KKALADAGITEQVSGELNKNRCGVLIGTAMGSMRALKDGIDAI------KISYKKMT-----------------------  151 (287)
Q Consensus       101 ~~al~~agi~~~~i~~~~~~~~gv~~g~~~~~~~~~~~~~~~~------~~~~~~~~-----------------------  151 (287)
                      .+||+++|++..   +++..++|+++|++.+.....+.....+      ...+..+.                       
T Consensus        81 ~~Al~dAg~~~~---~~~~~~~gv~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~ia~~~gl~Gp~~t  157 (250)
T d2gfva1          81 VQAMQDSGLEIT---EENATRIGAAIGSGIGGLGLIEENHTSLMNGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSIS  157 (250)
T ss_dssp             HHHHHHHTCCCC---TTTGGGEEEEEECSSCCHHHHHHHHHHHHHHCGGGSCTTHHHHHSTTHHHHHHHHHTTCCSCEEC
T ss_pred             HHHHHhcCCCcc---ccCccceEEEEeeccCCcchhhhhHHHHhhccccccccchhhhhhhhHHHHHHHHHhCCCCCccc
Confidence            999999999864   4567899999999888776655544333      11111000                       


Q ss_pred             ----chhhHHHHHHHHHHHHcCCCCEEEEeecCCCCCHHHHHhhHhcCCCCCCCCCCCCCCcCCCCCCCcccccceEEEE
Q 041762          152 ----CATGNCCILTAANHIIEGDADMMLCGGSDGVIIPECIAGFIACNNLSRRNSDPTKASRPWDSDHDGFVMGEGAGVM  227 (287)
Q Consensus       152 ----caS~~~Al~~A~~~I~~G~~d~vlv~g~d~~~~~~~~~~~~~~~~l~~~~~~~~~~~~pf~~~~~g~~~geGaaav  227 (287)
                          |+|++.||.+|+++|++|++|++||||+|...+|..+..|..++.++..+.+|...++|||.+++|+++|||++++
T Consensus       158 v~~aCaSg~~Ai~~A~~~i~~G~~d~~lvgg~d~~~~~~~~~~f~~~~~ls~~~~~p~~~~rPFD~~rdG~v~gEGaa~l  237 (250)
T d2gfva1         158 IATAQTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTRNDNPQAASRPWDKERDGFVLGDGAGML  237 (250)
T ss_dssp             CCCGGGHHHHHHHHHHHHHHHTSCSEEEEEEEECCCSHHHHHHHHHTTCBCCCTTCHHHHCCTTBTTCCSBCBBCEEEEE
T ss_pred             cccccchhhhhhHHHHHHHHcCCcchhhcccchhhcCcHHHHHHHhcccccCCCCCCCCccCCCCCCCCCEeeeeEEEEE
Confidence                9999999999999999999999999999998999999999999999976666677899999999999999999999


Q ss_pred             EecchHHHHhcCC
Q 041762          228 LLEELDHAKRRRA  240 (287)
Q Consensus       228 vL~~~~~A~~~g~  240 (287)
                      |||++++|++||+
T Consensus       238 VLE~~~~A~~rGA  250 (250)
T d2gfva1         238 VLEEYEHAKKRGA  250 (250)
T ss_dssp             EEEEHHHHHHHTC
T ss_pred             EECcHHHHHHCcC
Confidence            9999999999984
>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Back     information, alignment and structure
>d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1tqya1 c.95.1.1 (A:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mzja1 c.95.1.2 (A:3-183) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hnja1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1xpma1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ulqa2 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure