Citrus Sinensis ID: 041900

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
KDLASQGKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTISFVGMGDIVTKESFEWLFSNPRSVRASSAVNRLMNDIMSHK
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHcccccccHHHHHHcccccHHHHHHHHHHHHHccccccc
HHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcHHHcHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHHHcccc
kdlasqgkLYRLHYAKEAMKNLVKHYLFEAKwchqnyvptVDEYMAVALVTsacpilstisfvgmgdivtKESFEWLFsnprsvraSSAVNRLMNDIMSHK
kdlasqgklYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTISFVGMGDIVTKESFEWLFsnprsvrassavnrlmndimshk
KDLASQGKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTISFVGMGDIVTKESFEWLFSNPRSVRASSAVNRLMNDIMSHK
*******KLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTISFVGMGDIVTKESFEWLFSN*********************
******GKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTISFVGMGDIVTKESFEWLFSNPRSVRASSAVNRLMNDIMSHK
KDLASQGKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTISFVGMGDIVTKESFEWLFSNPRSVRASSAVNRLMNDIMSHK
****SQGKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTISFVGMGDIVTKESFEWLFSNPRSVRASSAVNRLMNDIMS**
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KDLASQGKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTISFVGMGDIVTKESFEWLFSNPRSVRASSAVNRLMNDIMSHK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query101 2.2.26 [Sep-21-2011]
F6M8H7562 Probable sesquiterpene sy N/A no 1.0 0.179 0.584 2e-32
F6M8H4559 Probable sesquiterpene sy N/A no 1.0 0.180 0.574 6e-32
F6M8H5562 Probable sesquiterpene sy N/A no 0.990 0.177 0.59 8e-32
B5A435559 Sesquiterpene synthase OS N/A no 1.0 0.180 0.584 8e-32
E3W207559 Sesquiterpene synthase OS N/A no 1.0 0.180 0.574 1e-31
E3W208562 Sesquiterpene synthase OS N/A no 1.0 0.179 0.554 6e-31
F6M8H6562 Probable sesquiterpene sy N/A no 1.0 0.179 0.554 2e-30
Q6Q3H3557 (-)-germacrene D synthase no no 1.0 0.181 0.603 3e-30
Q6Q3H2556 Valencene synthase OS=Vit no no 0.940 0.170 0.547 3e-26
Q43714555 (+)-delta-cadinene syntha N/A no 0.980 0.178 0.505 3e-25
>sp|F6M8H7|SMST_SANMU Probable sesquiterpene synthase OS=Santalum murrayanum GN=STPS PE=3 SV=1 Back     alignment and function desciption
 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 82/101 (81%)

Query: 1   KDLASQGKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTI 60
           +++A+QG L+R+HYAKE MK +V+ Y+ EAKWCH+ YVPT  EYM+VALVTS    L+TI
Sbjct: 365 EEMANQGSLFRMHYAKEVMKTIVEGYMDEAKWCHEKYVPTFQEYMSVALVTSGYTFLTTI 424

Query: 61  SFVGMGDIVTKESFEWLFSNPRSVRASSAVNRLMNDIMSHK 101
           S++GMG+I +KE+F+WLFS+P  + AS +V RLM+D+ SHK
Sbjct: 425 SYLGMGEIASKEAFDWLFSHPPVIEASESVGRLMDDMRSHK 465
Sesquiterpene synthase.
Santalum murrayanum (taxid: 453085)
EC: 4EC: .EC: 2EC: .EC: 3EC: .EC: -
>sp|F6M8H4|SAST_SANAL Probable sesquiterpene synthase OS=Santalum album GN=SesquiTPS1 PE=3 SV=1 Back     alignment and function description
>sp|F6M8H5|SAUST_SANAS Probable sesquiterpene synthase OS=Santalum austrocaledonicum GN=SesquiTPS PE=3 SV=1 Back     alignment and function description
>sp|B5A435|STPS1_SANAL Sesquiterpene synthase OS=Santalum album PE=1 SV=1 Back     alignment and function description
>sp|E3W207|SAUSS_SANAS Sesquiterpene synthase OS=Santalum austrocaledonicum PE=2 SV=1 Back     alignment and function description
>sp|E3W208|SPISS_SANSP Sesquiterpene synthase OS=Santalum spicatum PE=2 SV=1 Back     alignment and function description
>sp|F6M8H6|SPIST_SANSP Probable sesquiterpene synthase OS=Santalum spicatum GN=SesquiTPS PE=3 SV=1 Back     alignment and function description
>sp|Q6Q3H3|TPSGD_VITVI (-)-germacrene D synthase OS=Vitis vinifera GN=VIT_19s0014g04930 PE=1 SV=1 Back     alignment and function description
>sp|Q6Q3H2|TPSVS_VITVI Valencene synthase OS=Vitis vinifera GN=ValCS PE=1 SV=1 Back     alignment and function description
>sp|Q43714|DCS3_GOSAR (+)-delta-cadinene synthase isozyme A OS=Gossypium arboreum GN=CAD1-A PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
322424205 541 germacrene D synthase [Citrus hystrix] 1.0 0.186 0.851 7e-46
225461479 561 PREDICTED: (-)-germacrene D synthase [Vi 1.0 0.180 0.594 7e-32
408407799 562 RecName: Full=Probable sesquiterpene syn 1.0 0.179 0.584 7e-31
224115384 569 predicted protein [Populus trichocarpa] 0.990 0.175 0.59 7e-31
147864027 561 hypothetical protein VITISV_002911 [Viti 0.950 0.171 0.614 1e-30
408407794 559 RecName: Full=Probable sesquiterpene syn 1.0 0.180 0.574 3e-30
408407795 562 RecName: Full=Probable sesquiterpene syn 0.990 0.177 0.59 3e-30
408387587 559 RecName: Full=Sesquiterpene synthase; Sh 1.0 0.180 0.584 4e-30
255565287 550 (+)-delta-cadinene synthase isozyme A, p 0.980 0.18 0.606 4e-30
403377874 559 RecName: Full=Sesquiterpene synthase; Sh 1.0 0.180 0.574 6e-30
>gi|322424205|gb|ADX01384.1| germacrene D synthase [Citrus hystrix] Back     alignment and taxonomy information
 Score =  187 bits (475), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 92/101 (91%)

Query: 1   KDLASQGKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTI 60
           KDL SQGKLYRLHYAKEAMKN VKHY FEAKWCHQNYVPTVDEYM VAL++S  P LSTI
Sbjct: 345 KDLVSQGKLYRLHYAKEAMKNQVKHYFFEAKWCHQNYVPTVDEYMTVALISSGHPNLSTI 404

Query: 61  SFVGMGDIVTKESFEWLFSNPRSVRASSAVNRLMNDIMSHK 101
           SFVG+GDIVTKESFEWLFSNPRS+RAS AV RLMND++SHK
Sbjct: 405 SFVGLGDIVTKESFEWLFSNPRSIRASCAVGRLMNDMVSHK 445

Source: Citrus hystrix

Species: Citrus hystrix

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225461479|ref|XP_002282488.1| PREDICTED: (-)-germacrene D synthase [Vitis vinifera] gi|302142994|emb|CBI20289.3| unnamed protein product [Vitis vinifera] gi|313755468|gb|ADR74225.1| selina-411-diene/intermedeol synthase [synthetic construct] Back     alignment and taxonomy information
>gi|408407799|sp|F6M8H7.1|SMST_SANMU RecName: Full=Probable sesquiterpene synthase; Short=SmSTPS gi|333411345|gb|AEF32537.1| putative sesquiterpene synthase [Santalum murrayanum] Back     alignment and taxonomy information
>gi|224115384|ref|XP_002317018.1| predicted protein [Populus trichocarpa] gi|222860083|gb|EEE97630.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147864027|emb|CAN81129.1| hypothetical protein VITISV_002911 [Vitis vinifera] Back     alignment and taxonomy information
>gi|408407794|sp|F6M8H4.1|SAST_SANAL RecName: Full=Probable sesquiterpene synthase; Short=SaSTPS gi|333411339|gb|AEF32534.1| sesquiterpene synthase [Santalum album] Back     alignment and taxonomy information
>gi|408407795|sp|F6M8H5.1|SAUST_SANAS RecName: Full=Probable sesquiterpene synthase; Short=SauSTPS gi|333411341|gb|AEF32535.1| sesquiterpene synthase [Santalum austrocaledonicum] Back     alignment and taxonomy information
>gi|408387587|sp|B5A435.1|STPS1_SANAL RecName: Full=Sesquiterpene synthase; Short=SaSesquiTPS1 gi|193876292|gb|ACF24768.1| sesquiterpene synthase [Santalum album] Back     alignment and taxonomy information
>gi|255565287|ref|XP_002523635.1| (+)-delta-cadinene synthase isozyme A, putative [Ricinus communis] gi|223537087|gb|EEF38721.1| (+)-delta-cadinene synthase isozyme A, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|403377874|sp|E3W207.1|SAUSS_SANAS RecName: Full=Sesquiterpene synthase; Short=SauSesquiTPS gi|309754775|gb|ADO87005.1| sesquiterpene synthase [Santalum austrocaledonicum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
UNIPROTKB|B5A435559 B5A435 "Sesquiterpene synthase 1.0 0.180 0.584 1.6e-29
UNIPROTKB|B3TPQ6550 B3TPQ6 "Beta-cubebene synthase 0.990 0.181 0.49 3.3e-21
UNIPROTKB|J7LMP2565 J7LMP2 "Bicyclogermacrene synt 1.0 0.178 0.435 7.2e-20
UNIPROTKB|B2KSJ6560 B2KSJ6 "Alpha-farnesene syntha 0.910 0.164 0.440 3.6e-17
UNIPROTKB|Q49SP4545 Q49SP4 "Germacrene D synthase 0.950 0.176 0.443 1.5e-16
UNIPROTKB|Q49SP6554 Q49SP6 "Germacrene D synthase 0.970 0.176 0.464 1.6e-16
UNIPROTKB|Q49SP5554 Q49SP5 "Germacrene A synthase" 0.990 0.180 0.405 3.3e-16
UNIPROTKB|E2E2N7555 TPS4 "Bicyclogermacrene syntha 0.900 0.163 0.467 4.3e-16
UNIPROTKB|J7LJN5555 J7LJN5 "Beta-caryophyllene syn 0.900 0.163 0.406 4.3e-16
UNIPROTKB|Q8LSC3583 Q8LSC3 "Germacrene A synthase 0.980 0.169 0.363 9.9e-16
UNIPROTKB|B5A435 B5A435 "Sesquiterpene synthase" [Santalum album (taxid:35974)] Back     alignment and assigned GO terms
 Score = 332 (121.9 bits), Expect = 1.6e-29, P = 1.6e-29
 Identities = 59/101 (58%), Positives = 81/101 (80%)

Query:     1 KDLASQGKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTI 60
             +++ +QG L+R+HYAKE MK LV+ Y+ EAKWCH+ YVPT +EYM VALVTS    L+TI
Sbjct:   362 EEMDNQGSLFRMHYAKEVMKKLVEGYMDEAKWCHEKYVPTFEEYMPVALVTSGYTFLTTI 421

Query:    61 SFVGMGDIVTKESFEWLFSNPRSVRASSAVNRLMNDIMSHK 101
             S++GMG+I +KE+F+WLFS+P  + AS +V RLM+D+ SHK
Sbjct:   422 SYLGMGEIASKEAFDWLFSHPPVIEASESVCRLMDDMRSHK 462
GO:0010334 "sesquiterpene synthase activity" evidence=IDA
GO:0033383 "geranyl diphosphate metabolic process" evidence=IDA
UNIPROTKB|B3TPQ6 B3TPQ6 "Beta-cubebene synthase" [Magnolia grandiflora (taxid:3406)] Back     alignment and assigned GO terms
UNIPROTKB|J7LMP2 J7LMP2 "Bicyclogermacrene synthase" [Phyla dulcis (taxid:542674)] Back     alignment and assigned GO terms
UNIPROTKB|B2KSJ6 B2KSJ6 "Alpha-farnesene synthase" [Cucumis melo (taxid:3656)] Back     alignment and assigned GO terms
UNIPROTKB|Q49SP4 Q49SP4 "Germacrene D synthase 1" [Pogostemon cablin (taxid:28511)] Back     alignment and assigned GO terms
UNIPROTKB|Q49SP6 Q49SP6 "Germacrene D synthase 2" [Pogostemon cablin (taxid:28511)] Back     alignment and assigned GO terms
UNIPROTKB|Q49SP5 Q49SP5 "Germacrene A synthase" [Pogostemon cablin (taxid:28511)] Back     alignment and assigned GO terms
UNIPROTKB|E2E2N7 TPS4 "Bicyclogermacrene synthase" [Origanum vulgare (taxid:39352)] Back     alignment and assigned GO terms
UNIPROTKB|J7LJN5 J7LJN5 "Beta-caryophyllene synthase" [Phyla dulcis (taxid:542674)] Back     alignment and assigned GO terms
UNIPROTKB|Q8LSC3 Q8LSC3 "Germacrene A synthase long form" [Cichorium intybus (taxid:13427)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00027698001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (561 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
cd00684542 cd00684, Terpene_cyclase_plant_C1, Plant Terpene C 2e-38
cd00868284 cd00868, Terpene_cyclase_C1, Terpene cyclases, Cla 8e-33
pfam03936270 pfam03936, Terpene_synth_C, Terpene synthase famil 1e-32
cd00385243 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynth 2e-11
PLN02279 784 PLN02279, PLN02279, ent-kaur-16-ene synthase 7e-05
>gnl|CDD|173832 cd00684, Terpene_cyclase_plant_C1, Plant Terpene Cyclases, Class 1 Back     alignment and domain information 
 Score =  133 bits (338), Expect = 2e-38
 Identities = 55/101 (54%), Positives = 72/101 (71%)

Query: 1   KDLASQGKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTI 60
           ++L  +G  Y + Y KEA K+LVK YL EAKW H+ YVPT +EYM  ALV+     L   
Sbjct: 347 EELLKEGGSYVVPYLKEAWKDLVKAYLVEAKWAHEGYVPTFEEYMENALVSIGLGPLLLT 406

Query: 61  SFVGMGDIVTKESFEWLFSNPRSVRASSAVNRLMNDIMSHK 101
           SF+GMGDI+T+E+FEWL S P+ VRASS + RLMNDI +++
Sbjct: 407 SFLGMGDILTEEAFEWLESRPKLVRASSTIGRLMNDIATYE 447

This CD includes a diverse group of monomeric plant terpene cyclases (Tspa-Tspf) that convert the acyclic isoprenoid diphosphates, geranyl diphosphate (GPP), farnesyl diphosphate (FPP), or geranylgeranyl diphosphate (GGPP) into cyclic monoterpenes, diterpenes, or sesquiterpenes, respectively; a few form acyclic species. Terpnoid cyclases are soluble enzymes localized to the cytosol (sesquiterpene synthases) or plastids (mono- and diterpene synthases). All monoterpene and diterpene synthases have restrict substrate specificity, however, some sesquiterpene synthases can accept both FPP and GPP. The catalytic site consists of a large central cavity formed by mostly antiparallel alpha helices with two aspartate-rich regions located on opposite walls. These residues mediate binding of prenyl diphosphates, via bridging Mg2+ ions (K+ preferred by gymnosperm cyclases), inducing conformational changes such that an N-terminal region forms a cap over the catalytic core. Loss of diphosphate from the enzyme-bound substrate (GPP, FPP, or GGPP) results in an allylic carbocation that electrophilically attacks a double bond further down the terpene chain to effect the first ring closure. Unlike monoterpene, sesquiterene, and macrocyclic diterpenes synthases, which undergo substrate ionization by diphosphate ester scission, Tpsc-like diterpene synthases catalyze cyclization reactions by an initial protonation step producing a copalyl diphosphate intermediate. These enzymes lack the aspartate-rich sequences mentioned above. Most diterpene synthases have an N-terminal, internal element (approx 210 aa) whose function is unknown. Length = 542
>gnl|CDD|173837 cd00868, Terpene_cyclase_C1, Terpene cyclases, Class 1 Back     alignment and domain information
>gnl|CDD|202816 pfam03936, Terpene_synth_C, Terpene synthase family, metal binding domain Back     alignment and domain information
>gnl|CDD|173830 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynthesis enzymes, Class 1 Back     alignment and domain information
>gnl|CDD|177918 PLN02279, PLN02279, ent-kaur-16-ene synthase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 101
PLN02279 784 ent-kaur-16-ene synthase 99.94
cd00684542 Terpene_cyclase_plant_C1 Plant Terpene Cyclases, C 99.94
cd00868284 Terpene_cyclase_C1 Terpene cyclases, Class 1. Terp 99.72
PF03936270 Terpene_synth_C: Terpene synthase family, metal bi 99.7
cd00687303 Terpene_cyclase_nonplant_C1 Non-plant Terpene Cycl 99.68
PLN02592800 ent-copalyl diphosphate synthase 99.17
cd00385243 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzym 98.95
cd00867236 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases. 94.98
cd00685259 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthase 89.69
TIGR02749 322 prenyl_cyano solanesyl diphosphate synthase. Membe 87.04
PLN02890 422 geranyl diphosphate synthase 86.2
TIGR02748 319 GerC3_HepT heptaprenyl diphosphate synthase compon 82.31
COG0142 322 IspA Geranylgeranyl pyrophosphate synthase [Coenzy 81.74
>PLN02279 ent-kaur-16-ene synthase Back     alignment and domain information 
Probab=99.94  E-value=1.9e-27  Score=194.71  Aligned_cols=97  Identities=27%  Similarity=0.320  Sum_probs=92.7

Q ss_pred             hhhhCCccHHHHHHHHHHHHHHHHHHHHHHhcCCcccChHHHhhhhhhhcchhhHHHHHHHhcCCCcchhhhhhccCCcH
Q 041900            3 LASQGKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTISFVGMGDIVTKESFEWLFSNPR   82 (101)
Q Consensus         3 ~~~~~~~~~~~~~k~~~~~l~~~yl~EakW~~~~~vPt~eEYl~~~~~S~g~~~~~~~~~~~~g~~~~~e~~~w~~~~p~   82 (101)
                      +.+||+ ++++|+|++|++++++|++||+|+++||+||+||||+||.+|+|++++++++++++|+.+|+|+++| .++|+
T Consensus       584 ~~~qGr-~v~~~l~~aW~~ll~ayl~EAeW~~~g~vPT~eEYL~na~vS~~l~~i~l~~~~~~G~~l~eev~e~-~~~~~  661 (784)
T PLN02279        584 FTWQGR-NVTSHIIKIWLDLLKSMLTEAQWSSNKSTPTLDEYMTNAYVSFALGPIVLPALYLVGPKLSEEVVDS-PELHK  661 (784)
T ss_pred             HHHcCc-hHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCHHHHHhhchhhhhhHHHHHHHHHHhCCCCCHHHHhC-cchhH
Confidence            346777 9999999999999999999999999999999999999999999999999999999999999999999 69999


Q ss_pred             HHHHHHHHHHHhcccccCC
Q 041900           83 SVRASSAVNRLMNDIMSHK  101 (101)
Q Consensus        83 i~~~~~~i~RL~nDi~s~~  101 (101)
                      |+++++.|+||+|||+||+
T Consensus       662 L~~l~s~I~RLlNDI~S~e  680 (784)
T PLN02279        662 LYKLMSTCGRLLNDIRGFK  680 (784)
T ss_pred             HHHHHHHHHHHHHhccccH
Confidence            9999999999999999985

>cd00684 Terpene_cyclase_plant_C1 Plant Terpene Cyclases, Class 1 Back     alignment and domain information
>cd00868 Terpene_cyclase_C1 Terpene cyclases, Class 1 Back     alignment and domain information
>PF03936 Terpene_synth_C: Terpene synthase family, metal binding domain; InterPro: IPR005630 Sequences containing this domain belong to the terpene synthase family Back     alignment and domain information
>cd00687 Terpene_cyclase_nonplant_C1 Non-plant Terpene Cyclases, Class 1 Back     alignment and domain information
>PLN02592 ent-copalyl diphosphate synthase Back     alignment and domain information
>cd00385 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzymes, Class 1 Back     alignment and domain information
>cd00867 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases Back     alignment and domain information
>cd00685 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthases, head-to-tail Back     alignment and domain information
>TIGR02749 prenyl_cyano solanesyl diphosphate synthase Back     alignment and domain information
>PLN02890 geranyl diphosphate synthase Back     alignment and domain information
>TIGR02748 GerC3_HepT heptaprenyl diphosphate synthase component II Back     alignment and domain information
>COG0142 IspA Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
3g4d_A554 Crystal Structure Of (+)-Delta-Cadinene Synthase Fr 8e-24
3lz9_A550 The Crystal Structure Of 5-Epi-Aristolochene Syntha 9e-11
5eat_A548 5-Epi-Aristolochene Synthase From Nicotiana Tabacum 1e-10
5eau_A548 5-Epi-Aristolochene Synthase From Nicotiana Tabacum 1e-10
5eas_A548 5-Epi-Aristolochene Synthase From Nicotiana Tabacum 1e-10
1hx9_A548 Crystal Structure Of Teas W273s Form 1 Length = 548 1e-10
3m01_A550 The Crystal Structure Of 5-Epi-Aristolochene Syntha 1e-10
4di5_A535 Co-Crystal Structure Of Wt 5-Epi-Aristolochene Synt 1e-10
1hxc_A548 Crystal Structure Of Teas C440w Length = 548 2e-10
1hxg_A548 Crystal Structure Of Teas W273sC440W Length = 548 2e-10
1n1b_A549 Crystal Structure Of (+)-bornyl Diphosphate Synthas 8e-07
2j5c_A569 Rational Conversion Of Substrate And Product Specif 1e-06
2ong_A543 Crystal Structure Of Of Limonene Synthase With 2- F 3e-06
3s9v_A785 Abietadiene Synthase From Abies Grandis Length = 78 7e-06
3n0f_A555 Crystal Structure Of Isoprene Synthase From Grey Po 6e-05
>pdb|3G4D|A Chain A, Crystal Structure Of (+)-Delta-Cadinene Synthase From Gossypium Arboreum And Evolutionary Divergence Of Metal Binding Motifs For Catalysis Length = 554 Back     alignment and structure 
Iteration: 1

 Score =  105 bits (261), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 67/99 (67%)
Query: 3   LASQGKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTISF 62
           +A  G+ YR+ YAK AM  L + YL EAKW  QNY P+ +E+ A AL T    +L+  SF
Sbjct: 359 VAEHGRQYRVEYAKNAMIRLAQSYLVEAKWTLQNYKPSFEEFKANALPTCGYAMLAITSF 418
Query: 63  VGMGDIVTKESFEWLFSNPRSVRASSAVNRLMNDIMSHK 101
           VGMGDIVT E+F+W  S+P+ ++AS+ + R M+D+  HK
Sbjct: 419 VGMGDIVTPETFKWAASDPKIIQASTIICRFMDDVAEHK 457
>pdb|3LZ9|A Chain A, The Crystal Structure Of 5-Epi-Aristolochene Synthase M4 Mut Complexed With (2-Trans,6-Trans)-2-Fluorofarnesyl Diphospha Length = 550 Back     alignment and structure
>pdb|5EAT|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana Tabacum With Substrate Analog Farnesyl Hydroxyphosphonate Length = 548 Back     alignment and structure
>pdb|5EAU|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana Tabacum Length = 548 Back     alignment and structure
>pdb|5EAS|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana Tabacum Length = 548 Back     alignment and structure
>pdb|1HX9|A Chain A, Crystal Structure Of Teas W273s Form 1 Length = 548 Back     alignment and structure
>pdb|3M01|A Chain A, The Crystal Structure Of 5-Epi-Aristolochene Synthase Complexed With (2-Trans,6-Trans)-2-Fluorofarnesyl Diphosphate Length = 550 Back     alignment and structure
>pdb|4DI5|A Chain A, Co-Crystal Structure Of Wt 5-Epi-Aristolochene Synthase From Nicotiana Tobaccum With Geraniline Length = 535 Back     alignment and structure
>pdb|1HXC|A Chain A, Crystal Structure Of Teas C440w Length = 548 Back     alignment and structure
>pdb|1HXG|A Chain A, Crystal Structure Of Teas W273sC440W Length = 548 Back     alignment and structure
>pdb|1N1B|A Chain A, Crystal Structure Of (+)-bornyl Diphosphate Synthase From Sage Length = 549 Back     alignment and structure
>pdb|2J5C|A Chain A, Rational Conversion Of Substrate And Product Specificity In A Monoterpene Synthase. Structural Insights Into The Molecular Basis Of Rapid Evolution. Length = 569 Back     alignment and structure
>pdb|2ONG|A Chain A, Crystal Structure Of Of Limonene Synthase With 2- Fluorogeranyl Diphosphate (Fgpp). Length = 543 Back     alignment and structure
>pdb|3S9V|A Chain A, Abietadiene Synthase From Abies Grandis Length = 785 Back     alignment and structure
>pdb|3N0F|A Chain A, Crystal Structure Of Isoprene Synthase From Grey Poplar Leaves (Populus X Canescens) Length = 555 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
3s9v_A785 Abietadiene synthase, chloroplastic; alpha bundle/ 2e-28
3g4d_A554 (+)-delta-cadinene synthase isozyme XC1; cyclase, 1e-27
3n0f_A555 Isoprene synthase; terpene cyclase fold, hemiterpe 3e-27
3m00_A550 Aristolochene synthase; plant terpenoid cyclase, l 1e-26
3p5p_A 764 Taxadiene synthase; class I and II terpene cyclase 2e-26
1n1b_A549 (+)-bornyl diphosphate synthase; terpene synthase 5e-26
2ong_A543 4S-limonene synthase; monoterpene synthase, monote 6e-26
2j5c_A569 1,8-cineole synthase; terpene synthases, 1, monote 8e-26
3sdr_A817 Alpha-bisabolene synthase; lyase, terpene synthase 1e-22
3kb9_A 382 EPI-isozizaene synthase; terpenoid cyclase, alpha- 7e-14
3pya_A727 ENT-copalyl diphosphate synthase, chloroplastic; c 2e-13
1ps1_A 337 Pentalenene synthase; antibiotic biosynthesis, ses 3e-12
3bny_A320 Aristolochene synthase; sesquiterpene cyclase, iso 3e-07
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 3e-06
1di1_A300 Aristolochene synthase; sesquiterpene cyclase, iso 2e-04
>3s9v_A Abietadiene synthase, chloroplastic; alpha bundle/barrel, lyase, isomerase; 2.30A {Abies grandis} Length = 785 Back     alignment and structure
 Score =  106 bits (265), Expect = 2e-28
 Identities = 26/101 (25%), Positives = 48/101 (47%)

Query: 1   KDLASQGKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTI 60
           K+   +     L Y +   K  ++ Y  EA+W    YVP+ +EY+  A V+ A   +  I
Sbjct: 588 KEGRERQGRDVLGYIQNVWKVQLEAYTKEAEWSEAKYVPSFNEYIENASVSIALGTVVLI 647

Query: 61  SFVGMGDIVTKESFEWLFSNPRSVRASSAVNRLMNDIMSHK 101
           S +  G+++T E    +    R ++      RL+ND  +++
Sbjct: 648 SALFTGEVLTDEVLSKIDRESRFLQLMGLTGRLVNDTKTYQ 688
>3g4d_A (+)-delta-cadinene synthase isozyme XC1; cyclase, lyase, magnesium, metal-binding; 2.40A {Gossypium arboreum} PDB: 3g4f_A* Length = 554 Back     alignment and structure
>3n0f_A Isoprene synthase; terpene cyclase fold, hemiterpene synthase, DDXXD motif, NSE motif, lyase; 2.70A {Populus tremula x populus alba} PDB: 3n0g_A* Length = 555 Back     alignment and structure
>3m00_A Aristolochene synthase; plant terpenoid cyclase, lyase binding domain, (2-CIS, 6-trans)-2-fluorofarnesyl diphospha magnesium, metal-binding; HET: 2CF; 2.10A {Nicotiana tabacum} PDB: 3lz9_A* 3m02_A* 3m01_A* 5eau_A* 1hxa_A* 1hx9_A* 1hxc_A* 5eas_A 1hxg_A 4di5_A* 5eat_A* Length = 550 Back     alignment and structure
>3p5p_A Taxadiene synthase; class I and II terpene cyclase fold, diterpene cyclase, DDXX NSE/DTE motif, 3-azacopalyl diphosphate; HET: A3C; 1.82A {Taxus brevifolia} PDB: 3p5r_A* Length = 764 Back     alignment and structure
>1n1b_A (+)-bornyl diphosphate synthase; terpene synthase fold, isomerase; 2.00A {Salvia officinalis} SCOP: a.102.4.1 a.128.1.3 PDB: 1n1z_A* 1n20_A* 1n21_A* 1n22_A* 1n23_A* 1n24_A* Length = 549 Back     alignment and structure
>2ong_A 4S-limonene synthase; monoterpene synthase, monoterpene cyclase, geranyl diphosphate, 2 fluorogeranyl diphosphate linalyl diphosphate; HET: FPG BTB; 2.70A {Mentha spicata} PDB: 2onh_A* Length = 543 Back     alignment and structure
>2j5c_A 1,8-cineole synthase; terpene synthases, 1, monoterpene, lyase; 1.95A {Salvia fruticosa} Length = 569 Back     alignment and structure
>3sdr_A Alpha-bisabolene synthase; lyase, terpene synthase; HET: 210; 1.86A {Abies grandis} PDB: 3sdq_A 3sae_A* 3sdt_A* 3sdu_A* 3sdv_A* Length = 817 Back     alignment and structure
>3kb9_A EPI-isozizaene synthase; terpenoid cyclase, alpha-helical fold, farnesyl diphosphate, metal-binding, lyase, magnesium; HET: BTM; 1.60A {Streptomyces coelicolor} PDB: 3kbk_A 3lgk_A 3lg5_A* Length = 382 Back     alignment and structure
>3pya_A ENT-copalyl diphosphate synthase, chloroplastic; class I and II terpene cyclase fold, class II diterpene CYCL DXXDD motif; HET: AG8 1PE; 2.25A {Arabidopsis thaliana} PDB: 3pyb_A* Length = 727 Back     alignment and structure
>1ps1_A Pentalenene synthase; antibiotic biosynthesis, sesquiterpene cyclase, lyase; 2.60A {Streptomyces SP} SCOP: a.128.1.4 PDB: 1hm7_A 1hm4_A Length = 337 Back     alignment and structure
>3bny_A Aristolochene synthase; sesquiterpene cyclase, isoprenoid, farnesyl diphosphate, magnesium, cyclization, lyase; HET: FPF; 1.89A {Aspergillus terreus} PDB: 2e4o_A 2oa6_A* 3bnx_A* 3cke_A* Length = 320 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>1di1_A Aristolochene synthase; sesquiterpene cyclase, isoprenoid biosynthesis, lyase; 2.50A {Penicillium roqueforti} SCOP: a.128.1.4 PDB: 1dgp_A Length = 300 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query101
3g4d_A554 (+)-delta-cadinene synthase isozyme XC1; cyclase, 99.98
3m00_A550 Aristolochene synthase; plant terpenoid cyclase, l 99.97
3n0f_A555 Isoprene synthase; terpene cyclase fold, hemiterpe 99.97
2ong_A543 4S-limonene synthase; monoterpene synthase, monote 99.97
2j5c_A569 1,8-cineole synthase; terpene synthases, 1, monote 99.97
1n1b_A549 (+)-bornyl diphosphate synthase; terpene synthase 99.96
3s9v_A785 Abietadiene synthase, chloroplastic; alpha bundle/ 99.96
3p5p_A 764 Taxadiene synthase; class I and II terpene cyclase 99.96
3sdr_A817 Alpha-bisabolene synthase; lyase, terpene synthase 99.96
3kb9_A 382 EPI-isozizaene synthase; terpenoid cyclase, alpha- 99.87
1ps1_A 337 Pentalenene synthase; antibiotic biosynthesis, ses 99.87
1di1_A300 Aristolochene synthase; sesquiterpene cyclase, iso 99.85
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 99.82
3bny_A320 Aristolochene synthase; sesquiterpene cyclase, iso 99.81
3pya_A727 ENT-copalyl diphosphate synthase, chloroplastic; c 98.86
1yyq_A 374 Trichodiene synthase; terpenoid cyclase fold, site 95.38
3lmd_A 360 Geranylgeranyl pyrophosphate synthase; isoprenyl d 91.1
2q80_A 301 Geranylgeranyl pyrophosphate synthetase; isoprenoi 88.93
3nf2_A 352 Putative polyprenyl synthetase; isoprenyl diphosph 88.81
2e8v_A 340 Geranylgeranyl pyrophosphate synthetase; prenyltra 87.24
3rmg_A 334 Octaprenyl-diphosphate synthase; structural genomi 86.99
3aqb_B 325 Component B of hexaprenyl diphosphate synthase; pr 86.46
4dhd_A 358 Polyprenyl synthetase; isoprenoid synthesis, isopr 86.21
3mzv_A 341 Decaprenyl diphosphate synthase; transferase, stru 85.52
3ipi_A295 Geranyltranstransferase; isoprene biosynthesis, he 85.08
1wmw_A 330 Geranylgeranyl diphosphate synthetase; GGPP, preny 84.85
3oyr_A 345 Trans-isoprenyl diphosphate synthase; isoprenyl sy 84.84
1v4e_A299 Octoprenyl-diphosphate synthase; trans-type prenyl 84.44
1wy0_A 342 Geranylgeranyl pyrophosphate synthetase; pyrococcu 83.86
2ftz_A284 Geranyltranstransferase; TM0161, structural GE joi 82.89
3m0g_A297 Farnesyl diphosphate synthase; structural genomics 82.82
3pko_A 334 Geranylgeranyl pyrophosphate synthase; isoprenyl d 82.6
1uby_A 367 FPS, farnesyl diphosphate synthase; transferase, i 82.44
2qis_A 374 Farnesyl pyrophosphate synthetase; trans-prenyltra 82.13
>3g4d_A (+)-delta-cadinene synthase isozyme XC1; cyclase, lyase, magnesium, metal-binding; 2.40A {Gossypium arboreum} PDB: 3g4f_A* Back     alignment and structure
Probab=99.98  E-value=6e-33  Score=219.38  Aligned_cols=100  Identities=48%  Similarity=0.831  Sum_probs=96.9

Q ss_pred             hhhhhCCccHHHHHHHHHHHHHHHHHHHHHHhcCCcccChHHHhhhhhhhcchhhHHHHHHHhcCCCcchhhhhhccCCc
Q 041900            2 DLASQGKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTISFVGMGDIVTKESFEWLFSNP   81 (101)
Q Consensus         2 ~~~~~~~~~~~~~~k~~~~~l~~~yl~EakW~~~~~vPt~eEYl~~~~~S~g~~~~~~~~~~~~g~~~~~e~~~w~~~~p   81 (101)
                      ++.+|||+++++|+|++|++++++|++||||+++||+||+||||+||.+|+|+++++++++++||+.+|+|+++|+.++|
T Consensus       358 ~~~~~~~~~~~~ylk~~w~~l~~ayl~EAkW~~~gyvPT~EEYl~na~vSsg~~~l~~~~~~~mg~~lt~e~~e~~~~~p  437 (554)
T 3g4d_A          358 LVAEHGRQYRVEYAKNAMIRLAQSYLVEAKWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDIVTPETFKWAASDP  437 (554)
T ss_dssp             HHGGGTCTHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCCHHHHHHHHGGGSCHHHHHHHHHHTSCTTSCHHHHHHHHTCC
T ss_pred             HHHHcCCcchHHHHHHHHHHHHHHHHHHHHHHhcCCCCCHHHHHhccceeehHHHHHHHHHHhcCCCCCHHHHHhccccH
Confidence            46688998999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhcccccCC
Q 041900           82 RSVRASSAVNRLMNDIMSHK  101 (101)
Q Consensus        82 ~i~~~~~~i~RL~nDi~s~~  101 (101)
                      +|+++++.|+||+|||+||+
T Consensus       438 ~i~~~~~~I~RL~NDI~S~k  457 (554)
T 3g4d_A          438 KIIQASTIICRFMDDVAEHK  457 (554)
T ss_dssp             HHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHhcccchhh
Confidence            99999999999999999985
>3m00_A Aristolochene synthase; plant terpenoid cyclase, lyase binding domain, (2-CIS, 6-trans)-2-fluorofarnesyl diphospha magnesium, metal-binding; HET: 2CF; 2.10A {Nicotiana tabacum} PDB: 3lz9_A* 3m02_A* 3m01_A* 5eau_A* 1hxa_A* 1hx9_A* 1hxc_A* 5eas_A 1hxg_A 4di5_A* 5eat_A* Back     alignment and structure
>3n0f_A Isoprene synthase; terpene cyclase fold, hemiterpene synthase, DDXXD motif, NSE motif, lyase; 2.70A {Populus tremula x populus alba} PDB: 3n0g_A* Back     alignment and structure
>2ong_A 4S-limonene synthase; monoterpene synthase, monoterpene cyclase, geranyl diphosphate, 2 fluorogeranyl diphosphate linalyl diphosphate; HET: FPG BTB; 2.70A {Mentha spicata} PDB: 2onh_A* Back     alignment and structure
>2j5c_A 1,8-cineole synthase; terpene synthases, 1, monoterpene, lyase; 1.95A {Salvia fruticosa} Back     alignment and structure
>1n1b_A (+)-bornyl diphosphate synthase; terpene synthase fold, isomerase; 2.00A {Salvia officinalis} SCOP: a.102.4.1 a.128.1.3 PDB: 1n1z_A* 1n20_A* 1n21_A* 1n22_A* 1n23_A* 1n24_A* Back     alignment and structure
>3s9v_A Abietadiene synthase, chloroplastic; alpha bundle/barrel, lyase, isomerase; 2.30A {Abies grandis} Back     alignment and structure
>3p5p_A Taxadiene synthase; class I and II terpene cyclase fold, diterpene cyclase, DDXX NSE/DTE motif, 3-azacopalyl diphosphate; HET: A3C; 1.82A {Taxus brevifolia} PDB: 3p5r_A* Back     alignment and structure
>3sdr_A Alpha-bisabolene synthase; lyase, terpene synthase; HET: 210; 1.86A {Abies grandis} PDB: 3sdq_A 3sae_A* 3sdt_A* 3sdu_A* 3sdv_A* Back     alignment and structure
>3kb9_A EPI-isozizaene synthase; terpenoid cyclase, alpha-helical fold, farnesyl diphosphate, metal-binding, lyase, magnesium; HET: BTM; 1.60A {Streptomyces coelicolor} PDB: 3kbk_A 3lgk_A 3lg5_A* Back     alignment and structure
>1ps1_A Pentalenene synthase; antibiotic biosynthesis, sesquiterpene cyclase, lyase; 2.60A {Streptomyces SP} SCOP: a.128.1.4 PDB: 1hm7_A 1hm4_A Back     alignment and structure
>1di1_A Aristolochene synthase; sesquiterpene cyclase, isoprenoid biosynthesis, lyase; 2.50A {Penicillium roqueforti} SCOP: a.128.1.4 PDB: 1dgp_A Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Back     alignment and structure
>3bny_A Aristolochene synthase; sesquiterpene cyclase, isoprenoid, farnesyl diphosphate, magnesium, cyclization, lyase; HET: FPF; 1.89A {Aspergillus terreus} PDB: 2e4o_A 2oa6_A* 3bnx_A* 3cke_A* Back     alignment and structure
>3pya_A ENT-copalyl diphosphate synthase, chloroplastic; class I and II terpene cyclase fold, class II diterpene CYCL DXXDD motif; HET: AG8 1PE; 2.25A {Arabidopsis thaliana} PDB: 3pyb_A* Back     alignment and structure
>1yyq_A Trichodiene synthase; terpenoid cyclase fold, site-directed mutant, pyrophosphate, lyase; 2.10A {Fusarium sporotrichioides} PDB: 1yj4_A 1yyr_A* 1yys_A* 1jfa_A 1jfg_A 2q9y_A* 2q9z_A 2ael_A* 2aek_A* 2aet_A 2ps7_A 2ps8_A 1kiy_A 1kiz_A 1yyt_A* 1yyu_A* 2ps5_A 2ps4_A 2ps6_A Back     alignment and structure
>3lmd_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, protein structure initiative, nysgrc; 1.90A {Corynebacterium glutamicum} PDB: 3q2q_A* Back     alignment and structure
>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural GENO structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1 Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Back     alignment and structure
>2e8v_A Geranylgeranyl pyrophosphate synthetase; prenyltransferase, farnesyl pyrophosphate, bisphosphonate; HET: GRG; 1.80A {Saccharomyces cerevisiae} PDB: 2e8t_A* 2e8u_A* 2dh4_A* 2e8w_A* 2e8x_A* 2e90_A* 2e91_A* 2e92_A* 2e93_A* 2e94_A* 2e95_A* 2z4v_A* 2z4w_A* 2z4x_A* 2z4y_A* 2z4z_A* 2z50_A* 2z52_A* 2z78_A* 2z7h_A* ... Back     alignment and structure
>3rmg_A Octaprenyl-diphosphate synthase; structural genomics, protein structure initiative, isoprene biosynthesis, transferase; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Back     alignment and structure
>4dhd_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; 1.65A {Pyrobaculum calidifontis} PDB: 4gp1_A* 4gp2_A* Back     alignment and structure
>3mzv_A Decaprenyl diphosphate synthase; transferase, structural genomics, PSI-2, protein structure initiative; 1.90A {Rhodobacter capsulatus} Back     alignment and structure
>3ipi_A Geranyltranstransferase; isoprene biosynthesis, helical bundle, protein structure initiative II (PSI II), structural genomics, nysgxrc; 1.90A {Methanosarcina mazei} Back     alignment and structure
>1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genom riken structural genomics/proteomics initiative; 1.55A {Thermus thermophilus} Back     alignment and structure
>3oyr_A Trans-isoprenyl diphosphate synthase; isoprenyl synthase, PSI, protein structure initiative; HET: IPE; 2.00A {Caulobacter crescentus} Back     alignment and structure
>1v4e_A Octoprenyl-diphosphate synthase; trans-type prenyltransferase, thermophilic; 2.28A {Thermotoga maritima} SCOP: a.128.1.1 PDB: 1v4j_A 1wkz_A 1vg2_A 1wl3_A 1wl0_A 1wl2_A 1v4h_A 1v4i_A 1v4k_A 2azl_A 1wl1_A 1vg4_A 1vg3_A 1vg6_A 1vg7_A Back     alignment and structure
>1wy0_A Geranylgeranyl pyrophosphate synthetase; pyrococcus horikosh structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2ftz_A Geranyltranstransferase; TM0161, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima} Back     alignment and structure
>3m0g_A Farnesyl diphosphate synthase; structural genomics, protein structure initiative, NYSGXRC, biosynthesis, transferase, PSI-2; 1.90A {Rhodobacter capsulatus} PDB: 3lvs_A Back     alignment and structure
>3pko_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; HET: CIT; 1.98A {Lactobacillus brevis} PDB: 3n3d_A Back     alignment and structure
>1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} SCOP: a.128.1.1 PDB: 1ubw_A* 1ubv_A* 1ubx_A* 1fps_A Back     alignment and structure
>2qis_A Farnesyl pyrophosphate synthetase; trans-prenyltransferase, structural genomics, structural GEN consortium, SGC, transferase; HET: RIS; 1.80A {Homo sapiens} PDB: 4dem_F* 1yv5_A* 1yq7_A* 2opm_A* 2opn_A* 3cp6_A* 2rah_A* 2vf6_A* 1zw5_A* 3b7l_A* 3s4j_A* 3rye_A* 3n45_F* 2f89_F* 2f7m_F* 2f8z_F* 2f8c_F* 2f92_F* 2f9k_F* 3n1v_F* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 101
d1n1ba2328 a.128.1.3 (A:271-598) (+)-bornyl diphosphate synth 2e-30
d5easa2328 a.128.1.3 (A:221-548) 5-Epi-aristolochene synthase 1e-29
d1ps1a_311 a.128.1.4 (A:) Pentalenene synthase {Streptomyces 6e-19
d1di1a_300 a.128.1.4 (A:) Aristolochene synthase {Fungus (Pen 3e-16
>d1n1ba2 a.128.1.3 (A:271-598) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis) [TaxId: 38868]} Length = 328 Back     information, alignment and structure

class: All alpha proteins
fold: Terpenoid synthases
superfamily: Terpenoid synthases
family: Terpenoid cyclase C-terminal domain
domain: (+)-bornyl diphosphate synthase
species: Garden sage (Salvia officinalis) [TaxId: 38868]

 Score =  107 bits (269), Expect = 2e-30
 Identities = 23/102 (22%), Positives = 52/102 (50%), Gaps = 1/102 (0%)

Query: 1   KDLASQGKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTI 60
            D+  +   + L Y ++++ +LV+ Y  EAKW H  Y P++DEY+ +A ++ A P + + 
Sbjct: 131 YDILKEHGFFCLQYLRKSVVDLVEAYFHEAKWYHSGYTPSLDEYLNIAKISVASPAIISP 190

Query: 61  SFVGMGDIVTKES-FEWLFSNPRSVRASSAVNRLMNDIMSHK 101
           ++    +     +  + L+     +  +  + RL +D+ +  
Sbjct: 191 TYFTFANASHDTAVIDSLYQYHDILCLAGIILRLPDDLGTSY 232
>d5easa2 a.128.1.3 (A:221-548) 5-Epi-aristolochene synthase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 328 Back     information, alignment and structure
>d1ps1a_ a.128.1.4 (A:) Pentalenene synthase {Streptomyces sp., UC5319 [TaxId: 1931]} Length = 311 Back     information, alignment and structure
>d1di1a_ a.128.1.4 (A:) Aristolochene synthase {Fungus (Penicillium roqueforti) [TaxId: 5082]} Length = 300 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query101
d1n1ba2328 (+)-bornyl diphosphate synthase {Garden sage (Salv 99.97
d5easa2328 5-Epi-aristolochene synthase {Tobacco (Nicotiana t 99.97
d1ps1a_311 Pentalenene synthase {Streptomyces sp., UC5319 [Ta 99.7
d1di1a_300 Aristolochene synthase {Fungus (Penicillium roquef 99.44
d1kiya_ 354 Trichodiene synthase {Fusarium sporotrichioides [T 93.63
d2q80a1 291 Geranylgeranyl pyrophosphate synthetase {Human (Ho 92.32
d1fpsa_ 348 Farnesyl diphosphate synthase (geranyltranstransfe 85.23
>d1n1ba2 a.128.1.3 (A:271-598) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis) [TaxId: 38868]} Back     information, alignment and structure
class: All alpha proteins
fold: Terpenoid synthases
superfamily: Terpenoid synthases
family: Terpenoid cyclase C-terminal domain
domain: (+)-bornyl diphosphate synthase
species: Garden sage (Salvia officinalis) [TaxId: 38868]

Probab=99.97  E-value=1.5e-32  Score=204.11  Aligned_cols=100  Identities=23%  Similarity=0.510  Sum_probs=91.0

Q ss_pred             hhhhhCCccHHHHHHHHHHHHHHHHHHHHHHhcCCcccChHHHhhhhhhhcchhhHHHHHHHhcCCCcc-hhhhhhccCC
Q 041900            2 DLASQGKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALVTSACPILSTISFVGMGDIVT-KESFEWLFSN   80 (101)
Q Consensus         2 ~~~~~~~~~~~~~~k~~~~~l~~~yl~EakW~~~~~vPt~eEYl~~~~~S~g~~~~~~~~~~~~g~~~~-~e~~~w~~~~   80 (101)
                      ++.+++++++++|+|++|++++++|++||||+++||+||+||||+||.+|+|+++++++++++||+.++ +++++|+.++
T Consensus       132 ~~~~~~g~~~~~~lk~~w~~l~~ayl~EakW~~~g~vPt~eEYl~~~~vS~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~  211 (328)
T d1n1ba2         132 DILKEHGFFCLQYLRKSVVDLVEAYFHEAKWYHSGYTPSLDEYLNIAKISVASPAIISPTYFTFANASHDTAVIDSLYQY  211 (328)
T ss_dssp             HHHHHHSCCCHHHHHHHHHHHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTCHHHHHHHHHTTSTTCCCCHHHHHHHHTT
T ss_pred             HHHHhcCchHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCHHHHHhhceehhhHHHHHHHHHHhCCCccchHHHHHHHhcc
Confidence            345666679999999999999999999999999999999999999999999999999999999998765 5579999999


Q ss_pred             cHHHHHHHHHHHHhcccccCC
Q 041900           81 PRSVRASSAVNRLMNDIMSHK  101 (101)
Q Consensus        81 p~i~~~~~~i~RL~nDi~s~~  101 (101)
                      |+++++++.|+||+|||+||+
T Consensus       212 p~~~~~~~~i~RL~nDi~~~~  232 (328)
T d1n1ba2         212 HDILCLAGIILRLPDDLGTSY  232 (328)
T ss_dssp             CHHHHHHHHHHHHHHHHC---
T ss_pred             HHHHHHHHHHHHHHhhhhhHH
Confidence            999999999999999999986
>d5easa2 a.128.1.3 (A:221-548) 5-Epi-aristolochene synthase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ps1a_ a.128.1.4 (A:) Pentalenene synthase {Streptomyces sp., UC5319 [TaxId: 1931]} Back     information, alignment and structure
>d1di1a_ a.128.1.4 (A:) Aristolochene synthase {Fungus (Penicillium roqueforti) [TaxId: 5082]} Back     information, alignment and structure
>d1kiya_ a.128.1.5 (A:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]} Back     information, alignment and structure
>d2q80a1 a.128.1.1 (A:6-296) Geranylgeranyl pyrophosphate synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpsa_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure