Citrus Sinensis ID: 041968
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 87 | ||||||
| 62421312 | 374 | 3,5-dimethoxyphenol O-methyltransferase | 0.770 | 0.179 | 0.746 | 1e-23 | |
| 75129654 | 366 | RecName: Full=8-hydroxyquercetin 8-O-met | 0.816 | 0.193 | 0.690 | 3e-21 | |
| 3077640 | 356 | O-methyltransferase [Prunus dulcis] | 0.850 | 0.207 | 0.621 | 3e-21 | |
| 225446491 | 357 | PREDICTED: 8-hydroxyquercetin 8-O-methyl | 0.839 | 0.204 | 0.630 | 7e-21 | |
| 147816431 | 357 | hypothetical protein VITISV_020020 [Viti | 0.839 | 0.204 | 0.630 | 8e-21 | |
| 224121884 | 354 | flavonoid o-methyltransferase related [P | 0.839 | 0.206 | 0.643 | 1e-20 | |
| 2282586 | 354 | methyltransferase [Prunus armeniaca] | 0.850 | 0.209 | 0.662 | 1e-20 | |
| 225446499 | 358 | PREDICTED: myricetin O-methyltransferase | 0.850 | 0.206 | 0.594 | 1e-20 | |
| 224135351 | 359 | flavonoid o-methyltransferase [Populus t | 0.839 | 0.203 | 0.643 | 2e-20 | |
| 225446503 | 359 | PREDICTED: 8-hydroxyquercetin 8-O-methyl | 0.850 | 0.206 | 0.594 | 2e-20 |
| >gi|62421312|gb|AAX82431.1| 3,5-dimethoxyphenol O-methyltransferase [Ruta graveolens] | Back alignment and taxonomy information |
|---|
Score = 113 bits (283), Expect = 1e-23, Method: Composition-based stats.
Identities = 50/67 (74%), Positives = 57/67 (85%)
Query: 21 ELLKAQAQVWNCAFNYINSMSLKCAVELGIPDVIHKHGQPMTLSQIASALDIQKNKAHCI 80
EL KAQ QVWNCA N +NS+SLKCAVELGIPD+IH HGQPMTLSQI SAL+IQ NK +
Sbjct: 19 ELFKAQGQVWNCALNCVNSLSLKCAVELGIPDIIHSHGQPMTLSQICSALNIQPNKTQAM 78
Query: 81 QRLMRIL 87
+R+MRIL
Sbjct: 79 ERVMRIL 85
|
Source: Ruta graveolens Species: Ruta graveolens Genus: Ruta Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|75129654|sp|Q6VMW0.1|Q8OMT_MENPI RecName: Full=8-hydroxyquercetin 8-O-methyltransferase; AltName: Full=Flavonol 8-O-methyltransferase gi|38047395|gb|AAR09600.1| flavonoid 8-O-methyltransferase [Mentha x piperita] | Back alignment and taxonomy information |
|---|
| >gi|3077640|emb|CAA11131.1| O-methyltransferase [Prunus dulcis] | Back alignment and taxonomy information |
|---|
| >gi|225446491|ref|XP_002278211.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147816431|emb|CAN61955.1| hypothetical protein VITISV_020020 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224121884|ref|XP_002330677.1| flavonoid o-methyltransferase related [Populus trichocarpa] gi|222872281|gb|EEF09412.1| flavonoid o-methyltransferase related [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|2282586|gb|AAB71213.1| methyltransferase [Prunus armeniaca] | Back alignment and taxonomy information |
|---|
| >gi|225446499|ref|XP_002278398.1| PREDICTED: myricetin O-methyltransferase [Vitis vinifera] gi|302143369|emb|CBI21930.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224135351|ref|XP_002327196.1| flavonoid o-methyltransferase [Populus trichocarpa] gi|222835566|gb|EEE74001.1| flavonoid o-methyltransferase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225446503|ref|XP_002278517.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 87 | ||||||
| UNIPROTKB|Q6VMW0 | 366 | OMT2 "8-hydroxyquercetin 8-O-m | 0.770 | 0.183 | 0.701 | 3.9e-21 | |
| UNIPROTKB|B0EXJ8 | 355 | 16OMT "Tabersonine 16-O-methyl | 0.770 | 0.188 | 0.521 | 5.7e-13 | |
| UNIPROTKB|Q8GSN1 | 348 | Q8GSN1 "Myricetin O-methyltran | 0.770 | 0.192 | 0.522 | 6.9e-13 | |
| UNIPROTKB|Q84KK4 | 365 | HI4'OMT "Isoflavone 4'-O-methy | 0.770 | 0.183 | 0.447 | 4.8e-12 | |
| UNIPROTKB|Q84KK6 | 367 | HI4'OMT "Isoflavone 4'-O-methy | 0.770 | 0.182 | 0.462 | 6.2e-12 | |
| UNIPROTKB|Q84KK5 | 357 | D7OMT "Isoflavone 7-O-methyltr | 0.770 | 0.187 | 0.417 | 2.6e-10 | |
| UNIPROTKB|A8QW53 | 374 | OMT3 "5-pentadecatrienyl resor | 0.770 | 0.179 | 0.373 | 5.7e-08 | |
| TAIR|locus:2132801 | 325 | AT4G35150 [Arabidopsis thalian | 0.735 | 0.196 | 0.362 | 6.9e-07 | |
| TAIR|locus:2132806 | 382 | AT4G35160 [Arabidopsis thalian | 0.735 | 0.167 | 0.347 | 2e-06 |
| UNIPROTKB|Q6VMW0 OMT2 "8-hydroxyquercetin 8-O-methyltransferase" [Mentha x piperita (taxid:34256)] | Back alignment and assigned GO terms |
|---|
Score = 248 (92.4 bits), Expect = 3.9e-21, P = 3.9e-21
Identities = 47/67 (70%), Positives = 57/67 (85%)
Query: 21 ELLKAQAQVWNCAFNYINSMSLKCAVELGIPDVIHKHGQPMTLSQIASALDIQKNKAHCI 80
ELL+AQA VWN ++YINSMSLKCA++LGIPD IHKHG P+TLSQ+A AL+I K K+H +
Sbjct: 12 ELLEAQAHVWNHIYSYINSMSLKCAIQLGIPDAIHKHGNPITLSQLADALNINKAKSHGL 71
Query: 81 QRLMRIL 87
RLMRIL
Sbjct: 72 FRLMRIL 78
|
|
| UNIPROTKB|B0EXJ8 16OMT "Tabersonine 16-O-methyltransferase" [Catharanthus roseus (taxid:4058)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8GSN1 Q8GSN1 "Myricetin O-methyltransferase" [Catharanthus roseus (taxid:4058)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q84KK4 HI4'OMT "Isoflavone 4'-O-methyltransferase" [Lotus japonicus (taxid:34305)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q84KK6 HI4'OMT "Isoflavone 4'-O-methyltransferase" [Glycyrrhiza echinata (taxid:46348)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q84KK5 D7OMT "Isoflavone 7-O-methyltransferase" [Glycyrrhiza echinata (taxid:46348)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8QW53 OMT3 "5-pentadecatrienyl resorcinol O-methyltransferase" [Sorghum bicolor (taxid:4558)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132801 AT4G35150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132806 AT4G35160 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 87 | |||
| pfam08100 | 50 | pfam08100, Dimerisation, Dimerisation domain | 7e-18 |
| >gnl|CDD|219719 pfam08100, Dimerisation, Dimerisation domain | Back alignment and domain information |
|---|
Score = 69.5 bits (171), Expect = 7e-18
Identities = 24/49 (48%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
Query: 40 MSLKCAVELGIPDVIHKHGQPMTLSQIASAL-DIQKNKAHCIQRLMRIL 87
M LKCA+ELGIPD+I KHG+P++ S++AS L + + RL+R+L
Sbjct: 1 MVLKCAIELGIPDIIAKHGKPLSPSELASKLPTVNPEAPVMLDRLLRLL 49
|
This domain is found at the N-terminus of a variety of plant O-methyltransferases. It has been shown to mediate dimerisation of these proteins. Length = 50 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 87 | |||
| PF08100 | 51 | Dimerisation: Dimerisation domain; InterPro: IPR01 | 99.66 | |
| KOG3178 | 342 | consensus Hydroxyindole-O-methyltransferase and re | 98.95 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 98.87 | |
| PF09339 | 52 | HTH_IclR: IclR helix-turn-helix domain; InterPro: | 97.07 | |
| PF04967 | 53 | HTH_10: HTH DNA binding domain; InterPro: IPR00705 | 96.57 | |
| smart00346 | 91 | HTH_ICLR helix_turn_helix isocitrate lyase regulat | 96.2 | |
| PRK11569 | 274 | transcriptional repressor IclR; Provisional | 95.42 | |
| TIGR02431 | 248 | pcaR_pcaU beta-ketoadipate pathway transcriptional | 95.37 | |
| PRK10163 | 271 | DNA-binding transcriptional repressor AllR; Provis | 95.16 | |
| smart00550 | 68 | Zalpha Z-DNA-binding domain in adenosine deaminase | 94.97 | |
| PRK09834 | 263 | DNA-binding transcriptional activator MhpR; Provis | 94.35 | |
| PF12840 | 61 | HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ | 94.03 | |
| PF02082 | 83 | Rrf2: Transcriptional regulator; InterPro: IPR0009 | 93.74 | |
| COG1414 | 246 | IclR Transcriptional regulator [Transcription] | 93.72 | |
| PF08279 | 55 | HTH_11: HTH domain; InterPro: IPR013196 Winged hel | 93.72 | |
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 93.69 | |
| PRK15090 | 257 | DNA-binding transcriptional regulator KdgR; Provis | 93.66 | |
| COG3413 | 215 | Predicted DNA binding protein [General function pr | 93.53 | |
| PRK10857 | 164 | DNA-binding transcriptional regulator IscR; Provis | 93.51 | |
| PF02796 | 45 | HTH_7: Helix-turn-helix domain of resolvase; Inter | 93.2 | |
| PF01022 | 47 | HTH_5: Bacterial regulatory protein, arsR family; | 92.91 | |
| TIGR02010 | 135 | IscR iron-sulfur cluster assembly transcription fa | 92.79 | |
| PF01978 | 68 | TrmB: Sugar-specific transcriptional regulator Trm | 92.21 | |
| PF08461 | 66 | HTH_12: Ribonuclease R winged-helix domain; InterP | 92.21 | |
| cd07153 | 116 | Fur_like Ferric uptake regulator(Fur) and related | 91.9 | |
| smart00344 | 108 | HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto | 91.82 | |
| PF04703 | 62 | FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. | 91.66 | |
| PF12802 | 62 | MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP | 91.62 | |
| TIGR00738 | 132 | rrf2_super rrf2 family protein (putative transcrip | 91.49 | |
| TIGR02944 | 130 | suf_reg_Xantho FeS assembly SUF system regulator, | 91.32 | |
| PF09012 | 69 | FeoC: FeoC like transcriptional regulator; InterPr | 91.13 | |
| smart00418 | 66 | HTH_ARSR helix_turn_helix, Arsenical Resistance Op | 90.61 | |
| PF13404 | 42 | HTH_AsnC-type: AsnC-type helix-turn-helix domain; | 90.56 | |
| PRK06266 | 178 | transcription initiation factor E subunit alpha; V | 90.33 | |
| PF00165 | 42 | HTH_AraC: Bacterial regulatory helix-turn-helix pr | 90.3 | |
| smart00420 | 53 | HTH_DEOR helix_turn_helix, Deoxyribose operon repr | 89.98 | |
| PRK10141 | 117 | DNA-binding transcriptional repressor ArsR; Provis | 89.38 | |
| TIGR00122 | 69 | birA_repr_reg BirA biotin operon repressor domain. | 89.36 | |
| COG3355 | 126 | Predicted transcriptional regulator [Transcription | 89.16 | |
| PF12324 | 77 | HTH_15: Helix-turn-helix domain of alkylmercury ly | 89.09 | |
| smart00347 | 101 | HTH_MARR helix_turn_helix multiple antibiotic resi | 88.71 | |
| PRK06474 | 178 | hypothetical protein; Provisional | 88.67 | |
| PRK11014 | 141 | transcriptional repressor NsrR; Provisional | 88.5 | |
| smart00419 | 48 | HTH_CRP helix_turn_helix, cAMP Regulatory protein. | 88.13 | |
| PF08220 | 57 | HTH_DeoR: DeoR-like helix-turn-helix domain; Inter | 88.02 | |
| COG1959 | 150 | Predicted transcriptional regulator [Transcription | 87.91 | |
| PRK13239 | 206 | alkylmercury lyase; Provisional | 87.37 | |
| PRK11920 | 153 | rirA iron-responsive transcriptional regulator; Re | 87.32 | |
| cd00092 | 67 | HTH_CRP helix_turn_helix, cAMP Regulatory protein | 87.19 | |
| PRK13558 | 665 | bacterio-opsin activator; Provisional | 86.7 | |
| PRK11179 | 153 | DNA-binding transcriptional regulator AsnC; Provis | 86.48 | |
| PF01047 | 59 | MarR: MarR family; InterPro: IPR000835 The MarR-ty | 86.42 | |
| PF00325 | 32 | Crp: Bacterial regulatory proteins, crp family; In | 86.29 | |
| PF01418 | 77 | HTH_6: Helix-turn-helix domain, rpiR family; Inter | 86.21 | |
| TIGR00373 | 158 | conserved hypothetical protein TIGR00373. This fam | 86.11 | |
| PRK11169 | 164 | leucine-responsive transcriptional regulator; Prov | 85.69 | |
| TIGR02702 | 203 | SufR_cyano iron-sulfur cluster biosynthesis transc | 85.06 | |
| COG4190 | 144 | Predicted transcriptional regulator [Transcription | 84.43 | |
| cd00090 | 78 | HTH_ARSR Arsenical Resistance Operon Repressor and | 84.17 | |
| TIGR02337 | 118 | HpaR homoprotocatechuate degradation operon regula | 84.0 | |
| PF01726 | 65 | LexA_DNA_bind: LexA DNA binding domain; InterPro: | 83.56 | |
| COG1522 | 154 | Lrp Transcriptional regulators [Transcription] | 83.52 | |
| PRK11511 | 127 | DNA-binding transcriptional activator MarA; Provis | 83.49 | |
| PF13936 | 44 | HTH_38: Helix-turn-helix domain; PDB: 2W48_A. | 83.4 | |
| PF13463 | 68 | HTH_27: Winged helix DNA-binding domain; PDB: 3GFL | 82.87 | |
| COG2345 | 218 | Predicted transcriptional regulator [Transcription | 82.78 | |
| PF10668 | 60 | Phage_terminase: Phage terminase small subunit; In | 82.7 | |
| PRK00215 | 205 | LexA repressor; Validated | 82.29 | |
| PF06163 | 127 | DUF977: Bacterial protein of unknown function (DUF | 82.0 | |
| PF03374 | 111 | ANT: Phage antirepressor protein KilAC domain; Int | 81.83 | |
| TIGR02531 | 88 | yecD_yerC TrpR-related protein YerC/YecD. This mod | 81.47 | |
| PHA00738 | 108 | putative HTH transcription regulator | 81.4 | |
| PF07381 | 90 | DUF1495: Winged helix DNA-binding domain (DUF1495) | 81.32 | |
| PF00356 | 46 | LacI: Bacterial regulatory proteins, lacI family; | 80.97 | |
| PRK11302 | 284 | DNA-binding transcriptional regulator HexR; Provis | 80.56 | |
| TIGR02844 | 80 | spore_III_D sporulation transcriptional regulator | 80.16 | |
| PRK11557 | 278 | putative DNA-binding transcriptional regulator; Pr | 80.13 |
| >PF08100 Dimerisation: Dimerisation domain; InterPro: IPR012967 This domain is found at the N terminus of a variety of plant O-methyltransferases | Back alignment and domain information |
|---|
Probab=99.66 E-value=5.8e-17 Score=93.05 Aligned_cols=48 Identities=52% Similarity=0.924 Sum_probs=43.4
Q ss_pred HHHHHHHHhCchHHHHhCC-CCCCHHHHHHhcC-CCCCChhhHHHHHhcC
Q 041968 40 MSLKCAVELGIPDVIHKHG-QPMTLSQIASALD-IQKNKAHCIQRLMRIL 87 (87)
Q Consensus 40 ~aL~aaveLgI~d~L~~~~-gp~S~~ELA~~~~-~~~~~~~~L~RlLR~L 87 (87)
|+||+|+||||||+|+++| +|+|++||+++++ .+|.++..|+|+||+|
T Consensus 1 MaLk~aveLgI~dii~~~g~~~ls~~eia~~l~~~~p~~~~~L~RimR~L 50 (51)
T PF08100_consen 1 MALKCAVELGIPDIIHNAGGGPLSLSEIAARLPTSNPSAPPMLDRIMRLL 50 (51)
T ss_dssp HHHHHHHHTTHHHHHHHHTTS-BEHHHHHHTSTCT-TTHHHHHHHHHHHH
T ss_pred CcHHHHHHcCcHHHHHHcCCCCCCHHHHHHHcCCCCcchHHHHHHHHHHh
Confidence 6899999999999999987 9999999999999 7888889999999986
|
It has been shown to mediate dimerisation of these proteins [].; GO: 0008168 methyltransferase activity, 0046983 protein dimerization activity; PDB: 1ZGJ_A 1ZG3_A 1ZHF_A 1ZGA_A 2QYO_A 1KYW_A 1KYZ_A 3REO_D 1FPX_A 1FP2_A .... |
| >KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation | Back alignment and domain information |
|---|
| >PRK11569 transcriptional repressor IclR; Provisional | Back alignment and domain information |
|---|
| >TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family | Back alignment and domain information |
|---|
| >PRK10163 DNA-binding transcriptional repressor AllR; Provisional | Back alignment and domain information |
|---|
| >smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases | Back alignment and domain information |
|---|
| >PRK09834 DNA-binding transcriptional activator MhpR; Provisional | Back alignment and domain information |
|---|
| >PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B | Back alignment and domain information |
|---|
| >PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp | Back alignment and domain information |
|---|
| >COG1414 IclR Transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
| >PRK15090 DNA-binding transcriptional regulator KdgR; Provisional | Back alignment and domain information |
|---|
| >COG3413 Predicted DNA binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10857 DNA-binding transcriptional regulator IscR; Provisional | Back alignment and domain information |
|---|
| >PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms | Back alignment and domain information |
|---|
| >PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities | Back alignment and domain information |
|---|
| >TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR | Back alignment and domain information |
|---|
| >PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis | Back alignment and domain information |
|---|
| >PF08461 HTH_12: Ribonuclease R winged-helix domain; InterPro: IPR013668 This domain is found at the amino terminus of Ribonuclease R and a number of presumed transcriptional regulatory proteins from archaea | Back alignment and domain information |
|---|
| >cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators | Back alignment and domain information |
|---|
| >smart00344 HTH_ASNC helix_turn_helix ASNC type | Back alignment and domain information |
|---|
| >PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A | Back alignment and domain information |
|---|
| >PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B | Back alignment and domain information |
|---|
| >TIGR00738 rrf2_super rrf2 family protein (putative transcriptional regulator) | Back alignment and domain information |
|---|
| >TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator, gammaproteobacterial | Back alignment and domain information |
|---|
| >PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif | Back alignment and domain information |
|---|
| >smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor | Back alignment and domain information |
|---|
| >PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B | Back alignment and domain information |
|---|
| >PRK06266 transcription initiation factor E subunit alpha; Validated | Back alignment and domain information |
|---|
| >PF00165 HTH_AraC: Bacterial regulatory helix-turn-helix proteins, AraC family; PDB: 1WPK_A 1ZGW_A 1U8B_A | Back alignment and domain information |
|---|
| >smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor | Back alignment and domain information |
|---|
| >PRK10141 DNA-binding transcriptional repressor ArsR; Provisional | Back alignment and domain information |
|---|
| >TIGR00122 birA_repr_reg BirA biotin operon repressor domain | Back alignment and domain information |
|---|
| >COG3355 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF12324 HTH_15: Helix-turn-helix domain of alkylmercury lyase; InterPro: IPR024259 Alkylmercury lyase (EC:4 | Back alignment and domain information |
|---|
| >smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein | Back alignment and domain information |
|---|
| >PRK06474 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11014 transcriptional repressor NsrR; Provisional | Back alignment and domain information |
|---|
| >smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein | Back alignment and domain information |
|---|
| >PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism | Back alignment and domain information |
|---|
| >COG1959 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK13239 alkylmercury lyase; Provisional | Back alignment and domain information |
|---|
| >PRK11920 rirA iron-responsive transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family | Back alignment and domain information |
|---|
| >PRK13558 bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >PRK11179 DNA-binding transcriptional regulator AsnC; Provisional | Back alignment and domain information |
|---|
| >PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance | Back alignment and domain information |
|---|
| >PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PF01418 HTH_6: Helix-turn-helix domain, rpiR family; InterPro: IPR000281 This domain contains a helix-turn-helix motif [] | Back alignment and domain information |
|---|
| >TIGR00373 conserved hypothetical protein TIGR00373 | Back alignment and domain information |
|---|
| >PRK11169 leucine-responsive transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR | Back alignment and domain information |
|---|
| >COG4190 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors | Back alignment and domain information |
|---|
| >TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR | Back alignment and domain information |
|---|
| >PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria | Back alignment and domain information |
|---|
| >COG1522 Lrp Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PRK11511 DNA-binding transcriptional activator MarA; Provisional | Back alignment and domain information |
|---|
| >PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A | Back alignment and domain information |
|---|
| >PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A | Back alignment and domain information |
|---|
| >COG2345 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes | Back alignment and domain information |
|---|
| >PRK00215 LexA repressor; Validated | Back alignment and domain information |
|---|
| >PF06163 DUF977: Bacterial protein of unknown function (DUF977); InterPro: IPR010382 This entry consists of several hypothetical bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PF03374 ANT: Phage antirepressor protein KilAC domain; InterPro: IPR005039 This entry is represented by Bacteriophage P1, Ant1 C-terminal domain, which represents the processed Ant2 chain | Back alignment and domain information |
|---|
| >TIGR02531 yecD_yerC TrpR-related protein YerC/YecD | Back alignment and domain information |
|---|
| >PHA00738 putative HTH transcription regulator | Back alignment and domain information |
|---|
| >PF07381 DUF1495: Winged helix DNA-binding domain (DUF1495); InterPro: IPR010863 This family consists of several hypothetical archaeal proteins of around 110 residues in length | Back alignment and domain information |
|---|
| >PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PRK11302 DNA-binding transcriptional regulator HexR; Provisional | Back alignment and domain information |
|---|
| >TIGR02844 spore_III_D sporulation transcriptional regulator SpoIIID | Back alignment and domain information |
|---|
| >PRK11557 putative DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 87 | ||||
| 1zg3_A | 358 | Crystal Structure Of The Isoflavanone 4'-O-Methyltr | 3e-14 | ||
| 1zga_A | 357 | Crystal Structure Of Isoflavanone 4'-o-methyltransf | 3e-14 | ||
| 1zgj_A | 354 | Crystal Structure Of Isoflavanone 4'-O-Methyltransf | 3e-14 | ||
| 2qyo_A | 357 | Crystal Structure Of Isoflavone O-Methyltransferase | 3e-13 | ||
| 1fp2_A | 352 | Crystal Structure Analysis Of Isoflavone O-Methyltr | 3e-12 | ||
| 1fpx_A | 352 | Crystal Structure Analysis Of Selenomethionine Subs | 2e-10 |
| >pdb|1ZG3|A Chain A, Crystal Structure Of The Isoflavanone 4'-O-Methyltransferase Complexed With Sah And 2,7,4'-Trihydroxyisoflavanone Length = 358 | Back alignment and structure |
|
| >pdb|1ZGA|A Chain A, Crystal Structure Of Isoflavanone 4'-o-methyltransferase Complexed With (+)-6a-hydroxymaackiain Length = 357 | Back alignment and structure |
| >pdb|1ZGJ|A Chain A, Crystal Structure Of Isoflavanone 4'-O-Methyltransferase Complexed With (+)-Pisatin Length = 354 | Back alignment and structure |
| >pdb|2QYO|A Chain A, Crystal Structure Of Isoflavone O-Methyltransferase Homolog In Complex With Biochanin A And Sah Length = 357 | Back alignment and structure |
| >pdb|1FP2|A Chain A, Crystal Structure Analysis Of Isoflavone O-Methyltransferase Length = 352 | Back alignment and structure |
| >pdb|1FPX|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Isoflavone O-Methyltransferase Length = 352 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 87 | |||
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 1e-29 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 2e-26 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 1e-24 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 3e-24 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 2e-22 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 9e-22 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 1e-21 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 1e-21 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 3e-21 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 3e-21 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 1e-19 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 5e-19 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 1e-17 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 3e-15 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 4e-15 |
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Length = 358 | Back alignment and structure |
|---|
Score = 106 bits (266), Expect = 1e-29
Identities = 33/71 (46%), Positives = 51/71 (71%)
Query: 17 SSSSELLKAQAQVWNCAFNYINSMSLKCAVELGIPDVIHKHGQPMTLSQIASALDIQKNK 76
S SEL AQ ++ +N+++SM+LK A+ELGI D IH HG+PMTLS++AS+L + +K
Sbjct: 2 SEESELYHAQIHLYKHVYNFVSSMALKSAMELGIADAIHNHGKPMTLSELASSLKLHPSK 61
Query: 77 AHCIQRLMRIL 87
+ + R +R+L
Sbjct: 62 VNILHRFLRLL 72
|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Length = 352 | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Length = 348 | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 1kyz_A* 1kyw_A* Length = 368 | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Length = 374 | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Length = 369 | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Length = 334 | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Length = 332 | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Length = 363 | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Length = 360 | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Length = 335 | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Length = 352 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 87 | |||
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 99.43 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 99.41 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 99.38 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 99.36 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 99.35 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 99.35 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 99.23 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 99.22 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 99.19 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 99.18 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 99.18 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 99.11 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 99.11 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 99.1 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 99.07 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 98.89 | |
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 96.11 | |
| 2fu4_A | 83 | Ferric uptake regulation protein; DNA binding doma | 95.25 | |
| 3mq0_A | 275 | Transcriptional repressor of the blcabc operon; he | 95.12 | |
| 3r0a_A | 123 | Putative transcriptional regulator; structural gen | 94.77 | |
| 1mkm_A | 249 | ICLR transcriptional regulator; structural genomic | 94.41 | |
| 1xn7_A | 78 | Hypothetical protein YHGG; alpha+beta, GFT structu | 94.33 | |
| 2jt1_A | 77 | PEFI protein; solution structure, winged helix-tur | 94.17 | |
| 2xrn_A | 241 | HTH-type transcriptional regulator TTGV; DNA-bindi | 94.11 | |
| 3cuo_A | 99 | Uncharacterized HTH-type transcriptional regulato; | 93.86 | |
| 2htj_A | 81 | P fimbrial regulatory protein KS71A; winged helix- | 93.63 | |
| 3r4k_A | 260 | Transcriptional regulator, ICLR family; DNA/RNA-bi | 93.58 | |
| 2k02_A | 87 | Ferrous iron transport protein C; FEOC, iron-sulfu | 93.55 | |
| 2y75_A | 129 | HTH-type transcriptional regulator CYMR; DNA bindi | 93.34 | |
| 1y0u_A | 96 | Arsenical resistance operon repressor, putative; s | 93.08 | |
| 1ub9_A | 100 | Hypothetical protein PH1061; helix-turn-helix moti | 93.06 | |
| 1u2w_A | 122 | CADC repressor, cadmium efflux system accessory pr | 93.05 | |
| 2g7u_A | 257 | Transcriptional regulator; ICLR family, structural | 93.01 | |
| 3pqk_A | 102 | Biofilm growth-associated repressor; helix-turn-he | 92.78 | |
| 2o0y_A | 260 | Transcriptional regulator; ICLR-family, structural | 92.76 | |
| 2lkp_A | 119 | Transcriptional regulator, ARSR family; symmetric | 92.68 | |
| 2ia2_A | 265 | Putative transcriptional regulator; SAD, PSI-2, st | 92.66 | |
| 3f6o_A | 118 | Probable transcriptional regulator, ARSR family pr | 92.57 | |
| 1sfx_A | 109 | Conserved hypothetical protein AF2008; structural | 92.57 | |
| 1r1u_A | 106 | CZRA, repressor protein; zinc, DNA binding, transc | 92.39 | |
| 3lwf_A | 159 | LIN1550 protein, putative transcriptional regulato | 92.35 | |
| 2lnb_A | 80 | Z-DNA-binding protein 1; structural genomics, nort | 92.19 | |
| 3boq_A | 160 | Transcriptional regulator, MARR family; MARR famil | 92.18 | |
| 3jth_A | 98 | Transcription activator HLYU; transcription factor | 92.12 | |
| 2oqg_A | 114 | Possible transcriptional regulator, ARSR family P; | 92.07 | |
| 3ech_A | 142 | MEXR, multidrug resistance operon repressor; winge | 92.04 | |
| 2kko_A | 108 | Possible transcriptional regulatory protein (possi | 91.98 | |
| 2o03_A | 131 | Probable zinc uptake regulation protein FURB; DNA- | 91.72 | |
| 1oyi_A | 82 | Double-stranded RNA-binding protein; (alpha+beta) | 91.34 | |
| 1xmk_A | 79 | Double-stranded RNA-specific adenosine deaminase; | 91.34 | |
| 3t8r_A | 143 | Staphylococcus aureus CYMR; transcriptional regula | 91.34 | |
| 2d1h_A | 109 | ST1889, 109AA long hypothetical transcriptional re | 91.27 | |
| 2cfx_A | 144 | HTH-type transcriptional regulator LRPC; transcrip | 91.23 | |
| 1q1h_A | 110 | TFE, transcription factor E, TFE; TFIIE, transcrip | 91.2 | |
| 2pn6_A | 150 | ST1022, 150AA long hypothetical transcriptional re | 91.2 | |
| 3e6m_A | 161 | MARR family transcriptional regulator; APC88769, s | 91.19 | |
| 2w25_A | 150 | Probable transcriptional regulatory protein; trans | 91.04 | |
| 2fe3_A | 145 | Peroxide operon regulator; oxidative stress regula | 90.93 | |
| 2dbb_A | 151 | Putative HTH-type transcriptional regulator PH006; | 90.84 | |
| 2p5v_A | 162 | Transcriptional regulator, LRP/ASNC family; NMB057 | 90.81 | |
| 2cyy_A | 151 | Putative HTH-type transcriptional regulator PH151; | 90.76 | |
| 1ylf_A | 149 | RRF2 family protein; structural genomics, transcri | 90.69 | |
| 1qgp_A | 77 | Protein (double stranded RNA adenosine deaminase); | 90.64 | |
| 3kp7_A | 151 | Transcriptional regulator TCAR; multiple drug resi | 90.5 | |
| 2zkz_A | 99 | Transcriptional repressor PAGR; protein-DNA, HTH m | 90.49 | |
| 1r1t_A | 122 | Transcriptional repressor SMTB; zinc, transcriptio | 90.47 | |
| 2cg4_A | 152 | Regulatory protein ASNC; DNA binding, FFRP, LRP fa | 90.38 | |
| 1ku9_A | 152 | Hypothetical protein MJ223; putative transcription | 90.28 | |
| 3i4p_A | 162 | Transcriptional regulator, ASNC family; PSI, struc | 90.24 | |
| 1jhg_A | 101 | Trp operon repressor; complex (regulatory protein- | 90.24 | |
| 3fm5_A | 150 | Transcriptional regulator; MCSG, PF04017, PSI, MAR | 90.19 | |
| 1i1g_A | 141 | Transcriptional regulator LRPA; helix-turn-helix, | 90.18 | |
| 3bro_A | 141 | Transcriptional regulator; helix_TURN_helix, multi | 90.05 | |
| 2nnn_A | 140 | Probable transcriptional regulator; structural gen | 89.9 | |
| 2jsc_A | 118 | Transcriptional regulator RV1994C/MT2050; cadmium, | 89.88 | |
| 2hr3_A | 147 | Probable transcriptional regulator; MCSG, structur | 89.74 | |
| 3bj6_A | 152 | Transcriptional regulator, MARR family; helix-turn | 89.69 | |
| 3eco_A | 139 | MEPR; mutlidrug efflux pump regulator winged helix | 89.68 | |
| 1qbj_A | 81 | Protein (double-stranded RNA specific adenosine D | 89.62 | |
| 3b73_A | 111 | PHIH1 repressor-like protein; winged-helix-turn-he | 89.55 | |
| 2pg4_A | 95 | Uncharacterized protein; structural genomics, join | 89.38 | |
| 2xig_A | 150 | Ferric uptake regulation protein; hpfur, transcrip | 89.32 | |
| 2gxg_A | 146 | 146AA long hypothetical transcriptional regulator; | 89.22 | |
| 2ia0_A | 171 | Putative HTH-type transcriptional regulator PF086; | 89.17 | |
| 3bja_A | 139 | Transcriptional regulator, MARR family, putative; | 89.17 | |
| 1mzb_A | 136 | Ferric uptake regulation protein; ferric uptake re | 89.1 | |
| 2fbh_A | 146 | Transcriptional regulator PA3341; MARR, transcript | 89.05 | |
| 2e1c_A | 171 | Putative HTH-type transcriptional regulator PH151; | 89.02 | |
| 3k2z_A | 196 | LEXA repressor; winged helix-turn-helix, SOS syste | 88.84 | |
| 3f6v_A | 151 | Possible transcriptional regulator, ARSR family pr | 88.77 | |
| 3nrv_A | 148 | Putative transcriptional regulator (MARR/EMRR FAM; | 88.61 | |
| 3u2r_A | 168 | Regulatory protein MARR; structural genomics, PSI- | 88.59 | |
| 3bpv_A | 138 | Transcriptional regulator; MARR, DNA binding, tran | 88.58 | |
| 3bdd_A | 142 | Regulatory protein MARR; putative multiple antibio | 88.19 | |
| 2a61_A | 145 | Transcriptional regulator TM0710; APC4350, MCSG, m | 88.07 | |
| 3k0l_A | 162 | Repressor protein; helix-turn-helix, structural ge | 87.92 | |
| 2x4h_A | 139 | Hypothetical protein SSO2273; transcription; 2.30A | 87.82 | |
| 1j5y_A | 187 | Transcriptional regulator, biotin repressor famil; | 87.7 | |
| 3cdh_A | 155 | Transcriptional regulator, MARR family; helix-turn | 87.59 | |
| 3jw4_A | 148 | Transcriptional regulator, MARR/EMRR family; DNA-b | 87.42 | |
| 2fa5_A | 162 | Transcriptional regulator MARR/EMRR family; multip | 87.35 | |
| 3k69_A | 162 | Putative transcription regulator; putative transcr | 87.09 | |
| 2rdp_A | 150 | Putative transcriptional regulator MARR; PFAM PF01 | 87.03 | |
| 1uly_A | 192 | Hypothetical protein PH1932; helix-turn-helix, str | 86.96 | |
| 3g3z_A | 145 | NMB1585, transcriptional regulator, MARR family; t | 86.89 | |
| 3deu_A | 166 | Transcriptional regulator SLYA; MARR, WING-helix, | 86.85 | |
| 2o3f_A | 111 | Putative HTH-type transcriptional regulator YBBH; | 86.51 | |
| 1tbx_A | 99 | ORF F-93, hypothetical 11.0 kDa protein; sulfolobu | 86.51 | |
| 3tgn_A | 146 | ADC operon repressor ADCR; helix-turn-helix, trans | 86.31 | |
| 1jgs_A | 138 | Multiple antibiotic resistance protein MARR; trans | 86.24 | |
| 1lj9_A | 144 | Transcriptional regulator SLYA; HTH DNA binding pr | 86.23 | |
| 2qww_A | 154 | Transcriptional regulator, MARR family; YP_013417. | 86.23 | |
| 3mn2_A | 108 | Probable ARAC family transcriptional regulator; st | 86.21 | |
| 2eth_A | 154 | Transcriptional regulator, putative, MAR family; M | 86.01 | |
| 2fbi_A | 142 | Probable transcriptional regulator; MARR, APC5816, | 86.0 | |
| 3oop_A | 143 | LIN2960 protein; protein structure initiative, PSI | 85.75 | |
| 2bv6_A | 142 | MGRA, HTH-type transcriptional regulator MGRA; mul | 85.7 | |
| 1p6r_A | 82 | Penicillinase repressor; transcription regulation, | 85.67 | |
| 3oio_A | 113 | Transcriptional regulator (ARAC-type DNA-binding c | 85.63 | |
| 3cjn_A | 162 | Transcriptional regulator, MARR family; silicibact | 85.59 | |
| 1on2_A | 142 | Transcriptional regulator MNTR; helix-turn-helix, | 85.55 | |
| 2fbk_A | 181 | Transcriptional regulator, MARR family; winged-hel | 85.5 | |
| 2wte_A | 244 | CSA3; antiviral protein, viral resistance, winged | 85.34 | |
| 3mwm_A | 139 | ZUR, putative metal uptake regulation protein; FUR | 85.26 | |
| 2nyx_A | 168 | Probable transcriptional regulatory protein, RV14; | 85.22 | |
| 2pex_A | 153 | Transcriptional regulator OHRR; transcription regu | 84.95 | |
| 3iwf_A | 107 | Transcription regulator RPIR family; transcription | 84.78 | |
| 3oou_A | 108 | LIN2118 protein; protein structure initiative, PSI | 84.6 | |
| 2p5k_A | 64 | Arginine repressor; DNA-binding domain, winged hel | 84.39 | |
| 1xd7_A | 145 | YWNA; structural genomics, protein structure initi | 84.37 | |
| 3kor_A | 119 | Possible Trp repressor; putative DNA-binding Trp r | 84.17 | |
| 2w57_A | 150 | Ferric uptake regulation protein; gene regulation, | 84.1 | |
| 3mkl_A | 120 | HTH-type transcriptional regulator GADX; PSI2, MCS | 84.09 | |
| 2hzt_A | 107 | Putative HTH-type transcriptional regulator YTCD; | 83.99 | |
| 1z7u_A | 112 | Hypothetical protein EF0647; winged-helix-turn-hel | 83.89 | |
| 3f3x_A | 144 | Transcriptional regulator, MARR family, putative; | 83.88 | |
| 1s3j_A | 155 | YUSO protein; structural genomics, MARR transcript | 83.88 | |
| 2g9w_A | 138 | Conserved hypothetical protein; DNA-binding domain | 83.58 | |
| 4hbl_A | 149 | Transcriptional regulator, MARR family; HTH, trans | 83.51 | |
| 1jko_C | 52 | HIN recombinase, DNA-invertase HIN; water-mediated | 82.85 | |
| 2k9s_A | 107 | Arabinose operon regulatory protein; activator, ar | 82.79 | |
| 1z91_A | 147 | Organic hydroperoxide resistance transcriptional; | 82.72 | |
| 1tc3_C | 51 | Protein (TC3 transposase); DNA binding, helix-turn | 82.67 | |
| 3s2w_A | 159 | Transcriptional regulator, MARR family; structural | 82.17 | |
| 3nqo_A | 189 | MARR-family transcriptional regulator; structural | 81.9 | |
| 2qvo_A | 95 | Uncharacterized protein AF_1382; PSI, structural g | 81.84 | |
| 2hoe_A | 380 | N-acetylglucosamine kinase; TM1224, structural gen | 81.74 | |
| 2p4w_A | 202 | Transcriptional regulatory protein ARSR family; ar | 81.58 | |
| 3hsr_A | 140 | HTH-type transcriptional regulator SARZ; helix-tur | 81.5 | |
| 1bl0_A | 129 | Protein (multiple antibiotic resistance protein), | 81.32 | |
| 4aik_A | 151 | Transcriptional regulator SLYA; transcription, tra | 81.24 | |
| 3lsg_A | 103 | Two-component response regulator YESN; structural | 81.11 | |
| 2dk5_A | 91 | DNA-directed RNA polymerase III 39 kDa polypeptide | 80.82 |
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
Probab=99.43 E-value=1.4e-13 Score=101.26 Aligned_cols=62 Identities=23% Similarity=0.309 Sum_probs=57.7
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhCchHHHHhCCCCCCHHHHHHhcCCCCCChhhHHHHHhcC
Q 041968 23 LKAQAQVWNCAFNYINSMSLKCAVELGIPDVIHKHGQPMTLSQIASALDIQKNKAHCIQRLMRIL 87 (87)
Q Consensus 23 ~~~~~~l~~l~~g~~~~~aL~aaveLgI~d~L~~~~gp~S~~ELA~~~~~~~~~~~~L~RlLR~L 87 (87)
.++...+++++.||+.+++|++|++|||||+|++.++|+|++|||+++|+++ ..+.|+||+|
T Consensus 6 ~~~~~~L~~l~~Gf~~s~~L~aa~eLglfd~L~~~~~p~t~~eLA~~~g~~~---~~l~rlLr~L 67 (353)
T 4a6d_A 6 DQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASA---HGTELLLDIC 67 (353)
T ss_dssp CHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHSSSCBCHHHHHHHHTCCH---HHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHcCHHHHHhcCCCCCCHHHHHHhhCcCH---HHHHHHHHHH
Confidence 3677788999999999999999999999999998779999999999999999 9999999975
|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
| >2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 | Back alignment and structure |
|---|
| >1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 | Back alignment and structure |
|---|
| >2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A | Back alignment and structure |
|---|
| >3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 | Back alignment and structure |
|---|
| >3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} | Back alignment and structure |
|---|
| >2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 | Back alignment and structure |
|---|
| >1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A | Back alignment and structure |
|---|
| >2g7u_A Transcriptional regulator; ICLR family, structural genomics, PSI, protein structure initiative, midwest center for struc genomics; 2.30A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A | Back alignment and structure |
|---|
| >2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2ia2_A Putative transcriptional regulator; SAD, PSI-2, structural genomics, structure initiative, midwest center for structural genomic transcription; 2.10A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A | Back alignment and structure |
|---|
| >3lwf_A LIN1550 protein, putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG; HET: SO4; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >2lnb_A Z-DNA-binding protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A | Back alignment and structure |
|---|
| >2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A | Back alignment and structure |
|---|
| >2o03_A Probable zinc uptake regulation protein FURB; DNA-binding, helix-turn-helix, zinc binding, GE regulation; 2.70A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3t8r_A Staphylococcus aureus CYMR; transcriptional regulator protein, dimer, sulfenic acid, UNK function; 1.70A {Staphylococcus aureus} PDB: 3t8t_A | Back alignment and structure |
|---|
| >2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 | Back alignment and structure |
|---|
| >2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* | Back alignment and structure |
|---|
| >3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A | Back alignment and structure |
|---|
| >2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* | Back alignment and structure |
|---|
| >2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A | Back alignment and structure |
|---|
| >2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >1ylf_A RRF2 family protein; structural genomics, transcription regulator, P protein structure initiative; 2.50A {Bacillus cereus atcc 14579} SCOP: a.4.5.55 | Back alignment and structure |
|---|
| >1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A | Back alignment and structure |
|---|
| >2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A | Back alignment and structure |
|---|
| >2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 | Back alignment and structure |
|---|
| >3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* | Back alignment and structure |
|---|
| >3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A | Back alignment and structure |
|---|
| >3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} | Back alignment and structure |
|---|
| >2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >2xig_A Ferric uptake regulation protein; hpfur, transcription, homeostasis; HET: CIT; 1.85A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A | Back alignment and structure |
|---|
| >2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} | Back alignment and structure |
|---|
| >1mzb_A Ferric uptake regulation protein; ferric uptake regulator, iron, DTXR, gene regulation; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.42 | Back alignment and structure |
|---|
| >2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} | Back alignment and structure |
|---|
| >3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* | Back alignment and structure |
|---|
| >3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} | Back alignment and structure |
|---|
| >2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} | Back alignment and structure |
|---|
| >2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 | Back alignment and structure |
|---|
| >3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3k69_A Putative transcription regulator; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.95A {Lactobacillus plantarum} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A | Back alignment and structure |
|---|
| >3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2o3f_A Putative HTH-type transcriptional regulator YBBH; APC85504, putative transcriptional regulator YBBH; HET: MLY; 1.75A {Bacillus subtilis} SCOP: a.4.1.20 | Back alignment and structure |
|---|
| >1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3mn2_A Probable ARAC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} | Back alignment and structure |
|---|
| >2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B | Back alignment and structure |
|---|
| >3oio_A Transcriptional regulator (ARAC-type DNA-binding containing proteins); PSI-2, midwest center for structural genomics; 1.65A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* | Back alignment and structure |
|---|
| >2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3mwm_A ZUR, putative metal uptake regulation protein; FUR, regulatory metal, graded transcription regulation, transcription; 2.40A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A | Back alignment and structure |
|---|
| >3iwf_A Transcription regulator RPIR family; transcriptional, N-terminal, PSI, MCSG, structural genomics, midwest center structural genomics; 1.40A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3oou_A LIN2118 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; HET: BTB; 1.57A {Listeria innocua} | Back alignment and structure |
|---|
| >2p5k_A Arginine repressor; DNA-binding domain, winged helix-turn-helix (WHTH), DNA binding protein; 1.00A {Bacillus subtilis} SCOP: a.4.5.3 PDB: 2p5l_C* | Back alignment and structure |
|---|
| >1xd7_A YWNA; structural genomics, protein structure initiative, winged HE binding, hypothetical protein, PSI; 2.30A {Bacillus subtilis subsp} SCOP: a.4.5.55 | Back alignment and structure |
|---|
| >3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2w57_A Ferric uptake regulation protein; gene regulation, transcription regulation, transport, iron, repressor, DNA-binding, transcription; 2.60A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3mkl_A HTH-type transcriptional regulator GADX; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 | Back alignment and structure |
|---|
| >4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C | Back alignment and structure |
|---|
| >2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* | Back alignment and structure |
|---|
| >1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 | Back alignment and structure |
|---|
| >3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} | Back alignment and structure |
|---|
| >2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A | Back alignment and structure |
|---|
| >2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 | Back alignment and structure |
|---|
| >3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A | Back alignment and structure |
|---|
| >1bl0_A Protein (multiple antibiotic resistance protein), DNA (5'- D(*CP*CP*GP*AP*TP*GP*CP*CP*AP*CP*GP*TP*TP*TP*TP*GP*CP*TP*AP *AP*AP*TP* CP*C)-3')...; transcriptional activator; HET: DNA; 2.30A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 PDB: 1xs9_A | Back alignment and structure |
|---|
| >4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* | Back alignment and structure |
|---|
| >3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum} | Back alignment and structure |
|---|
| >2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 87 | ||||
| d1fp2a1 | 101 | a.4.5.29 (A:8-108) Isoflavone O-methyltransferase | 4e-28 | |
| d1fp1d1 | 110 | a.4.5.29 (D:19-128) Chalcone O-methyltransferase { | 2e-18 | |
| d1kyza1 | 107 | a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic | 6e-16 | |
| d1qzza1 | 92 | a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase R | 8e-16 | |
| d1tw3a1 | 85 | a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransfer | 9e-11 | |
| d1mkma1 | 75 | a.4.5.33 (A:1-75) Transcriptional regulator IclR, | 4e-04 |
| >d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 101 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: "Winged helix" DNA-binding domain family: Plant O-methyltransferase, N-terminal domain domain: Isoflavone O-methyltransferase species: Alfalfa (Medicago sativa) [TaxId: 3879]
Score = 95.4 bits (237), Expect = 4e-28
Identities = 31/69 (44%), Positives = 48/69 (69%)
Query: 19 SSELLKAQAQVWNCAFNYINSMSLKCAVELGIPDVIHKHGQPMTLSQIASALDIQKNKAH 78
SE+ KAQA ++ + +I+SMSLK AVE+ IP++I HG+P++LS + S L + +K
Sbjct: 3 PSEIFKAQALLYKHIYAFIDSMSLKWAVEMNIPNIIQNHGKPISLSNLVSILQVPSSKIG 62
Query: 79 CIQRLMRIL 87
++RLMR L
Sbjct: 63 NVRRLMRYL 71
|
| >d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 110 | Back information, alignment and structure |
|---|
| >d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 107 | Back information, alignment and structure |
|---|
| >d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Length = 85 | Back information, alignment and structure |
|---|
| >d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 75 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 87 | |||
| d1fp2a1 | 101 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 99.82 | |
| d1fp1d1 | 110 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 99.71 | |
| d1kyza1 | 107 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 99.69 | |
| d1tw3a1 | 85 | Carminomycin 4-O-methyltransferase {Streptomyces p | 99.54 | |
| d1qzza1 | 92 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 99.53 | |
| d1mkma1 | 75 | Transcriptional regulator IclR, N-terminal domain | 97.11 | |
| d1z05a1 | 71 | Transcriptional regulator VC2007 N-terminal domain | 94.83 | |
| d2d1ha1 | 109 | Hypothetical transcriptional regulator ST1889 {Sul | 94.18 | |
| d1j5ya1 | 65 | Putative transcriptional regulator TM1602, N-termi | 93.82 | |
| d1ulya_ | 190 | Hypothetical protein PH1932 {Pyrococcus horikoshii | 93.58 | |
| d1xd7a_ | 127 | Hypothetical protein ywnA {Bacillus subtilis [TaxI | 93.51 | |
| d2hoea1 | 62 | N-acetylglucosamine kinase {Thermotoga maritima [T | 92.78 | |
| d1r1ta_ | 98 | SmtB repressor {Cyanobacteria (Synechococcus), pcc | 92.62 | |
| d1ku9a_ | 151 | DNA-binding protein Mj223 {Archaeon Methanococcus | 92.58 | |
| d2hr3a1 | 145 | Probable transcriptional regulator PA3067 {Pseudom | 92.56 | |
| d1biaa1 | 63 | Biotin repressor, N-terminal domain {Escherichia c | 92.39 | |
| d1ub9a_ | 100 | Hypothetical protein PH1061 {Archaeon Pyrococcus h | 92.39 | |
| d1z6ra1 | 70 | Mlc protein N-terminal domain {Escherichia coli [T | 92.39 | |
| d1r1ua_ | 94 | Metal-sensing transcriptional repressor CzrA {Stap | 92.18 | |
| d1lvaa3 | 64 | C-terminal fragment of elongation factor SelB {Moo | 92.11 | |
| d1ylfa1 | 138 | Hypothetical protein BC1842 {Bacillus cereus [TaxI | 91.61 | |
| d1bl0a1 | 54 | MarA {Escherichia coli [TaxId: 562]} | 91.49 | |
| d1sfxa_ | 109 | Hypothetical protein AF2008 {Archaeoglobus fulgidu | 91.44 | |
| d1u2wa1 | 108 | Cadmium efflux system accessory protein CadC {Stap | 91.32 | |
| d2cyya1 | 60 | Putative transcriptional regulator PH1519 {Archaeo | 91.1 | |
| d1i1ga1 | 60 | LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 90.71 | |
| d2cfxa1 | 63 | Transcriptional regulator LrpC {Bacillus subtilis | 90.67 | |
| d1d5ya1 | 54 | Rob transcription factor, N-terminal domain {Esche | 90.66 | |
| d2p4wa1 | 194 | Transcriptional regulatory protein PF1790 {Pyrococ | 89.46 | |
| d2o3fa1 | 83 | Putative transcriptional regulator YbbH {Bacillus | 89.16 | |
| d1s3ja_ | 143 | Putative transcriptional regulator YusO {Bacillus | 88.56 | |
| d2cg4a1 | 63 | Regulatory protein AsnC {Escherichia coli [TaxId: | 87.65 | |
| d3broa1 | 135 | Transcriptional regulator OEOE1854 {Oenococcus oen | 87.19 | |
| d2etha1 | 140 | Putative transcriptional regulator TM0816 {Thermot | 85.93 | |
| d1q1ha_ | 88 | Transcription factor E/IIe-alpha, N-terminal domai | 85.89 | |
| d1gdta1 | 43 | gamma,delta resolvase (C-terminal domain) {Escheri | 84.19 | |
| d1efaa1 | 59 | Lac repressor (LacR), N-terminal domain {Escherich | 84.05 | |
| d2a61a1 | 139 | Transcriptional regulator TM0710 {Thermotoga marit | 83.37 | |
| d2fbha1 | 137 | Transcriptional regulator PA3341 {Pseudomonas aeru | 81.54 | |
| d1j75a_ | 57 | Dlm-1 {Mouse (Mus musculus) [TaxId: 10090]} | 81.37 | |
| d1v7ba1 | 74 | Transcriptional regulator Cgl2612 {Corynebacterium | 81.04 | |
| d2a6ca1 | 69 | HTH-motif protein NE1354 {Nitrosomonas europaea [T | 80.63 |
| >d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: "Winged helix" DNA-binding domain family: Plant O-methyltransferase, N-terminal domain domain: Isoflavone O-methyltransferase species: Alfalfa (Medicago sativa) [TaxId: 3879]
Probab=99.82 E-value=4.9e-21 Score=120.55 Aligned_cols=70 Identities=44% Similarity=0.770 Sum_probs=65.8
Q ss_pred CcHHhHHHHHHHHHHHHHHHHHHHHHHHHHhCchHHHHhCCCCCCHHHHHHhcCCCCCChhhHHHHHhcC
Q 041968 18 SSSELLKAQAQVWNCAFNYINSMSLKCAVELGIPDVIHKHGQPMTLSQIASALDIQKNKAHCIQRLMRIL 87 (87)
Q Consensus 18 ~~~~~~~~~~~l~~l~~g~~~~~aL~aaveLgI~d~L~~~~gp~S~~ELA~~~~~~~~~~~~L~RlLR~L 87 (87)
.++|.++++.++|+++|||+.+++|++|++|||||+|++++||+|++|||+.+|+++.+++.|.|+||+|
T Consensus 2 ~~~e~~qaq~~l~~~~~gf~~s~aL~~aveLgi~d~l~~~~~p~t~~eLa~~~~~~~~~~~~L~RlLR~L 71 (101)
T d1fp2a1 2 KPSEIFKAQALLYKHIYAFIDSMSLKWAVEMNIPNIIQNHGKPISLSNLVSILQVPSSKIGNVRRLMRYL 71 (101)
T ss_dssp CSTHHHHHHHHHHHHHTTHHHHHHHHHHHHTTHHHHHHHHTSCEEHHHHHHHHTCCGGGHHHHHHHHHHH
T ss_pred ChHHHHHHHHHHHHHHHhHHHHHHHHHHHHcCcHHHHHHcCCCCCHHHHHHHcCCCCccchHHHHHHHHH
Confidence 4678999999999999999999999999999999999987899999999999999887878999999986
|
| >d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xd7a_ a.4.5.55 (A:) Hypothetical protein ywnA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} | Back information, alignment and structure |
|---|
| >d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} | Back information, alignment and structure |
|---|
| >d1ylfa1 a.4.5.55 (A:5-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2o3fa1 a.4.1.20 (A:1-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} | Back information, alignment and structure |
|---|
| >d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1q1ha_ a.4.5.41 (A:) Transcription factor E/IIe-alpha, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1j75a_ a.4.5.19 (A:) Dlm-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v7ba1 a.4.1.9 (A:1-74) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|