Citrus Sinensis ID: 041764


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MTSQFFLMLLVLTSTSFVFMLFIKLQEKTRVLAKRLPPGPWKLPVLGNLHQLNGDSPHVSLQHLSNDYGPLMFLQLGSVPTLVISSADVAREIFRTHDLIFSGRPRSYAAKKAVRKIVIMEILSSKRVQSFQAVRYEEVMLVLQFIAQSSTKPIDLSRLTLLLSNNIVCRVAFGQ
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccEEEEccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEcccEcHHHcccccHHHHHHHHHHHHccEEEEEEccEEEEEEccHHHHHHHHccccccccEEcHHHHHHHHHHHHHHHHHHcHHHHHccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcc
MTSQFFLMLLVLTSTSFVFMLFIKLQEKTRVLakrlppgpwklpvlgnlhqlngdsphvslqhlsndygplmflqlgsvptlvISSADVAREIFRThdlifsgrprsyaAKKAVRKIVIMEILSSKRVQSFQAVRYEEVMLVLQFIAqsstkpidlsrLTLLLSNNIVCRVAFGQ
MTSQFFLMLLVLTSTSFVFMLFIKLQEKTRVLAKRLPPGPWKLPVLGNLHQLNGDSPHVSLQHLSNDYGPLMFLQLGSVPTLVISSADVAREIFRThdlifsgrprsyaaKKAVRKIVIMEILSSKRVQSFQAVRYEEVMLVLQFIAQSSTKPIDLSRLTLLLSNNIVCRVAFGQ
MTSQFFLMLLVLTSTSFVFMLFIKLQEKTRVLAKRLPPGPWKLPVLGNLHQLNGDSPHVSLQHLSNDYGPLMFLQLGSVPTLVISSADVAREIFRTHDLIFSGRPRSYAAKKAVRKIVIMEILSSKRVQSFQAVRYEEVMLVLQFIAQSSTKPIDLSRLTLLLSNNIVCRVAFGQ
****FFLMLLVLTSTSFVFMLFIKLQEKTRVLAKRLPPGPWKLPVLGNLHQLNGDSPHVSLQHLSNDYGPLMFLQLGSVPTLVISSADVAREIFRTHDLIFSGRPRSYAAKKAVRKIVIMEILSSKRVQSFQAVRYEEVMLVLQFIAQSSTKPIDLSRLTLLLSNNIVCRVAF**
**SQFFLMLLVLTSTSFVFMLF*******************KLPVLGNLHQLNGDSPHVSLQHLSNDYGPLMFLQLGSVPTLVISSADVAREIFRTHDLIFSGRPRSYAAKKAVRKIVIMEILSSKRVQSFQAVRYEEVMLVLQFIAQSSTKPIDLSRLTLLLSNNIVCRVAFGQ
MTSQFFLMLLVLTSTSFVFMLFIKLQEKTRVLAKRLPPGPWKLPVLGNLHQLNGDSPHVSLQHLSNDYGPLMFLQLGSVPTLVISSADVAREIFRTHDLIFSGRPRSYAAKKAVRKIVIMEILSSKRVQSFQAVRYEEVMLVLQFIAQSSTKPIDLSRLTLLLSNNIVCRVAFGQ
*TSQFFLMLLVLTSTSFVFMLFIKLQEKTRVLAKRLPPGPWKLPVLGNLHQLNGDSPHVSLQHLSNDYGPLMFLQLGSVPTLVISSADVAREIFRTHDLIFSGRPRSYAAKKAVRKIVIMEILSSKRVQSFQAVRYEEVMLVLQFIAQSSTKPIDLSRLTLLLSNNIVCRVAFGQ
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSQFFLMLLVLTSTSFVFMLFIKLQEKTRVLAKRLPPGPWKLPVLGNLHQLNGDSPHVSLQHLSNDYGPLMFLQLGSVPTLVISSADVAREIFRTHDLIFSGRPRSYAAKKAVRKIVIMEILSSKRVQSFQAVRYEEVMLVLQFIAQSSTKPIDLSRLTLLLSNNIVCRVAFGQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query175 2.2.26 [Sep-21-2011]
O81970 499 Cytochrome P450 71A9 OS=G yes no 0.857 0.300 0.573 2e-45
C0SJS2 473 Psoralen synthase (Fragme N/A no 0.92 0.340 0.436 1e-35
C0SJS4 476 Psoralen synthase (Fragme N/A no 0.925 0.340 0.436 8e-34
Q6QNI4 494 Psoralen synthase OS=Ammi N/A no 0.8 0.283 0.446 1e-32
Q9STK8 490 Cytochrome P450 71A25 OS= yes no 0.948 0.338 0.401 7e-32
A6YIH8 502 Premnaspirodiene oxygenas N/A no 0.817 0.284 0.378 7e-32
Q9STL0 483 Cytochrome P450 71A23 OS= no no 0.782 0.283 0.423 3e-31
C0SJS3 478 Angelicin synthase (Fragm N/A no 0.92 0.336 0.398 5e-31
Q9ZU07 496 Cytochrome P450 71B12 OS= no no 0.885 0.312 0.406 5e-31
Q9STL2 490 Cytochrome P450 71A21 OS= no no 0.942 0.336 0.392 1e-30
>sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 Back     alignment and function desciption
 Score =  181 bits (460), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 123/169 (72%), Gaps = 19/169 (11%)

Query: 24  KLQEKTRVLAKRLPPGPWKLPVLGNLHQLNGDSPHVSLQHLSNDYGPLMFLQLGSVPTLV 83
           +L++ T    + LPPGP KLP +GNLHQL G  PH SLQ+LSN +GPLMFLQLGS+PTLV
Sbjct: 21  QLRKPTAEKRRLLPPGPRKLPFIGNLHQL-GTLPHQSLQYLSNKHGPLMFLQLGSIPTLV 79

Query: 84  ISSADVAREIFRTHDLIFSGRPRSYAAK-----------------KAVRKIVIMEILSSK 126
           +SSA++AREIF+ HD +FSGRP  YAA                  + +RKI+I+E+LS K
Sbjct: 80  VSSAEMAREIFKNHDSVFSGRPSLYAANRLGYGSTVSFAPYGEYWREMRKIMILELLSPK 139

Query: 127 RVQSFQAVRYEEVMLVLQFIAQSSTKPIDLSRLTLLLSNNIVCRVAFGQ 175
           RVQSF+AVR+EEV L+LQ IA S   P++LS LTL L+NNIVCR+A G+
Sbjct: 140 RVQSFEAVRFEEVKLLLQTIALSHG-PVNLSELTLSLTNNIVCRIALGK 187





Glycine max (taxid: 3847)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 Back     alignment and function description
>sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 Back     alignment and function description
>sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 Back     alignment and function description
>sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 Back     alignment and function description
>sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 Back     alignment and function description
>sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 Back     alignment and function description
>sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 Back     alignment and function description
>sp|Q9STL2|C71AL_ARATH Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
85068670 494 CYP71AH2 [Nicotiana tabacum] 0.931 0.329 0.518 6e-47
359491181 952 PREDICTED: uncharacterized protein LOC10 0.828 0.152 0.6 2e-46
358248834 499 cytochrome P450 71A9 precursor [Glycine 0.857 0.300 0.573 7e-44
255639761 499 unknown [Glycine max] 0.857 0.300 0.573 8e-44
291277949252 cytochrome P450 [Nicotiana tabacum] 0.96 0.666 0.502 8e-44
252972605 500 cytochrome P450 [Nicotiana tabacum] gi|2 0.96 0.336 0.502 2e-43
421999456 507 putative cytochrome P450 monooxygenase [ 0.937 0.323 0.510 1e-40
357461733270 Cytochrome P450, partial [Medicago trunc 0.942 0.611 0.423 5e-35
359491185 507 PREDICTED: cytochrome P450 71A1-like [Vi 0.794 0.274 0.481 1e-34
224155022252 predicted protein [Populus trichocarpa] 0.942 0.654 0.432 2e-34
>gi|85068670|gb|ABC69415.1| CYP71AH2 [Nicotiana tabacum] Back     alignment and taxonomy information
 Score =  192 bits (487), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 97/187 (51%), Positives = 134/187 (71%), Gaps = 24/187 (12%)

Query: 7   LMLLVLTSTSFVFMLFIKLQEKTRVLAKRLPPGPWKLPVLGNLHQLNGDSPHVSLQHLSN 66
           +  LV+ ++ F+F+  +++ +     AK+LPPGP KLP++GNLHQ+ G  PH SLQ LSN
Sbjct: 1   MNFLVVLASLFLFVFLMRISK-----AKKLPPGPRKLPIIGNLHQI-GKLPHRSLQKLSN 54

Query: 67  DYGPLMFLQLGSVPTLVISSADVAREIFRTHDLIFSGRPRSYAAKK-------------- 112
           +YG  +FLQLGSVPT+V+SSAD+AREIFRTHDL+FSGRP  YAA+K              
Sbjct: 55  EYGDFIFLQLGSVPTVVVSSADIAREIFRTHDLVFSGRPALYAARKLSYNCYNVSFAPYG 114

Query: 113 ----AVRKIVIMEILSSKRVQSFQAVRYEEVMLVLQFIAQSSTKPIDLSRLTLLLSNNIV 168
                 RKI+++E+LS+KRVQSF+A+R EEV  ++Q I  S + P+++S L L L+NN+V
Sbjct: 115 NYWREARKILVLELLSTKRVQSFEAIRDEEVSSLVQIICSSLSSPVNISTLALSLANNVV 174

Query: 169 CRVAFGQ 175
           CRVAFG+
Sbjct: 175 CRVAFGK 181




Source: Nicotiana tabacum

Species: Nicotiana tabacum

Genus: Nicotiana

Family: Solanaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359491181|ref|XP_003634235.1| PREDICTED: uncharacterized protein LOC100248387 [Vitis vinifera] Back     alignment and taxonomy information
>gi|358248834|ref|NP_001239692.1| cytochrome P450 71A9 precursor [Glycine max] gi|5915816|sp|O81970.1|C71A9_SOYBN RecName: Full=Cytochrome P450 71A9; AltName: Full=Cytochrome P450 CP1 gi|3334659|emb|CAA71513.1| putative cytochrome P450 [Glycine max] Back     alignment and taxonomy information
>gi|255639761|gb|ACU20174.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|291277949|gb|ADD91442.1| cytochrome P450 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|252972605|dbj|BAH84782.1| cytochrome P450 [Nicotiana tabacum] gi|291277951|gb|ADD91443.1| cytochrome P450 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|421999456|emb|CCO62222.1| putative cytochrome P450 monooxygenase [Actaea racemosa] Back     alignment and taxonomy information
>gi|357461733|ref|XP_003601148.1| Cytochrome P450, partial [Medicago truncatula] gi|355490196|gb|AES71399.1| Cytochrome P450, partial [Medicago truncatula] Back     alignment and taxonomy information
>gi|359491185|ref|XP_002276558.2| PREDICTED: cytochrome P450 71A1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224155022|ref|XP_002337551.1| predicted protein [Populus trichocarpa] gi|222839555|gb|EEE77892.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
TAIR|locus:504955634 483 CYP71A23 ""cytochrome P450, fa 0.594 0.215 0.446 1.8e-31
TAIR|locus:2142055 490 CYP71A19 ""cytochrome P450, fa 0.617 0.220 0.436 4.4e-30
TAIR|locus:504955639 489 CYP71A26 ""cytochrome P450, fa 0.594 0.212 0.471 5e-30
TAIR|locus:504955640 490 CYP71A22 ""cytochrome P450, fa 0.588 0.210 0.481 9e-30
TAIR|locus:2179270 496 CYP71B11 ""ytochrome p450, fam 0.542 0.191 0.463 1.8e-29
TAIR|locus:2031900 502 CYP71B2 ""cytochrome P450, fam 0.571 0.199 0.444 4.3e-29
TAIR|locus:2149373 496 CYP71A15 ""cytochrome P450, fa 0.56 0.197 0.48 5.2e-29
TAIR|locus:2179290 496 CYP71B13 ""cytochrome P450, fa 0.462 0.163 0.475 3.4e-28
TAIR|locus:2093516 502 CYP71B20 ""cytochrome P450, fa 0.542 0.189 0.485 3.1e-27
TAIR|locus:2093511 502 CYP71B19 ""cytochrome P450, fa 0.542 0.189 0.465 5.3e-27
TAIR|locus:504955634 CYP71A23 ""cytochrome P450, family 71, subfamily A, polypeptide 23"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 222 (83.2 bits), Expect = 1.8e-31, Sum P(2) = 1.8e-31
 Identities = 50/112 (44%), Positives = 73/112 (65%)

Query:     6 FLMLLVLTSTSFVFMLFIKLQEKTRVLAKRLP-PGPWKLPVLGNLHQLNGDSPHVSLQHL 64
             FL L++L     + +LF K   K + + K +  P P +LP++GNLHQL+   PH SL +L
Sbjct:     4 FLCLIILF---IITILFFK---KHKTVNKIINFPSPPRLPLIGNLHQLS-QHPHRSLCYL 56

Query:    65 SNDYGPLMFLQLGSVPTLVISSADVAREIFRTHDLIFSGRPRSYAAKKAVRK 116
             S+ YGPLM L  GSVP +V S+A+ AR++ +THD +F+ RPRS   +K + K
Sbjct:    57 SHRYGPLMLLHFGSVPVIVASTAEAARDVLKTHDRVFASRPRSKIFEKLLYK 108


GO:0005506 "iron ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2142055 CYP71A19 ""cytochrome P450, family 71, subfamily A, polypeptide 19"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955639 CYP71A26 ""cytochrome P450, family 71, subfamily A, polypeptide 26"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955640 CYP71A22 ""cytochrome P450, family 71, subfamily A, polypeptide 22"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179270 CYP71B11 ""ytochrome p450, family 71, subfamily B, polypeptide 11"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031900 CYP71B2 ""cytochrome P450, family 71, subfamily B, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149373 CYP71A15 ""cytochrome P450, family 71, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179290 CYP71B13 ""cytochrome P450, family 71, subfamily B, polypeptide 13"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093516 CYP71B20 ""cytochrome P450, family 71, subfamily B, polypeptide 20"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093511 CYP71B19 ""cytochrome P450, family 71, subfamily B, polypeptide 19"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 2e-32
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 3e-27
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 1e-26
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 2e-26
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 1e-22
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 8e-19
pfam00067 461 pfam00067, p450, Cytochrome P450 3e-16
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 6e-15
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 6e-12
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 2e-11
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 6e-11
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 7e-10
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 6e-08
PLN02196 463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 2e-04
PLN02987 472 PLN02987, PLN02987, Cytochrome P450, family 90, su 0.002
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
 Score =  120 bits (303), Expect = 2e-32
 Identities = 62/189 (32%), Positives = 96/189 (50%), Gaps = 22/189 (11%)

Query: 8   MLLVLTSTSFVFMLFIKLQEKTRVL-AKRLPPGPWKLPVLGNLHQLNGDSPHVSLQHLSN 66
            LL L  +  +F + I       +  + RLPPGP + P++GNL QL G  PH  L  L  
Sbjct: 4   FLLSLLFSVLIFNVLIWRWLNASMRKSLRLPPGPPRWPIVGNLLQL-GPLPHRDLASLCK 62

Query: 67  DYGPLMFLQLGSVPTLVISSADVAREIFRTHDLIFSGRPRSYAAK--------------- 111
            YGPL++L+LGSV  +     ++ REI    D +F+ RPR+ AA                
Sbjct: 63  KYGPLVYLRLGSVDAITTDDPELIREILLRQDDVFASRPRTLAAVHLAYGCGDVALAPLG 122

Query: 112 ---KAVRKIVIMEILSSKRVQSFQAVRYEEVMLVLQFI--AQSSTKPIDLSRLTLLLSNN 166
              K +R+I +  +L++KR++SF   R EE   ++Q +  A  + KP++L  +    S N
Sbjct: 123 PHWKRMRRICMEHLLTTKRLESFAKHRAEEARHLIQDVWEAAQTGKPVNLREVLGAFSMN 182

Query: 167 IVCRVAFGQ 175
            V R+  G+
Sbjct: 183 NVTRMLLGK 191


Length = 514

>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 175
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.95
PLN03234 499 cytochrome P450 83B1; Provisional 99.94
PLN02687 517 flavonoid 3'-monooxygenase 99.94
PLN03112 514 cytochrome P450 family protein; Provisional 99.93
PTZ00404 482 cytochrome P450; Provisional 99.93
PLN02183 516 ferulate 5-hydroxylase 99.93
PLN02966 502 cytochrome P450 83A1 99.92
PLN02971 543 tryptophan N-hydroxylase 99.92
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.91
PLN00168 519 Cytochrome P450; Provisional 99.91
PLN02394 503 trans-cinnamate 4-monooxygenase 99.91
PLN02196 463 abscisic acid 8'-hydroxylase 99.91
PLN02290 516 cytokinin trans-hydroxylase 99.9
PLN02500 490 cytochrome P450 90B1 99.9
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.9
PLN02655 466 ent-kaurene oxidase 99.89
PLN02774 463 brassinosteroid-6-oxidase 99.88
PLN02302 490 ent-kaurenoic acid oxidase 99.87
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.87
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.86
PLN03018 534 homomethionine N-hydroxylase 99.85
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.85
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.84
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.82
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.79
PLN02936 489 epsilon-ring hydroxylase 99.79
PLN02738 633 carotene beta-ring hydroxylase 99.78
PLN02648 480 allene oxide synthase 99.78
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.65
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.65
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.56
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 98.91
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=99.95  E-value=7.5e-27  Score=176.41  Aligned_cols=141  Identities=45%  Similarity=0.770  Sum_probs=127.0

Q ss_pred             CCCCCCCCCCCccccccccCCCC-CcHHHHHHHHhhCCeEEEecCCccEEEeccHHHHHHHHHhcCcccccCCCc-hhHH
Q 041764           34 KRLPPGPWKLPVLGNLHQLNGDS-PHVSLQHLSNDYGPLMFLQLGSVPTLVISSADVAREIFRTHDLIFSGRPRS-YAAK  111 (175)
Q Consensus        34 ~~~~pgp~~~p~~G~~~~~~~~~-~~~~~~~~~~~yg~i~~~~~~~~~~v~i~~p~~~~~il~~~~~~~~~~~~~-~~~~  111 (175)
                      .+.||||+++|++||++++ ... ++..+.++.++|||++.+++|..|.|++++++.++|++++++..|++||.. ....
T Consensus        25 ~~lPPGP~~lPiIGnl~~l-~~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~~~  103 (489)
T KOG0156|consen   25 RNLPPGPPPLPIIGNLHQL-GSLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTATLK  103 (489)
T ss_pred             CCCCcCCCCCCccccHHHc-CCCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchhhHH
Confidence            7899999999999999999 554 999999999999999999999999999999999999999999999999972 2212


Q ss_pred             H------------------HhHhHHHhhccChhHHhhHHHHHHHHHHHHHHHHHhc-CCCCcchHHHHHHHHHHHHHHHh
Q 041764          112 K------------------AVRKIVIMEILSSKRVQSFQAVRYEEVMLVLQFIAQS-STKPIDLSRLTLLLSNNIVCRVA  172 (175)
Q Consensus       112 ~------------------~~Rr~~~~~~f~~~~l~~~~~~~~~~~~~~~~~~~~~-~~~~~d~~~~~~~~~~~~i~~~~  172 (175)
                      .                  .+||..+..+|+.+.++.....-.++++.+++.+.+. .++++|+.+.+..++.++|++++
T Consensus       104 ~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~~~~~~~vdl~~~l~~~~~nvI~~~~  183 (489)
T KOG0156|consen  104 YLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSKSKKGEPVDLSELLDLLVGNVICRML  183 (489)
T ss_pred             HhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHhcCCCceeeHHHHHHHHHHHHHHHHH
Confidence            1                  8899998999999999998888899999999999862 22789999999999999999999


Q ss_pred             cCC
Q 041764          173 FGQ  175 (175)
Q Consensus       173 fG~  175 (175)
                      ||+
T Consensus       184 fG~  186 (489)
T KOG0156|consen  184 FGR  186 (489)
T ss_pred             hCC
Confidence            996



>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 1e-10
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 3e-09
2q6n_A 478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 4e-09
4h1n_A 479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 4e-09
3tk3_A 476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 4e-09
1suo_A 476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 5e-09
1po5_A 476 Structure Of Mammalian Cytochrome P450 2b4 Length = 5e-09
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-08
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-08
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 3e-08
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 3e-08
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 3e-08
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 5e-08
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 8e-08
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 1e-07
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 1e-07
1pq2_A 476 Crystal Structure Of Human Drug Metabolizing Cytoch 2e-07
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 4e-07
3e4e_A 476 Human Cytochrome P450 2e1 In Complex With The Inhib 4e-06
3pm0_A 507 Structural Characterization Of The Complex Between 2e-05
3czh_A 481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 5e-04
3c6g_A 479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 6e-04
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure

Iteration: 1

Score = 62.4 bits (150), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 1/85 (1%) Query: 25 LQEKTRVLAKRLPPGPWKLPVLGNLHQLNGDSPHVSLQHLSNDYGPLMFLQLGSVPTLVI 84 + +KT + PPGPW P++G++ L G +PH++L +S YG ++ +++GS P +V+ Sbjct: 1 MAKKTSSKGLKNPPGPWGWPLIGHMLTL-GKNPHLALSRMSQQYGDVLQIRIGSTPVVVL 59 Query: 85 SSADVAREIFRTHDLIFSGRPRSYA 109 S D R+ F GRP Y Sbjct: 60 SGLDTIRQALVRQGDDFKGRPDLYT 84
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 4e-37
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 4e-33
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-31
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-30
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 1e-24
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 1e-24
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 1e-24
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-24
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 2e-24
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 5e-24
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 5e-24
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 1e-23
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-23
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 2e-22
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-22
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 9e-19
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 5e-18
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 9e-15
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-14
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 1e-13
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 3e-13
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 5e-11
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 7e-11
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-09
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 1e-05
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 4e-05
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score =  132 bits (334), Expect = 4e-37
 Identities = 23/167 (13%), Positives = 49/167 (29%), Gaps = 28/167 (16%)

Query: 36  LPPGPWKLPVLGNLHQLNGDS---PHVSLQHLSNDYGPLMFLQLGSVPTLVISSADVARE 92
             P P     L   H          H+        YGP+   +LG+V ++ +   +    
Sbjct: 10  EIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVAL 69

Query: 93  IFRTHDLIFSGRP-------RSYAAK------------KAVRKIVIMEILSSKRVQSFQA 133
           +F++                  Y  +            K  R  +  E+++ +  ++F  
Sbjct: 70  LFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLP 129

Query: 134 VRYEEVMLVLQFIAQ------SSTKPIDLSRLTLLLSNNIVCRVAFG 174
           +        +  + +      S     D+S      +   +  V FG
Sbjct: 130 LLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFG 176


>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.93
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.91
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.91
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.91
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.9
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.9
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.9
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.9
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.9
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.89
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.88
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.88
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.88
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.87
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.87
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.87
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.85
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.85
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.85
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.85
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.83
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.81
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.81
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.78
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.77
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.74
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.74
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.72
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.72
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.72
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.71
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.71
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.7
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.64
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.62
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.6
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.59
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.57
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.57
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.56
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.55
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.54
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.54
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.54
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.49
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.49
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.48
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.48
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.48
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.47
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.46
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.46
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.46
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.45
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.45
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.45
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.44
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.41
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.41
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.39
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.36
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.35
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.33
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.3
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.3
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.3
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.28
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.26
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.26
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.23
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.18
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.09
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.07
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.06
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 98.98
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 98.58
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 98.09
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
Probab=99.93  E-value=2.7e-25  Score=168.42  Aligned_cols=144  Identities=18%  Similarity=0.292  Sum_probs=122.4

Q ss_pred             ccccCCCCCCCCCCCccccccccCCCCCcHHHHHHHHhhCCeEEEecCCccEEEeccHHHHHHHHHhc-CcccccCCCch
Q 041764           30 RVLAKRLPPGPWKLPVLGNLHQLNGDSPHVSLQHLSNDYGPLMFLQLGSVPTLVISSADVAREIFRTH-DLIFSGRPRSY  108 (175)
Q Consensus        30 ~~~~~~~~pgp~~~p~~G~~~~~~~~~~~~~~~~~~~~yg~i~~~~~~~~~~v~i~~p~~~~~il~~~-~~~~~~~~~~~  108 (175)
                      .+.+++.+|||+++|++||+..+ ..+++.++.+++++||+++++++|+.+.++++||+++++++.++ ...|.+++...
T Consensus         9 ~~~k~~~~PGP~~~PliGn~~~~-~~~~~~~~~~~~~~yG~i~~~~~g~~~~vvv~dp~~i~~il~~~~~~~f~~r~~~~   87 (485)
T 3nxu_A            9 GLFKKLGIPGPTPLPFLGNILSY-HKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFG   87 (485)
T ss_dssp             THHHHHTCCCCCCBTTTBTGGGG-GGCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCCCCCCS
T ss_pred             hHHhhCCCCCCCCcCeecCcHHh-hcChHHHHHHHHHHcCCeEEEEeCCCCEEEECCHHHHHHHHhccchhhccCCcccc
Confidence            34455679999999999999998 67788899999999999999999999999999999999999877 45565543221


Q ss_pred             hH----H------H----HhHhHHHhhccChhHHhhHHHHHHHHHHHHHHHHHhc--CCCCcchHHHHHHHHHHHHHHHh
Q 041764          109 AA----K------K----AVRKIVIMEILSSKRVQSFQAVRYEEVMLVLQFIAQS--STKPIDLSRLTLLLSNNIVCRVA  172 (175)
Q Consensus       109 ~~----~------~----~~Rr~~~~~~f~~~~l~~~~~~~~~~~~~~~~~~~~~--~~~~~d~~~~~~~~~~~~i~~~~  172 (175)
                      ..    .      .    ++||.+ ++.|+.++++.+.+.+.++++.+++.+.+.  +++++|+.+++..+++|+++.++
T Consensus        88 ~~~~~~~~l~~~~g~~w~~~R~~~-~~~fs~~~l~~~~~~i~~~~~~l~~~l~~~~~~g~~~d~~~~~~~~~~dvi~~~~  166 (485)
T 3nxu_A           88 PVGFMKSAISIAEDEEWKRLRSLL-SPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTS  166 (485)
T ss_dssp             CCGGGGGSTTTCCHHHHHHHHHHH-GGGGCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCEEHHHHHHHHHHHHHHHHH
T ss_pred             cccccccCccccCCcHHHHHHhhc-ChhcCHHHHHHHHHHHHHHHHHHHHHHHHHhccCCcCcHHHHHHHHHHHHHHHHH
Confidence            10    0      0    778888 999999999999999999999999999753  46789999999999999999999


Q ss_pred             cCC
Q 041764          173 FGQ  175 (175)
Q Consensus       173 fG~  175 (175)
                      ||.
T Consensus       167 fG~  169 (485)
T 3nxu_A          167 FGV  169 (485)
T ss_dssp             HSC
T ss_pred             cCC
Confidence            994



>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 175
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 5e-31
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 3e-30
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 3e-29
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 9e-24
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-23
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 1e-20
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 8e-14
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 6e-13
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 6e-10
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  114 bits (285), Expect = 5e-31
 Identities = 39/158 (24%), Positives = 69/158 (43%), Gaps = 17/158 (10%)

Query: 35  RLPPGPWKLPVLGNLHQLNGDSPHVSLQHLSNDYGPLMFLQLGSVPTLVISSADVAREIF 94
           +LPPGP  LPV+GN+ Q+       SL +LS  YGP+  L  G  P +V+   +  +E  
Sbjct: 3   KLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEAL 62

Query: 95  RTHDLIFSGRPRSYAAK----------------KAVRKIVIMEILSSKRVQ-SFQAVRYE 137
                 FSGR     A+                K +R+  +M + +    + S +    E
Sbjct: 63  IDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQE 122

Query: 138 EVMLVLQFIAQSSTKPIDLSRLTLLLSNNIVCRVAFGQ 175
           E   +++ + ++   P D + +      N++C + F +
Sbjct: 123 EARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFHK 160


>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.92
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.91
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.89
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.87
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.86
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.84
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.7
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.68
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.53
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.41
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.33
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.23
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.23
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.14
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.03
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 98.97
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 98.92
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 98.87
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 98.83
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 98.65
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 98.15
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 80.31
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome P450 bm-3
species: Bacillus megaterium [TaxId: 1404]
Probab=99.92  E-value=1.8e-24  Score=160.92  Aligned_cols=140  Identities=16%  Similarity=0.199  Sum_probs=118.8

Q ss_pred             CCCCCCCCCCccccccccCCCCCcHHHHHHHHhhCCeEEEecCCccEEEeccHHHHHHHHHhcCcccccCCCchhHH---
Q 041764           35 RLPPGPWKLPVLGNLHQLNGDSPHVSLQHLSNDYGPLMFLQLGSVPTLVISSADVAREIFRTHDLIFSGRPRSYAAK---  111 (175)
Q Consensus        35 ~~~pgp~~~p~~G~~~~~~~~~~~~~~~~~~~~yg~i~~~~~~~~~~v~i~~p~~~~~il~~~~~~~~~~~~~~~~~---  111 (175)
                      +.+|||+++|++||+..+...+++.++.+++++|||||++++++.+.++++||+++++++.++...+..+.......   
T Consensus         1 r~iPGP~~~p~lG~l~~l~~~~~~~~~~~~~~kyG~if~~~~~~~~~vvl~~~~~i~~v~~~~~~~~~~~~~~~~~~~~~   80 (453)
T d2ij2a1           1 KEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFA   80 (453)
T ss_dssp             CCCCCCCCCGGGTTGGGGCSSCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHTCTTTEEECCCHHHHHHHHHH
T ss_pred             CCCccCCCcchhhCHHHhCCCCHHHHHHHHHHHhCCEEEEEeCCceEEEECCHHHHHHHHhcCCcccccccHhHHHHHhc
Confidence            35799999999999998856678999999999999999999999999999999999999976665444322111100   


Q ss_pred             ------------H--HhHhHHHhhccChhHHhhHHHHHHHHHHHHHHHHHhc-CCCCcchHHHHHHHHHHHHHHHhcCC
Q 041764          112 ------------K--AVRKIVIMEILSSKRVQSFQAVRYEEVMLVLQFIAQS-STKPIDLSRLTLLLSNNIVCRVAFGQ  175 (175)
Q Consensus       112 ------------~--~~Rr~~~~~~f~~~~l~~~~~~~~~~~~~~~~~~~~~-~~~~~d~~~~~~~~~~~~i~~~~fG~  175 (175)
                                  .  ++|+.+ .+.|+.++++.+.+.+.++++++++.|.+. +++++|+.+++..+++|++++++||.
T Consensus        81 g~~~~~~~~~g~~wk~~Rk~l-~~~fs~~~l~~~~~~i~~~~~~li~~l~~~~~~~~idl~~~~~~~~~~~i~~~~fG~  158 (453)
T d2ij2a1          81 GDGLFTSWTHEKNWKKAHNIL-LPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNY  158 (453)
T ss_dssp             TTSGGGSCTTSHHHHHHHHHH-GGGGSTTTHHHHHHHHHHHHHHHHHHHHTCCTTCCEEHHHHHHHHHHHHHHHHHHSC
T ss_pred             CCcEEecCCChHHHHHHHHHH-HHHhhhhhhhhhhhhHHHHHHHHHHHhhhcCCCCccchHHHHHHHhhhcchhccccc
Confidence                        0  567777 999999999999999999999999999864 46789999999999999999999984



>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure