Citrus Sinensis ID: 041966

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280
MDERLFETVLKGETPNFLNLVQKDEEIIKQTVPGSLNTVLHLAARYGHEELALEILKLCPEMLAATNEKLETPVHEACREGRLHIVRLFLETDSWVVHKMNRNKESALYVACERGRLDVVKQLLNYPSVSLLEMDDGLTTSLHVAASAGHLEIVNELLEARPEFTWKKDPNGRTPLTLCSSKGHLEITRELLKMDPDLSSSQDNEGRTPLHWATIKGRVNIIDEILSVNLESSEIRTLHGETVLHLGVKNNQYEAVKHLMETLNTTKLVNTPDNDGNTIL
ccHHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccHHHccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccccc
cccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccHHHcccccccccccc
MDERLFETVlkgetpnflnlvqKDEEiikqtvpgslNTVLHLAARYGHEELALEILKLCPEMLAATNekletpvheacREGRLHIVRLFLETDSWVVHKMNRNKESALYVACERGRLDVVKQLlnypsvsllemddglTTSLHVAASAGHLEIVNELLEarpeftwkkdpngrtpltlcsskgHLEITRELLkmdpdlsssqdnegrtplhwatIKGRVNIIDEILSVnlesseirtlhgetvlhlgvknNQYEAVKHLMETLNTtklvntpdndgntil
MDERLFetvlkgetpnflnlVQKDEEIIKQTVPGSLNTVLHLAARYGHEELALEILKLCPEMLAATNEKLETPVHEACREGRLHIVRLFLETDSWVVHKMNRNKESALYVACERGRLDVVKQLLNYPSVSLLEMDDGLTTSLHVAASAGHLEIVNELLEARPEftwkkdpngrtpltlcsskGHLEITRELLKMDPDlsssqdnegrtplhwatikgrvNIIDEILSVNLESSEIRTLHGETVLHLGVKNNQYEAVKHLMEtlnttklvntpdndgntil
MDERLFETVLKGETPNFLNLVQKDEEIIKQTVPGSLNTVLHLAARYGHEELALEILKLCPEMLAATNEKLETPVHEACREGRLHIVRLFLETDSWVVHKMNRNKESALYVACERGRLDVVKQLLNYPSVSLLEMDDGLTTSLHVAASAGHLEIVNELLEARPEFTWKKDPNGRTPLTLCSSKGHLEITRELLKMDPDLSSSQDNEGRTPLHWATIKGRVNIIDEILSVNLESSEIRTLHGETVLHLGVKNNQYEAVKHLMETLNTTKLVNTPDNDGNTIL
*******TVLKGETPNFLNLVQKDEEIIKQTVPGSLNTVLHLAARYGHEELALEILKLCPEMLAATNEKLETPVHEACREGRLHIVRLFLETDSWVVHKMNRNKESALYVACERGRLDVVKQLLNYPSVSLLEMDDGLTTSLHVAASAGHLEIVNELLEARPEFTWKK*******LTLC*****************************PLHWATIKGRVNIIDEILSVNLESSEIRTLHGETVLHLGVKNNQYEAVKHLMETLNTTK*************
MDERLFETVLKGETPNFLNLVQKDEEIIKQTVPGSLNTVLHLAARYGHEELALEILKLCPEMLAATNEKLETPVHEACREGRLHIVRLFLETDSWVVHKMNRNKESALYVACERGRLDVVKQLLNYPSVSLLEMDDGLTTSLHVAASAGHLEIVNELLEARPEFTWKKDPNGRTPLTLCSSKGHLEITRELLKMDPDLSSSQDNEGRTPLHWATIKGRVNIIDEILSVNLESSEIRTLHGETVLHLGVKNNQYEAVKHLMETLNTTKLVNTPDNDGNTIL
MDERLFETVLKGETPNFLNLVQKDEEIIKQTVPGSLNTVLHLAARYGHEELALEILKLCPEMLAATNEKLETPVHEACREGRLHIVRLFLETDSWVVHKMNRNKESALYVACERGRLDVVKQLLNYPSVSLLEMDDGLTTSLHVAASAGHLEIVNELLEARPEFTWKKDPNGRTPLTLCSSKGHLEITRELLKMDPD*********RTPLHWATIKGRVNIIDEILSVNLESSEIRTLHGETVLHLGVKNNQYEAVKHLMETLNTTKLVNTPDNDGNTIL
MDERLFETVLKGETPNFLNLVQKDEEIIKQTVPGSLNTVLHLAARYGHEELALEILKLCPEMLAATNEKLETPVHEACREGRLHIVRLFLETDSWVVHKMNRNKESALYVACERGRLDVVKQLLNYPSVSLLEMDDGLTTSLHVAASAGHLEIVNELLEARPEFTWKKDPNGRTPLTLCSSKGHLEITRELLKMDPDLSSSQDNEGRTPLHWATIKGRVNIIDEILSVNLESSEIRTLHGETVLHLGVKNNQYEAVKHLMETLNT***************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDERLFETVLKGETPNFLNLVQKDEEIIKQTVPGSLNTVLHLAARYGHEELALEILKLCPEMLAATNEKLETPVHEACREGRLHIVRLFLETDSWVVHKMNRNKESALYVACERGRLDVVKQLLNYPSVSLLEMDDGLTTSLHVAASAGHLEIVNELLEARPEFTWKKDPNGRTPLTLCSSKGHLEITRELLKMDPDLSSSQDNEGRTPLHWATIKGRVNIIDEILSVNLESSEIRTLHGETVLHLGVKNNQYEAVKHLMETLNTTKLVNTPDNDGNTIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query280 2.2.26 [Sep-21-2011]
Q6AWW5 524 Ankyrin repeat-containing no no 0.757 0.404 0.328 5e-22
Q9C7A2 590 Ankyrin repeat-containing no no 0.853 0.405 0.297 6e-19
A2AS55361 Ankyrin repeat domain-con yes no 0.892 0.692 0.302 2e-18
Q8N8A2 993 Serine/threonine-protein no no 0.935 0.263 0.297 4e-18
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no no 0.778 0.111 0.290 6e-18
Q5F478 990 Serine/threonine-protein yes no 0.942 0.266 0.285 2e-17
Q12955 4377 Ankyrin-3 OS=Homo sapiens no no 0.778 0.049 0.290 3e-17
Q63618 837 Espin OS=Rattus norvegicu no no 0.803 0.268 0.314 4e-17
B2RXR6 993 Serine/threonine-protein no no 0.935 0.263 0.290 5e-17
Q9ET47 871 Espin OS=Mus musculus GN= no no 0.807 0.259 0.314 8e-17
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function desciption
 Score =  104 bits (260), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 117/222 (52%), Gaps = 10/222 (4%)

Query: 66  TNEKLETPVHEACREGRLHIV-RLFLETDSW----VVHKMNRNKESALYVACERGRLDVV 120
           T  + +TP+H A REG+  ++  +  E D      ++ + N++ E+ALYVA E G  D+V
Sbjct: 13  TARRDDTPLHTAVREGKTDLLLEMIGEHDGVELKELLAEQNQSGETALYVAAEYGYTDMV 72

Query: 121 KQLLNYPSVSLL--EMDDGLTTSLHVAASAGHLEIVNELLEARPEFTWKKDPNGRTPLTL 178
           K L+ +    L   +  +G   + H+AA  G+L++++ L+EA PE ++  D +  T L  
Sbjct: 73  KILMKHSDSVLAGTKAKNGFD-AFHIAAKNGNLQVLDVLIEANPELSFTFDSSKTTALHT 131

Query: 179 CSSKGHLEITRELLKMDPDLSSSQDNEGRTPLHWATIKGRVNIIDEILSVNLESSEIRTL 238
            +S+GH EI   LL    DL++   + G+T LH A   G   I+ +++            
Sbjct: 132 AASQGHGEIVCFLLDKGVDLAAIARSNGKTALHSAARNGHTVIVKKLIEKKAGMVTRVDK 191

Query: 239 HGETVLHLGVKNNQYEAVKHLMETLNTTKLVNTPDNDGNTIL 280
            G+T LH+ VK    E V  LME   +  L+N+ DN GNT L
Sbjct: 192 KGQTALHMAVKGQNTEIVDVLMEADGS--LINSADNKGNTPL 231

Arabidopsis thaliana (taxid: 3702)
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function description
>sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 Back     alignment and function description
>sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 Back     alignment and function description
>sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=2 SV=1 Back     alignment and function description
>sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
359476356 601 PREDICTED: ankyrin repeat-containing pro 0.996 0.464 0.679 1e-107
147765315 580 hypothetical protein VITISV_020094 [Viti 0.996 0.481 0.679 1e-107
224142976 591 predicted protein [Populus trichocarpa] 0.996 0.472 0.65 1e-105
296081888 600 unnamed protein product [Vitis vinifera] 0.996 0.465 0.65 3e-99
225430027 595 PREDICTED: ankyrin repeat-containing pro 0.996 0.468 0.65 3e-99
255550978 595 ankyrin repeat-containing protein, putat 0.996 0.468 0.619 3e-97
296081857 470 unnamed protein product [Vitis vinifera] 0.925 0.551 0.647 1e-96
147812174 574 hypothetical protein VITISV_033967 [Viti 0.917 0.447 0.560 1e-81
147765317251 hypothetical protein VITISV_020096 [Viti 0.85 0.948 0.580 3e-79
359482580 781 PREDICTED: uncharacterized protein LOC10 0.992 0.355 0.396 2e-49
>gi|359476356|ref|XP_003631824.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 191/281 (67%), Positives = 233/281 (82%), Gaps = 2/281 (0%)

Query: 1   MDERLFETVLKGETPNFLNLVQKDEEIIKQTVPGSLNTVLHLAARYGHEELALEILKLCP 60
           MD RLFE VLKG+  +FL+L Q++E+IIKQ VPGSLNTVLHLAAR+GH ELA EI+ L P
Sbjct: 1   MDRRLFEAVLKGDVSSFLSLAQEEEDIIKQVVPGSLNTVLHLAARFGHLELASEIVNLRP 60

Query: 61  EMLAATNEKLETPVHEACREGRLHIVRLFLETDSWVVHKMNRNKESALYVACERGRLDVV 120
           E+ +A NEKLETP+HEACREGR+ IV L ++ D W+  K+NRN ES L+V CERG+LDVV
Sbjct: 61  ELSSAENEKLETPLHEACREGRVEIVALLMKVDQWIAPKVNRNDESVLFVGCERGKLDVV 120

Query: 121 KQLL-NYPSVSLLEMDDGLTTSLHVAASAGHLEIVNELLEARPEFTWKKDPNGRTPLTLC 179
           K LL N+  + +LE+D   TTSLH AAS GH ++V E++  RP+F+WKKD  G TPL L 
Sbjct: 121 KHLLVNHSWLLMLELD-APTTSLHAAASGGHTDVVKEIIRERPDFSWKKDSQGCTPLHLA 179

Query: 180 SSKGHLEITRELLKMDPDLSSSQDNEGRTPLHWATIKGRVNIIDEILSVNLESSEIRTLH 239
            SKGHLEITRELL++DPDL+S QDN+GRTPLHWA +KGRVNIIDEILSV+L+S+E+RT H
Sbjct: 180 CSKGHLEITRELLRLDPDLTSLQDNDGRTPLHWAAMKGRVNIIDEILSVSLQSAEMRTEH 239

Query: 240 GETVLHLGVKNNQYEAVKHLMETLNTTKLVNTPDNDGNTIL 280
           GETVLHL VKNNQYEAVK+L ETLN ++L+NTPD+DGNTIL
Sbjct: 240 GETVLHLAVKNNQYEAVKYLTETLNISQLLNTPDSDGNTIL 280

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147765315|emb|CAN66947.1| hypothetical protein VITISV_020094 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224142976|ref|XP_002324803.1| predicted protein [Populus trichocarpa] gi|222866237|gb|EEF03368.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296081888|emb|CBI20893.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225430027|ref|XP_002281561.1| PREDICTED: ankyrin repeat-containing protein At3g12360 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255550978|ref|XP_002516537.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223544357|gb|EEF45878.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296081857|emb|CBI20862.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147812174|emb|CAN61518.1| hypothetical protein VITISV_033967 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147765317|emb|CAN66949.1| hypothetical protein VITISV_020096 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482580|ref|XP_002278844.2| PREDICTED: uncharacterized protein LOC100258390 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
TAIR|locus:2012873 578 AT1G10340 "AT1G10340" [Arabido 0.957 0.463 0.339 4e-30
TAIR|locus:2046628 601 AT2G24600 "AT2G24600" [Arabido 0.960 0.447 0.308 1e-28
TAIR|locus:2026489 543 AT1G07710 "AT1G07710" [Arabido 0.953 0.491 0.308 4.9e-28
TAIR|locus:2009046 573 AT1G34050 "AT1G34050" [Arabido 0.964 0.471 0.294 9.9e-26
TAIR|locus:2157553 598 AT5G54710 "AT5G54710" [Arabido 0.946 0.443 0.286 2.8e-23
TAIR|locus:2045233 662 AT2G31820 [Arabidopsis thalian 0.867 0.367 0.298 3.6e-23
TAIR|locus:2075009 607 AT3G09550 [Arabidopsis thalian 0.653 0.301 0.338 1.7e-22
UNIPROTKB|Q8N8A2 993 ANKRD44 "Serine/threonine-prot 0.942 0.265 0.288 9.1e-22
TAIR|locus:2031948 627 AT1G05640 "AT1G05640" [Arabido 0.9 0.401 0.314 2.2e-21
MGI|MGI:2444796361 Ankrd16 "ankyrin repeat domain 0.778 0.603 0.320 3.9e-21
TAIR|locus:2012873 AT1G10340 "AT1G10340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 338 (124.0 bits), Expect = 4.0e-30, P = 4.0e-30
 Identities = 97/286 (33%), Positives = 148/286 (51%)

Query:     5 LFETVLKGETPNFLNLVQKDEEIIKQ-TVPGSLN-TVLHLAARYGHEELALEILKLCPEM 62
             +F  +LK + P FL LV+  E  +++      LN TVLH+AA++GH EL  +I++L P +
Sbjct:     4 IFHAILKNDLPAFLELVEDSESSLEERNEEEHLNNTVLHMAAKFGHRELVSKIIELRPSL 63

Query:    63 LAATNEKLETPVHEACREGRLHIVRLFLETDSWVVHKMNRNKESALYVACERGRLDVVKQ 122
             +++ N    TP+H A   G ++IV   LET   V    N N  + L++AC    ++  + 
Sbjct:    64 VSSRNAYRNTPLHLAAILGDVNIVMQMLETGLEVCSARNINNHTPLHLACRSNSIEAAR- 122

Query:   123 LLNYPSVSLLEMDDGLTTSLHVAASAGHLEIVNELLEARPEFT----WK-KDPNGRTPLT 177
             L+   + S+     GL   L +A S+G   IV  +LE  P+      W  +D +  T L 
Sbjct:   123 LIAEKTQSI-----GLG-ELILAISSGSTSIVGTILERFPDLAREEAWVVEDGSQSTLLH 176

Query:   178 LCSSKGHLEITRELLKMDPDLSSSQDNEGRTPLHWATIKGRVNIIDEILS-VNLESSEIR 236
                 KG  E+T  LL +D  L  + +  G +PLH A ++G V I++E L  V L  S I 
Sbjct:   177 HACDKGDFELTTILLGLDQGLEEALNPNGLSPLHLAVLRGSVVILEEFLDKVPLSFSSI- 235

Query:   237 TLHGETVLHLGVKNNQYEAVKHLMETL--NTTKLVNTPDNDGNTIL 280
             T   ETV HL  +N   +A   + E+L  N+  L+   D  GNT+L
Sbjct:   236 TPSKETVFHLAARNKNMDAFVFMAESLGINSQILLQQTDESGNTVL 281
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0009581 "detection of external stimulus" evidence=RCA
GO:0009595 "detection of biotic stimulus" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2046628 AT2G24600 "AT2G24600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026489 AT1G07710 "AT1G07710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009046 AT1G34050 "AT1G34050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157553 AT5G54710 "AT5G54710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045233 AT2G31820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N8A2 ANKRD44 "Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2031948 AT1G05640 "AT1G05640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:2444796 Ankrd16 "ankyrin repeat domain 16" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-25
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-24
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-21
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-21
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-20
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-14
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-13
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-12
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-11
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-10
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-09
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 7e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-07
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-05
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-04
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 5e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 6e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 7e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.001
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.001
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 96.7 bits (241), Expect = 4e-25
 Identities = 47/126 (37%), Positives = 74/126 (58%), Gaps = 3/126 (2%)

Query: 101 NRNKESALYVACERGRLDVVKQLLNYPSVSLLEMDDGLTTSLHVAASAGHLEIVNELLEA 160
           + +  + L++A   G L+VVK LL   +    + +DG T  LH+AA  GHLEIV  LLE 
Sbjct: 4   DEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRT-PLHLAAKNGHLEIVKLLLEK 62

Query: 161 RPEFTWKKDPNGRTPLTLCSSKGHLEITRELLKMDPDLSSSQDNEGRTPLHWATIKGRVN 220
             +    +D +G TPL L +  G+L++ + LLK   D+++ +D +GRTPLH A   G + 
Sbjct: 63  GADVN-ARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNA-RDKDGRTPLHLAAKNGHLE 120

Query: 221 IIDEIL 226
           ++  +L
Sbjct: 121 VVKLLL 126

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 280
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02946 446 ankyin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
PHA02792 631 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
KOG0508 615 consensus Ankyrin repeat protein [General function 99.98
PHA02859209 ankyrin repeat protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.97
KOG0508 615 consensus Ankyrin repeat protein [General function 99.97
PHA02795 437 ankyrin-like protein; Provisional 99.97
PHA02795 437 ankyrin-like protein; Provisional 99.97
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.97
PHA02792 631 ankyrin-like protein; Provisional 99.96
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.96
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.96
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.96
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.95
PLN03192823 Voltage-dependent potassium channel; Provisional 99.95
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.95
PLN03192823 Voltage-dependent potassium channel; Provisional 99.94
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.93
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.93
KOG0514452 consensus Ankyrin repeat protein [General function 99.92
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.92
KOG0514452 consensus Ankyrin repeat protein [General function 99.91
PHA02743166 Viral ankyrin protein; Provisional 99.91
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.9
PHA02741169 hypothetical protein; Provisional 99.9
PHA02743166 Viral ankyrin protein; Provisional 99.9
PHA02741169 hypothetical protein; Provisional 99.89
PHA02884300 ankyrin repeat protein; Provisional 99.87
PHA02884300 ankyrin repeat protein; Provisional 99.87
PHA02736154 Viral ankyrin protein; Provisional 99.87
PHA02736154 Viral ankyrin protein; Provisional 99.86
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.86
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.85
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.84
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.81
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.81
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.81
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.8
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.78
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.76
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.75
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.71
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.65
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.62
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.62
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.59
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.59
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.57
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.53
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.53
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.51
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.51
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.51
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.45
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.41
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 99.22
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.03
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 99.01
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.91
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.91
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.86
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.86
PF1360630 Ank_3: Ankyrin repeat 98.84
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.84
PF1360630 Ank_3: Ankyrin repeat 98.82
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.8
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.77
KOG0522 560 consensus Ankyrin repeat protein [General function 98.72
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.7
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.64
KOG0522 560 consensus Ankyrin repeat protein [General function 98.56
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.55
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.54
KOG0511 516 consensus Ankyrin repeat protein [General function 98.42
KOG2384 223 consensus Major histocompatibility complex protein 98.31
KOG2384223 consensus Major histocompatibility complex protein 98.24
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.18
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.08
KOG0511 516 consensus Ankyrin repeat protein [General function 98.07
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.05
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.01
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.55
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.21
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.0
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.93
KOG2505591 consensus Ankyrin repeat protein [General function 96.65
KOG2505591 consensus Ankyrin repeat protein [General function 96.48
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.27
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 96.12
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 96.07
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.83
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 95.19
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 93.74
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 81.0
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.6e-46  Score=306.09  Aligned_cols=269  Identities=22%  Similarity=0.331  Sum_probs=238.5

Q ss_pred             CChHHHHHHHcCChhHHHHHHhhcHHHHhhhcCCCCcchhHHHHhcCCHHHHHHHHHhChhhhhcccccCcchHHHHHhc
Q 041966            1 MDERLFETVLKGETPNFLNLVQKDEEIIKQTVPGSLNTVLHLAARYGHEELALEILKLCPEMLAATNEKLETPVHEACRE   80 (280)
Q Consensus         1 ~~~~l~~a~~~g~~~~~~~ll~~~~~~~~~~~~~~g~~~L~~A~~~g~~~~~~~ll~~~~~~~~~~~~~g~t~L~~A~~~   80 (280)
                      |+..|..|+..|+++.++.+++..+.... ..+..|.||||.|+..|+.+++++|++.|++ ++..+..|.||||.|+..
T Consensus         1 ~~~~l~~ai~~gd~~~v~~ll~~~~~~~n-~~~~~~~tpL~~A~~~g~~~iv~~Ll~~Ga~-~n~~~~~~~t~L~~A~~~   78 (434)
T PHA02874          1 ASQDLRMCIYSGDIEAIEKIIKNKGNCIN-ISVDETTTPLIDAIRSGDAKIVELFIKHGAD-INHINTKIPHPLLTAIKI   78 (434)
T ss_pred             CcHHHHHHHhcCCHHHHHHHHHcCCCCCC-CcCCCCCCHHHHHHHcCCHHHHHHHHHCCCC-CCCCCCCCCCHHHHHHHc
Confidence            56789999999999999999987766433 3467889999999999999999999999988 788899999999999999


Q ss_pred             CcHHHHHHHHhcChhh----------------------hhhhhhcCCCHHHHHHhcCcHHHHHHHHcCCCccccccccCC
Q 041966           81 GRLHIVRLFLETDSWV----------------------VHKMNRNKESALYVACERGRLDVVKQLLNYPSVSLLEMDDGL  138 (280)
Q Consensus        81 ~~~~~v~~Ll~~~~~~----------------------~~~~~~~~~t~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~~  138 (280)
                      |+.+++++|++.|++.                      .+..+..|.||||+|+..|+.+++++|++.+. ..+..+..|
T Consensus        79 ~~~~iv~~Ll~~g~~~~~~~~~~~~~~~i~~ll~~g~d~n~~~~~g~T~Lh~A~~~~~~~~v~~Ll~~ga-d~n~~d~~g  157 (434)
T PHA02874         79 GAHDIIKLLIDNGVDTSILPIPCIEKDMIKTILDCGIDVNIKDAELKTFLHYAIKKGDLESIKMLFEYGA-DVNIEDDNG  157 (434)
T ss_pred             CCHHHHHHHHHCCCCCCcchhccCCHHHHHHHHHCcCCCCCCCCCCccHHHHHHHCCCHHHHHHHHhCCC-CCCCcCCCC
Confidence            9999999999887532                      34457789999999999999999999999854 456677889


Q ss_pred             chHHHHHHhcCCHHHHHHHHHhCCCCccCCCCCCCcHHHHHHhcCcHHHHHHHHhcCCCCCCCCCCCCCChhhhHhhcCC
Q 041966          139 TTSLHVAASAGHLEIVNELLEARPEFTWKKDPNGRTPLTLCSSKGHLEITRELLKMDPDLSSSQDNEGRTPLHWATIKGR  218 (280)
Q Consensus       139 ~~~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~g~~~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~g~t~l~~a~~~~~  218 (280)
                      .||||+|+..++.+++++|++.|++++ ..+..|.||||+|+..|+.+++++|++.|+++.. .+..|.||||.|+..+.
T Consensus       158 ~tpLh~A~~~~~~~iv~~Ll~~g~~~n-~~~~~g~tpL~~A~~~g~~~iv~~Ll~~g~~i~~-~~~~g~TpL~~A~~~~~  235 (434)
T PHA02874        158 CYPIHIAIKHNFFDIIKLLLEKGAYAN-VKDNNGESPLHNAAEYGDYACIKLLIDHGNHIMN-KCKNGFTPLHNAIIHNR  235 (434)
T ss_pred             CCHHHHHHHCCcHHHHHHHHHCCCCCC-CCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCcC-CCCCCCCHHHHHHHCCh
Confidence            999999999999999999999999987 7889999999999999999999999999999865 78899999999998765


Q ss_pred             hhhHHHHHHhcccchhhhhhcCCchHHHHHhcC-cHHHHHHHHHhcccccccCCCCCCCCCCC
Q 041966          219 VNIIDEILSVNLESSEIRTLHGETVLHLGVKNN-QYEAVKHLMETLNTTKLVNTPDNDGNTIL  280 (280)
Q Consensus       219 ~~~~~~Ll~~~~~~~~~~~~~g~t~l~~a~~~~-~~~~~~~Ll~~~~~~~~~~~~d~~g~t~L  280 (280)
                       +.+++|+. + .+++.+|..|.||||+|+..+ +.+++++|++.   |++++.+|..|+|||
T Consensus       236 -~~i~~Ll~-~-~~in~~d~~G~TpLh~A~~~~~~~~iv~~Ll~~---gad~n~~d~~g~TpL  292 (434)
T PHA02874        236 -SAIELLIN-N-ASINDQDIDGSTPLHHAINPPCDIDIIDILLYH---KADISIKDNKGENPI  292 (434)
T ss_pred             -HHHHHHHc-C-CCCCCcCCCCCCHHHHHHhcCCcHHHHHHHHHC---cCCCCCCCCCCCCHH
Confidence             56677764 4 567889999999999999875 88999999998   556999999999996

>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 9e-18
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-15
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 7e-15
3b7b_A 237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-04
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 7e-14
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 7e-11
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-13
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 1e-13
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 9e-10
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-13
2xeh_A157 Structural Determinants For Improved Thermal Stabil 6e-10
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-12
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-12
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 6e-11
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 4e-12
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 7e-08
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 5e-12
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 6e-12
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 7e-12
1uoh_A226 Human Gankyrin Length = 226 8e-12
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 8e-12
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 8e-12
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 9e-12
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 9e-12
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 6e-11
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-11
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-11
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-11
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 4e-11
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-10
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 5e-11
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 8e-11
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-10
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-10
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 9e-08
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 3e-10
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 5e-10
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-10
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-10
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 4e-10
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 6e-10
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 1e-09
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 3e-09
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 4e-09
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 6e-09
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 2e-08
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 7e-04
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-08
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 8e-08
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-07
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 8e-06
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-07
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 9e-06
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 3e-07
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 3e-07
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 3e-07
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 5e-07
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 7e-07
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 1e-06
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 2e-06
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 4e-06
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 5e-06
3so8_A162 Crystal Structure Of Ankra Length = 162 5e-06
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 5e-06
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 6e-06
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 6e-06
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 7e-06
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 9e-06
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 9e-06
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 1e-05
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 1e-05
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-05
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 5e-05
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 5e-05
3utm_A 351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 6e-05
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 1e-04
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 1e-04
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 1e-04
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 1e-04
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 2e-04
3uxg_A172 Crystal Structure Of Rfxank Length = 172 2e-04
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 7e-04
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 8e-04
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure 
Iteration: 1

 Score = 87.0 bits (214), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 72/123 (58%), Gaps = 3/123 (2%)
Query: 140 TSLHVAASAGHLEIVNELLEARPEFTWKKDPNGRTPLTLCSSKGHLEITRELLKMDPDLS 199
           T LH+AA  GHLE+V  LLEA  +   K D NGRTPL L +  GHLE+ + LL+   D+ 
Sbjct: 4   TPLHLAARNGHLEVVKLLLEAGADVNAK-DKNGRTPLHLAARNGHLEVVKLLLEAGADV- 61
Query: 200 SSQDNEGRTPLHWATIKGRVNIIDEILSVNLESSEIRTLHGETVLHLGVKNNQYEAVKHL 259
           +++D  GRTPLH A   G + ++  +L    + +  +  +G T LHL  +N   E VK L
Sbjct: 62  NAKDKNGRTPLHLAARNGHLEVVKLLLEAGADVN-AKDKNGRTPLHLAARNGHLEVVKLL 120
Query: 260 MET 262
           +E 
Sbjct: 121 LEA 123
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-41
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-41
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-40
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-37
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-30
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-38
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-32
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-29
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-28
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-38
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 7e-36
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-35
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 5e-33
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-31
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-27
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-24
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-22
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-38
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-35
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-37
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-31
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-37
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-33
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-33
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-28
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-23
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-36
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-26
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-25
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-36
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-36
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-34
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-33
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-26
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-13
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-35
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-34
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-29
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-23
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-35
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-33
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-28
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 2e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-35
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-30
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-30
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-28
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-20
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-35
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-32
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-34
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-32
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-30
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-26
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-22
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-20
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-33
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-32
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-32
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-27
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-18
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-33
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-31
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-18
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 4e-08
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-33
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-31
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-31
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-25
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-19
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-13
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-13
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-33
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-32
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-18
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-15
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-13
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-31
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-26
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-24
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-24
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-14
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-07
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-31
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-29
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-27
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-23
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-30
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-29
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-27
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-18
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-30
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-29
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-26
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-25
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-29
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-25
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-24
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-19
2rfm_A 192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-29
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-23
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-19
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-18
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 2e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-28
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-20
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 8e-20
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-13
2rfa_A232 Transient receptor potential cation channel subfa 1e-27
2rfa_A232 Transient receptor potential cation channel subfa 5e-25
2rfa_A232 Transient receptor potential cation channel subfa 5e-25
2rfa_A232 Transient receptor potential cation channel subfa 1e-11
2rfa_A 232 Transient receptor potential cation channel subfa 3e-11
2rfa_A 232 Transient receptor potential cation channel subfa 7e-07
2rfa_A232 Transient receptor potential cation channel subfa 9e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-26
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-23
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-22
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-20
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 2e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-26
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-24
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-21
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-26
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-23
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-22
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-08
2pnn_A273 Transient receptor potential cation channel subfa 8e-26
2pnn_A273 Transient receptor potential cation channel subfa 5e-23
2pnn_A273 Transient receptor potential cation channel subfa 4e-16
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-25
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-22
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-22
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-12
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-25
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-25
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-22
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-21
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-13
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-25
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-20
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-19
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-25
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-19
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-14
3deo_A 183 Signal recognition particle 43 kDa protein; chloro 2e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-24
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-23
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-21
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-24
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-23
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-23
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-11
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-23
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-20
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-15
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-15
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-08
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-22
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-22
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-21
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-09
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-22
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-22
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-20
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-14
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-04
2etb_A256 Transient receptor potential cation channel subfam 2e-22
2etb_A256 Transient receptor potential cation channel subfam 2e-22
2etb_A256 Transient receptor potential cation channel subfam 3e-18
2etb_A 256 Transient receptor potential cation channel subfam 2e-06
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-22
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-17
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-14
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-09
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-21
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-21
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-20
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-15
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-15
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-21
1awc_B153 Protein (GA binding protein beta 1); complex (tran 8e-21
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-20
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-19
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 9e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-19
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-18
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-14
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-14
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-18
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-16
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-13
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-08
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-07
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-18
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-17
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-16
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-17
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-14
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 5e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 5e-06
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  147 bits (374), Expect = 1e-41
 Identities = 74/256 (28%), Positives = 105/256 (41%), Gaps = 33/256 (12%)

Query: 37  NTVLHLAARYGHEELALEILKLCPEML----AATNEK---LETPVHEACREGRLHIVRLF 89
            T LH+AAR GH E+A        + L    A  N K    +TP+H A R G  ++V+L 
Sbjct: 48  ETPLHMAARAGHTEVA--------KYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLL 99

Query: 90  LETDSWVVHKMNRNKESALYVACERGRLDVVKQLLNYPSVSLLEMDDGLTTSLHVAASAG 149
           LE ++   +       + L++A   G ++ V  LL     S   M     T LHVAA  G
Sbjct: 100 LENNA-NPNLATTAGHTPLHIAAREGHVETVLALLEK-EASQACMTKKGFTPLHVAAKYG 157

Query: 150 HLEIVNELLEARPEFTWKKDPNGRTPLTLCSSKGHLEITRELLKMDPDLSSSQDNEGRTP 209
            + +   LLE           NG TPL +     +L+I + LL        S    G TP
Sbjct: 158 KVRVAELLLERDAHPN-AAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSP-HSPAWNGYTP 215

Query: 210 LHWATIKGRVNIIDEILS----VNLESSEIRTLHGETVLHLGVKNNQYEAVKHLMET-LN 264
           LH A  + +V +   +L      N       ++ G T LHL  +    E V  L+    N
Sbjct: 216 LHIAAKQNQVEVARSLLQYGGSAN-----AESVQGVTPLHLAAQEGHAEMVALLLSKQAN 270

Query: 265 TTKLVNTPDNDGNTIL 280
                N  +  G T L
Sbjct: 271 ----GNLGNKSGLTPL 282
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 100.0
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.98
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.98
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.98
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.96
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.95
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.94
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.92
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.92
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.92
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.92
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.91
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.91
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.91
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.91
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.9
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.9
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.88
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.88
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.88
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.86
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.86
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.85
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.79
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.77
3gvo_A351 Pumilio 2, pumilio homolog 2; RNA-binding, PUF dom 94.47
3k49_A369 MRNA-binding protein PUF3; PUF3, pumilio, RNA bind 91.09
3gvo_A351 Pumilio 2, pumilio homolog 2; RNA-binding, PUF dom 89.1
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=2e-48  Score=301.15  Aligned_cols=264  Identities=21%  Similarity=0.233  Sum_probs=238.7

Q ss_pred             hHHHHHHHcCChhHHHHHHhhcHHHHhhhcCCCCcchhHHHHhcCCHHHHHHHHHhChhhhhcccccCcchHHHHHhcCc
Q 041966            3 ERLFETVLKGETPNFLNLVQKDEEIIKQTVPGSLNTVLHLAARYGHEELALEILKLCPEMLAATNEKLETPVHEACREGR   82 (280)
Q Consensus         3 ~~l~~a~~~g~~~~~~~ll~~~~~~~~~~~~~~g~~~L~~A~~~g~~~~~~~ll~~~~~~~~~~~~~g~t~L~~A~~~~~   82 (280)
                      .+|+.|++.|+.+.++.+++.+.... ...+..|.||||+|+..|+.+++++|++.+.+ ++..+..|.||||+|+..|+
T Consensus         7 ~~L~~A~~~g~~~~v~~Ll~~g~~~~-~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~-~~~~~~~g~t~L~~A~~~~~   84 (285)
T 1wdy_A            7 HLLIKAVQNEDVDLVQQLLEGGANVN-FQEEEGGWTPLHNAVQMSREDIVELLLRHGAD-PVLRKKNGATPFLLAAIAGS   84 (285)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHTTCCTT-CCCTTTCCCHHHHHHHTTCHHHHHHHHHTTCC-TTCCCTTCCCHHHHHHHHTC
T ss_pred             hHHHHHHHcCCHHHHHHHHHcCCCcc-cccCCCCCcHHHHHHHcCCHHHHHHHHHcCCC-CcccCCCCCCHHHHHHHcCC
Confidence            57999999999999999999887642 23367899999999999999999999999988 78899999999999999999


Q ss_pred             HHHHHHHHhcChhhhhhhhhcCCCHHHHHHhcCcHHHHHHHHcCCCcccccc---------ccCCchHHHHHHhcCCHHH
Q 041966           83 LHIVRLFLETDSWVVHKMNRNKESALYVACERGRLDVVKQLLNYPSVSLLEM---------DDGLTTSLHVAASAGHLEI  153 (280)
Q Consensus        83 ~~~v~~Ll~~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~Ll~~~~~~~~~~---------~~~~~~~l~~a~~~~~~~~  153 (280)
                      .+++++|++.++ ..+..+..|.||||+|+..|+.+++++|++.+.......         +..|.||||+|+..++.++
T Consensus        85 ~~~v~~Ll~~g~-~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~~~~~~~~~g~t~L~~A~~~~~~~~  163 (285)
T 1wdy_A           85 VKLLKLFLSKGA-DVNECDFYGFTAFMEAAVYGKVKALKFLYKRGANVNLRRKTKEDQERLRKGGATALMDAAEKGHVEV  163 (285)
T ss_dssp             HHHHHHHHHTTC-CTTCBCTTCCBHHHHHHHTTCHHHHHHHHHTTCCTTCCCCCCHHHHHTTCCCCCHHHHHHHHTCHHH
T ss_pred             HHHHHHHHHcCC-CCCccCcccCCHHHHHHHhCCHHHHHHHHHhCCCcccccccHHHHHhhccCCCcHHHHHHHcCCHHH
Confidence            999999999998 566778999999999999999999999999865443321         6778899999999999999


Q ss_pred             HHHHHHh-CCCCccCCCCCCCcHHHHHHhcCc----HHHHHHHHhcCCCCCCCCCCCCCChhhhHhhcCChhhHHHHHHh
Q 041966          154 VNELLEA-RPEFTWKKDPNGRTPLTLCSSKGH----LEITRELLKMDPDLSSSQDNEGRTPLHWATIKGRVNIIDEILSV  228 (280)
Q Consensus       154 ~~~ll~~-~~~~~~~~~~~g~~~l~~a~~~~~----~~~~~~Ll~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~Ll~~  228 (280)
                      +++|++. |.+++ ..+..|.||||+|+..++    .+++++|+++|++++. .+..|.||||+|+..++.+++++|++.
T Consensus       164 v~~Ll~~~~~~~~-~~~~~g~t~l~~a~~~~~~~~~~~i~~~Ll~~g~~~~~-~~~~g~t~L~~A~~~~~~~~v~~Ll~~  241 (285)
T 1wdy_A          164 LKILLDEMGADVN-ACDNMGRNALIHALLSSDDSDVEAITHLLLDHGADVNV-RGERGKTPLILAVEKKHLGLVQRLLEQ  241 (285)
T ss_dssp             HHHHHHTSCCCTT-CCCTTSCCHHHHHHHCSCTTTHHHHHHHHHHTTCCSSC-CCTTSCCHHHHHHHTTCHHHHHHHHHS
T ss_pred             HHHHHHhcCCCCC-ccCCCCCCHHHHHHHccccchHHHHHHHHHHcCCCCCC-cCCCCCcHHHHHHHcCCHHHHHHHHhc
Confidence            9999998 88887 889999999999999999    8999999999999875 889999999999999999999999996


Q ss_pred             cccchhhhhhcCCchHHHHHhcCcHHHHHHHHHhcccccccCCCCC
Q 041966          229 NLESSEIRTLHGETVLHLGVKNNQYEAVKHLMETLNTTKLVNTPDN  274 (280)
Q Consensus       229 ~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~d~  274 (280)
                      .+.+++.+|..|.||||+|++.++.+++++|+++|+   +++.+|.
T Consensus       242 ~g~~~~~~~~~g~t~l~~A~~~~~~~i~~~Ll~~Ga---~~~~~d~  284 (285)
T 1wdy_A          242 EHIEINDTDSDGKTALLLAVELKLKKIAELLCKRGA---STDCGDL  284 (285)
T ss_dssp             SSCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHHSS---CSCCSSC
T ss_pred             cCCCccccCCCCCcHHHHHHHcCcHHHHHHHHHcCC---CCCcccc
Confidence            668889999999999999999999999999999955   4777763
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3gvo_A Pumilio 2, pumilio homolog 2; RNA-binding, PUF domain, RNA binding protein; HET: DTD; 1.60A {Mus musculus} SCOP: a.118.1.8 PDB: 3gvt_A 3q0q_A 3q0r_A 3q0s_A 1ib2_A 1m8w_A 1m8x_A 1m8y_A 1m8z_A 3q0l_A 3q0m_A 3q0n_A 3q0o_A 3q0p_A 2yjy_A 3bsx_A 3bsb_A 3h3d_X Back     alignment and structure
>3k49_A MRNA-binding protein PUF3; PUF3, pumilio, RNA binding, mitochondrial mRNA,, membrane, mitochondrion; HET: CIT; 2.50A {Saccharomyces cerevisiae} SCOP: a.118.1.0 PDB: 3k4e_A Back     alignment and structure
>3gvo_A Pumilio 2, pumilio homolog 2; RNA-binding, PUF domain, RNA binding protein; HET: DTD; 1.60A {Mus musculus} SCOP: a.118.1.8 PDB: 3gvt_A 3q0q_A 3q0r_A 3q0s_A 1ib2_A 1m8w_A 1m8x_A 1m8y_A 1m8z_A 3q0l_A 3q0m_A 3q0n_A 3q0o_A 3q0p_A 2yjy_A 3bsx_A 3bsb_A 3h3d_X Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 280
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-26
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-22
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-20
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-24
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-19
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-19
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-14
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-10
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.003
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-18
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-11
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-18
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-07
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-18
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-05
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.001
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-17
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-16
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-16
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-14
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-14
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-13
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-09
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 6e-12
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 8e-10
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-08
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 9e-08
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 4e-07
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 9e-07
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 5e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 9e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 8e-05
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 5e-05
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.002
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  104 bits (260), Expect = 2e-26
 Identities = 68/275 (24%), Positives = 106/275 (38%), Gaps = 40/275 (14%)

Query: 38  TVLHLAARYGHEELALEILKLCPEMLAATNEKLETPVHEACREGRLHIVRLFLETDSWVV 97
           T LH+A+  GH  +   +L+        +N K+ETP+H A R G   + +  L+  +  V
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGAS-PNVSNVKVETPLHMAARAGHTEVAKYLLQNKAK-V 59

Query: 98  HKMNRNKESALYVACERGRLDVVKQLLNYPS----------------------------- 128
           +   ++ ++ L+ A   G  ++VK LL   +                             
Sbjct: 60  NAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALL 119

Query: 129 ---VSLLEMDDGLTTSLHVAASAGHLEIVNELLEARPEFTWKKDPNGRTPLTLCSSKGHL 185
               S   M     T LHVAA  G + +   LLE           NG TPL +     +L
Sbjct: 120 EKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPN-AAGKNGLTPLHVAVHHNNL 178

Query: 186 EITRELLKMDPDLSSSQDNEGRTPLHWATIKGRVNIIDEILSVNLESSEIRTLHGETVLH 245
           +I + LL        S    G TPLH A  + +V +   +L     S+   ++ G T LH
Sbjct: 179 DIVKLLLPRGGSP-HSPAWNGYTPLHIAAKQNQVEVARSLLQYG-GSANAESVQGVTPLH 236

Query: 246 LGVKNNQYEAVKHLMETLNTTKLVNTPDNDGNTIL 280
           L  +    E V  L+   +     N  +  G T L
Sbjct: 237 LAAQEGHAEMVALLL---SKQANGNLGNKSGLTPL 268
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 100.0
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 100.0
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.97
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.97
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.96
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.95
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.95
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.94
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.93
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.9
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.7e-44  Score=288.85  Aligned_cols=268  Identities=29%  Similarity=0.374  Sum_probs=203.7

Q ss_pred             HHHHHHHcCChhHHHHHHhhcHHHHhhhcCCCCcchhHHHHhcCCHHHHHHHHHhChhhhhcccccCcchHHHHHhcCcH
Q 041966            4 RLFETVLKGETPNFLNLVQKDEEIIKQTVPGSLNTVLHLAARYGHEELALEILKLCPEMLAATNEKLETPVHEACREGRL   83 (280)
Q Consensus         4 ~l~~a~~~g~~~~~~~ll~~~~~~~~~~~~~~g~~~L~~A~~~g~~~~~~~ll~~~~~~~~~~~~~g~t~L~~A~~~~~~   83 (280)
                      |||.|+..|+.+.|+.|++.+.+.  ...+..|.||||+|+..|+.+++++|+++|++ ++..+..|.||||+|+..|+.
T Consensus         3 pL~~Aa~~g~~~~v~~Ll~~g~~i--n~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gad-i~~~~~~g~t~L~~A~~~g~~   79 (408)
T d1n11a_           3 PLHVASFMGHLPIVKNLLQRGASP--NVSNVKVETPLHMAARAGHTEVAKYLLQNKAK-VNAKAKDDQTPLHCAARIGHT   79 (408)
T ss_dssp             HHHHHHHHTCHHHHHHHHHTTCCS--CCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCC-SSCCCTTSCCHHHHHHHHTCH
T ss_pred             hHHHHHHCcCHHHHHHHHHCCCCC--CCCCCCCCCHHHHHHHcCCHHHHHHHHHCcCC-CCCCCCCCCCHHHHHHHcCCH
Confidence            899999999999999999988664  45678999999999999999999999999987 899999999999999999999


Q ss_pred             HHHHHHHhcChhh-----------------------------------------------------------------hh
Q 041966           84 HIVRLFLETDSWV-----------------------------------------------------------------VH   98 (280)
Q Consensus        84 ~~v~~Ll~~~~~~-----------------------------------------------------------------~~   98 (280)
                      +++++|+......                                                                 .+
T Consensus        80 ~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~~~  159 (408)
T d1n11a_          80 NMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPN  159 (408)
T ss_dssp             HHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTT
T ss_pred             HHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHHcCCCCC
Confidence            9999888643211                                                                 11


Q ss_pred             hhhhcCCCHHHHHHhcCcHHHHHHHHcCCCccc--------------------------------cccccCCchHHHHHH
Q 041966           99 KMNRNKESALYVACERGRLDVVKQLLNYPSVSL--------------------------------LEMDDGLTTSLHVAA  146 (280)
Q Consensus        99 ~~~~~~~t~l~~a~~~~~~~~~~~Ll~~~~~~~--------------------------------~~~~~~~~~~l~~a~  146 (280)
                      ..+..|.+||++|+..++.+++++|+.++....                                ...+..+.||++.|+
T Consensus       160 ~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~~a~  239 (408)
T d1n11a_         160 AAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAA  239 (408)
T ss_dssp             CCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHH
T ss_pred             cCCCcCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCCCCHHHHHH
Confidence            122344555555555555555555554422110                                001222334444455


Q ss_pred             hcCCHHHHHHHHHhCCCCccCCCCCCCcHHHHHHhcCcHHHHHHHHhcCCCCCCCCCCCCCChhhhHhhcCChhhHHHHH
Q 041966          147 SAGHLEIVNELLEARPEFTWKKDPNGRTPLTLCSSKGHLEITRELLKMDPDLSSSQDNEGRTPLHWATIKGRVNIIDEIL  226 (280)
Q Consensus       147 ~~~~~~~~~~ll~~~~~~~~~~~~~g~~~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~Ll  226 (280)
                      ..+..++++++.+.+.... ..+..|.+|++.|+..++.+++++|+++|++++. .+..+.||||.++..++.+++++++
T Consensus       240 ~~~~~~~~~~~~~~~~~~~-~~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~~~~-~~~~~~t~L~~~~~~~~~~~~~~ll  317 (408)
T d1n11a_         240 QEGHAEMVALLLSKQANGN-LGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDA-TTRMGYTPLHVASHYGNIKLVKFLL  317 (408)
T ss_dssp             HTTCHHHHHHHHTTTCCTT-CCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTC-CCSSCCCHHHHHHHSSCSHHHHHHH
T ss_pred             HhCcHhHhhhhhccccccc-cccCCCCChhhhhhhcCcHHHHHHHHHCCCcccc-ccccccccchhhcccCcceeeeeec
Confidence            5555555555555444444 4566677888888888888888888888888765 6777888999999999989999888


Q ss_pred             HhcccchhhhhhcCCchHHHHHhcCcHHHHHHHHHhcccccccCCCCCCCCCCC
Q 041966          227 SVNLESSEIRTLHGETVLHLGVKNNQYEAVKHLMETLNTTKLVNTPDNDGNTIL  280 (280)
Q Consensus       227 ~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~d~~g~t~L  280 (280)
                      +.+ .+++.+|.+|.||||+|++.|+.+++++|+++   |++++.+|.+|+|||
T Consensus       318 ~~g-~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~---GAd~n~~d~~G~t~L  367 (408)
T d1n11a_         318 QHQ-ADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKN---GASPNEVSSDGTTPL  367 (408)
T ss_dssp             HTT-CCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHT---TCCSCCCCSSSCCHH
T ss_pred             ccc-ccccccCCCCCCHHHHHHHcCCHHHHHHHHHC---CCCCCCCCCCCCCHH
Confidence            877 67788999999999999999999999999998   455999999999986
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure