Citrus Sinensis ID: 041978
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 123 | ||||||
| 21618072 | 129 | unknown [Arabidopsis thaliana] | 0.975 | 0.930 | 0.435 | 3e-22 | |
| 297803024 | 127 | hypothetical protein ARALYDRAFT_491747 [ | 0.959 | 0.929 | 0.435 | 1e-19 | |
| 18417524 | 129 | defensin-like protein 182 [Arabidopsis t | 0.975 | 0.930 | 0.435 | 1e-18 | |
| 116831413 | 130 | unknown [Arabidopsis thaliana] | 0.975 | 0.923 | 0.435 | 1e-18 | |
| 297798972 | 119 | predicted protein [Arabidopsis lyrata su | 0.951 | 0.983 | 0.443 | 4e-18 | |
| 79325742 | 126 | defensin-like protein 183 [Arabidopsis t | 0.943 | 0.920 | 0.44 | 2e-17 | |
| 356530322 | 134 | PREDICTED: defensin-like protein 183-lik | 0.959 | 0.880 | 0.441 | 4e-15 | |
| 4938483 | 161 | hypothetical protein [Arabidopsis thalia | 0.804 | 0.614 | 0.466 | 4e-14 | |
| 449461213 | 115 | PREDICTED: defensin-like protein 182-lik | 0.837 | 0.895 | 0.458 | 4e-14 | |
| 356530320 | 137 | PREDICTED: uncharacterized protein LOC10 | 0.845 | 0.759 | 0.418 | 1e-11 |
| >gi|21618072|gb|AAM67122.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Score = 108 bits (271), Expect = 3e-22, Method: Compositional matrix adjust.
Identities = 54/124 (43%), Positives = 75/124 (60%), Gaps = 4/124 (3%)
Query: 1 LLIQLINLRGNVVHTIKGDTCQEGLGQCGASNDCDLHCKTRHAGQGQGSCDRTIQPPLCT 60
++ L+ + +VV+ +GDTC +GLG C N+CD CK +H + SCDR++ PLC
Sbjct: 9 FIVNLLIIFTSVVNQARGDTCIDGLGYC---NNCDERCKAKHGPSSESSCDRSVGVPLCK 65
Query: 61 CFYPCGSPSKRPSSPKKCTAGLGACDQ-CRDLCCNGKCAAQFKGGQGFCDNIGAQYLCQC 119
C+Y C SP P+ PKKC G G C Q C+ CC+ CA ++ GG GFC+ +G CQC
Sbjct: 66 CYYECESPPSPPAQPKKCDGGAGICSQRCQGQCCDMNCAQKYIGGHGFCNTLGTFSFCQC 125
Query: 120 TYDC 123
Y C
Sbjct: 126 EYPC 129
|
Source: Arabidopsis thaliana Species: Arabidopsis thaliana Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297803024|ref|XP_002869396.1| hypothetical protein ARALYDRAFT_491747 [Arabidopsis lyrata subsp. lyrata] gi|297315232|gb|EFH45655.1| hypothetical protein ARALYDRAFT_491747 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18417524|ref|NP_567840.1| defensin-like protein 182 [Arabidopsis thaliana] gi|46396245|sp|P82773.1|DF182_ARATH RecName: Full=Defensin-like protein 182; AltName: Full=Low-molecular-weight cysteine-rich protein 59; Short=Protein LCR59; AltName: Full=Plant defensin 3.2; Flags: Precursor gi|91806752|gb|ABE66103.1| plant defensin-fusion protein [Arabidopsis thaliana] gi|332660316|gb|AEE85716.1| defensin-like protein 182 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|116831413|gb|ABK28659.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297798972|ref|XP_002867370.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297313206|gb|EFH43629.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|79325742|ref|NP_001031755.1| defensin-like protein 183 [Arabidopsis thaliana] gi|46396210|sp|P82733.1|DF183_ARATH RecName: Full=Defensin-like protein 183; AltName: Full=Low-molecular-weight cysteine-rich protein 19; Short=Protein LCR19; Flags: Precursor gi|332660317|gb|AEE85717.1| defensin-like protein 183 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356530322|ref|XP_003533731.1| PREDICTED: defensin-like protein 183-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|4938483|emb|CAB43842.1| hypothetical protein [Arabidopsis thaliana] gi|7269907|emb|CAB81000.1| hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449461213|ref|XP_004148336.1| PREDICTED: defensin-like protein 182-like [Cucumis sativus] gi|449510579|ref|XP_004163705.1| PREDICTED: defensin-like protein 182-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356530320|ref|XP_003533730.1| PREDICTED: uncharacterized protein LOC100812103 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 123 | ||||||
| TAIR|locus:2126545 | 129 | LCR59 "low-molecular-weight cy | 0.967 | 0.922 | 0.390 | 1.2e-24 | |
| TAIR|locus:1009023378 | 126 | LCR19 "low-molecular-weight cy | 0.869 | 0.849 | 0.421 | 2.1e-22 | |
| TAIR|locus:2173288 | 122 | LCR80 "AT5G38330" [Arabidopsis | 0.910 | 0.918 | 0.333 | 4.6e-18 | |
| TAIR|locus:1009023434 | 127 | LCR58 "low-molecular-weight cy | 0.861 | 0.834 | 0.348 | 8.6e-17 | |
| TAIR|locus:1009023418 | 120 | LCR57 "low-molecular-weight cy | 0.886 | 0.908 | 0.276 | 2.8e-11 | |
| TAIR|locus:1009023189 | 78 | LCR62 "low-molecular-weight cy | 0.365 | 0.576 | 0.422 | 2.6e-06 | |
| UNIPROTKB|F1M4R9 | 188 | F1M4R9 "Uncharacterized protei | 0.666 | 0.436 | 0.311 | 3.3e-06 | |
| TAIR|locus:1009023366 | 78 | LCR61 "low-molecular-weight cy | 0.365 | 0.576 | 0.422 | 3.4e-06 | |
| UNIPROTKB|F1M211 | 240 | F1M211 "Uncharacterized protei | 0.796 | 0.408 | 0.283 | 3.4e-06 | |
| MGI|MGI:2149673 | 241 | Krtap5-5 "keratin associated p | 0.739 | 0.377 | 0.287 | 1.3e-05 |
| TAIR|locus:2126545 LCR59 "low-molecular-weight cysteine-rich 59" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 281 (104.0 bits), Expect = 1.2e-24, P = 1.2e-24
Identities = 48/123 (39%), Positives = 68/123 (55%)
Query: 2 LIQLINLRGNVVHTIKGDTCQEGLGQCGASNDCDLHCKTRHAGQGQGSCDRTIQPPLCTC 61
++ L+ + +VV+ +GDTC +GLG C N+CD CK +H + SCDR++ PLC C
Sbjct: 10 IVNLLIIFTSVVNQARGDTCIDGLGYC---NNCDERCKAKHGPSSESSCDRSVGVPLCKC 66
Query: 62 FYPCGXXXXXXXXXXXCTAGLGACDQ-CRDLCCNGKCAAQFKGGQGFCDNIGAQYLCQCT 120
+Y C C G G C Q C+ CC+ CA ++ GG GFC+ +G CQC
Sbjct: 67 YYECESPPSPPAPPKKCDGGAGICSQRCQGQCCDMNCAQKYIGGHGFCNTLGTFSFCQCE 126
Query: 121 YDC 123
Y C
Sbjct: 127 YPC 129
|
|
| TAIR|locus:1009023378 LCR19 "low-molecular-weight cysteine-rich 19" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173288 LCR80 "AT5G38330" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1009023434 LCR58 "low-molecular-weight cysteine-rich 58" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1009023418 LCR57 "low-molecular-weight cysteine-rich 57" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1009023189 LCR62 "low-molecular-weight cysteine-rich 62" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M4R9 F1M4R9 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1009023366 LCR61 "low-molecular-weight cysteine-rich 61" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M211 F1M211 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2149673 Krtap5-5 "keratin associated protein 5-5" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| PF07333 | 58 | SLR1-BP: S locus-related glycoprotein 1 binding po | 97.8 | |
| PF07333 | 58 | SLR1-BP: S locus-related glycoprotein 1 binding po | 96.76 | |
| PF10868 | 90 | DUF2667: Protein of unknown function (DUF2667); In | 96.74 | |
| PF00304 | 47 | Gamma-thionin: Gamma-thionin family; InterPro: IPR | 91.85 | |
| cd00107 | 33 | Knot1 The "knottin" fold is stable cysteine-rich s | 84.66 | |
| PF00451 | 32 | Toxin_2: Scorpion short toxin, BmKK2; InterPro: IP | 82.51 |
| >PF07333 SLR1-BP: S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP); InterPro: IPR010851 This entry consists of a number of cysteine rich SLR1 binding pollen coat like proteins | Back alignment and domain information |
|---|
Probab=97.80 E-value=2.1e-05 Score=50.56 Aligned_cols=46 Identities=33% Similarity=0.758 Sum_probs=37.3
Q ss_pred cccccccC-ccCCcchhhHHHHhcccCceeeeee-cCCccceEEEecC
Q 041978 78 CTAGLGAC-DQCRDLCCNGKCAAQFKGGQGFCDN-IGAQYLCQCTYDC 123 (123)
Q Consensus 78 C~~G~GlC-~~C~~~CCn~~Ca~kY~~G~G~C~~-~~~~~~C~C~Y~C 123 (123)
|..-+-+= ..|..+=|++.|++||+.+.|.|.. ..+...|+|+|+|
T Consensus 11 C~~~l~~~~~~C~~~~C~~~C~~k~~g~~G~C~~~~~~~~~C~C~Y~C 58 (58)
T PF07333_consen 11 CHEVLPNKPGPCDPQDCRSLCKKKYKGGVGTCIPKPKGPKQCLCTYNC 58 (58)
T ss_pred CceeCccCCCCCChHHHHHHHHHHcCCCceEeccCCCCCCeeEEEeeC
Confidence 55554444 5677778999999999999999999 5555899999998
|
Adhesion of pollen grains to the stigmatic surface is a critical step during sexual reproduction in plants. In Brassica, S locus-related glycoprotein 1 (SLR1), a stigma-specific protein belonging to the S gene family of proteins, has been shown to be involved in this step. SLR1-BP specifically binds SLR1 with high affinity. The SLR1-BP gene is specifically expressed in pollen at late stages of development and is a member of the class A pollen coat protein (PCP) family, which includes PCP-A1, an SLG (S locus glycoprotein)-binding protein []. This entry also includes defensin-like proteins. The function of these proteins is uncharacterised. |
| >PF07333 SLR1-BP: S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP); InterPro: IPR010851 This entry consists of a number of cysteine rich SLR1 binding pollen coat like proteins | Back alignment and domain information |
|---|
| >PF10868 DUF2667: Protein of unknown function (DUF2667); InterPro: IPR022618 This family of proteins with unknown function appears to be restricted to Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF00304 Gamma-thionin: Gamma-thionin family; InterPro: IPR008176 The following small plant proteins are evolutionary related: Gamma-thionins from Triticum aestivum (Wheat) endosperm (gamma-purothionins) and gamma-hordothionins from Hordeum vulgare(Barley) are toxic to animal cells and inhibit protein synthesis in cell free systems [] | Back alignment and domain information |
|---|
| >cd00107 Knot1 The "knottin" fold is stable cysteine-rich scaffold, in which one disulfide bridge crosses the macrocycle made by two other disulfide bridges and the connecting backbone segments | Back alignment and domain information |
|---|
| >PF00451 Toxin_2: Scorpion short toxin, BmKK2; InterPro: IPR001947 Scorpion venoms contain a variety of peptides toxic to mammals, insects and crustaceans | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| 2ksk_A | 71 | Sugarcane defensin 5; csalphabeta motif, antimicro | 95.21 | |
| 3psm_A | 47 | Defensin, SPE10; dimer, antimicrobial protein; 0.9 | 93.81 | |
| 1c49_A | 35 | Toxin K-beta; scorpion toxin, potassium channels b | 93.21 | |
| 1quz_A | 35 | HSTX1 toxin; scorpion toxin, alpha beta, molecular | 93.19 | |
| 1n8m_A | 38 | PI4, potassium channel blocking toxin 4; potassium | 92.41 | |
| 1qky_A | 38 | PI7, toxin 7 from pandinus imperator; neurotoxin; | 92.31 | |
| 1ayj_A | 51 | RS-AFP1, antifungal protein 1; fungicide, plant de | 92.24 | |
| 2kpy_A | 108 | Major pollen allergen ART V 1; defensin-like, poly | 91.83 | |
| 1bk8_A | 50 | AH-AMP1, antimicrobial protein 1; plant defensin, | 91.73 | |
| 2k9o_A | 36 | VM24 scorpion toxin; ALFA/beta scaffold, beta shee | 91.09 | |
| 1wt7_A | 41 | BUTX-MTX; maurotoxin, butantoxin, scorpion toxin, | 90.74 | |
| 1wmt_A | 41 | ISTX; neurotoxin, potassium channel blocker, solut | 90.29 | |
| 1jkz_A | 46 | PSD1, defense-related peptide 1; plant defensin, C | 89.51 | |
| 1mr4_A | 47 | Nicotiana alata plant defensin 1 (NAD1); cysteine- | 87.71 | |
| 1n4n_A | 47 | PHD1, floral defensin-like protein 1; cysteine-sta | 87.13 | |
| 1gps_A | 47 | Gamma-1-P thionin; plant toxin; NMR {Triticum turg | 86.66 | |
| 1ti5_A | 46 | Plant defensin; insecticidal activity, MUNG bean, | 85.49 | |
| 2lt8_A | 42 | Eurocin; A/B-fold, cysteine stabilised, antimicrob | 83.92 | |
| 1bah_A | 37 | Charybdotoxin, chabii; neurotoxin, potassium chann | 83.8 | |
| 1wz5_A | 35 | Potassium channel blocking toxin 1; ionic channel | 83.31 | |
| 1j5j_A | 36 | BEKM-1 toxin; alpha-beta motif, cysteine-knot moti | 81.48 | |
| 1hly_A | 39 | Hongotoxin 1; scorpion, centruroides limbatus HGTX | 81.15 | |
| 1hp2_A | 37 | Tityustoxin K alpha; K+ channel, scorpion toxin, a | 80.71 |
| >2ksk_A Sugarcane defensin 5; csalphabeta motif, antimicrobial protein; NMR {Saccharum officinarum} | Back alignment and structure |
|---|
Probab=95.21 E-value=0.017 Score=38.49 Aligned_cols=52 Identities=23% Similarity=0.543 Sum_probs=37.9
Q ss_pred eeccccccc----ccCCCCCccchHHhhhccCCCCcccccCCCCCCccEEEcCCCC
Q 041978 16 IKGDTCQEG----LGQCGASNDCDLHCKTRHAGQGQGSCDRTIQPPLCTCFYPCGS 67 (123)
Q Consensus 16 V~g~tCt~~----lG~C~~~~dC~~~Ck~~~~~~~~g~Cd~~~g~nlCtC~Y~C~~ 67 (123)
+||-+|... -|.|....+|+..|+.++-+...|+|.+......|+|+++|..
T Consensus 4 aEAr~C~s~S~~fkG~C~~~~nC~~vC~~~~Egf~~G~C~g~~~~rrC~Ctk~C~~ 59 (71)
T 2ksk_A 4 TPTPICKSRSHEYKGRCIQDMDCNAACVKESESYTGGFCNGRPPFKQCFCTKPCKR 59 (71)
T ss_dssp CSSCCEEEECSSSCSSCCCHHHHHHHHHHHCSSCCEEEEECCSSSCEEEEEECCSS
T ss_pred ccchhhhccCCCCeEEcCCCccHHHhccCcCCCCCCCCcCCCCCCceEEEECCcCC
Confidence 455567654 5899877889999998622346799986333357999999974
|
| >3psm_A Defensin, SPE10; dimer, antimicrobial protein; 0.98A {Pachyrhizus erosus} SCOP: g.3.7.5 PDB: 2gl1_A 2lj7_A | Back alignment and structure |
|---|
| >1c49_A Toxin K-beta; scorpion toxin, potassium channels blockers, alpha-K toxin family, neurotoxin, solution structure; NMR {Pandinus imperator} SCOP: g.3.7.2 PDB: 2pta_A | Back alignment and structure |
|---|
| >1quz_A HSTX1 toxin; scorpion toxin, alpha beta, molecular modeling, potassium channel; NMR {Synthetic} SCOP: k.23.1.1 PDB: 1y2p_A 1wpd_A | Back alignment and structure |
|---|
| >1n8m_A PI4, potassium channel blocking toxin 4; potassium channel blocker, disulfide bridge stabilized alpha beta motif; NMR {Synthetic} SCOP: g.3.7.2 PDB: 1v56_A 1txm_A | Back alignment and structure |
|---|
| >1qky_A PI7, toxin 7 from pandinus imperator; neurotoxin; NMR {Pandinus imperator} SCOP: g.3.7.2 | Back alignment and structure |
|---|
| >1ayj_A RS-AFP1, antifungal protein 1; fungicide, plant defensin, cysteine-stabilized ALFA/beta motif; HET: PCA; NMR {Raphanus sativus var} SCOP: g.3.7.5 | Back alignment and structure |
|---|
| >2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} | Back alignment and structure |
|---|
| >1bk8_A AH-AMP1, antimicrobial protein 1; plant defensin, cysteine-stabilized ALFA/ beta motif; NMR {Aesculus hippocastanum} SCOP: g.3.7.5 | Back alignment and structure |
|---|
| >2k9o_A VM24 scorpion toxin; ALFA/beta scaffold, beta sheet, ALFA helix, scorpion K+ toxin; NMR {Synthetic} | Back alignment and structure |
|---|
| >1wt7_A BUTX-MTX; maurotoxin, butantoxin, scorpion toxin, K+ channels, molecular contacts, toxin affinity; NMR {Synthetic} SCOP: g.3.7.2 PDB: 2z3s_A | Back alignment and structure |
|---|
| >1wmt_A ISTX; neurotoxin, potassium channel blocker, solution structure, alpha-K toxin family, scorpion toxin; NMR {Synthetic} SCOP: g.3.7.2 | Back alignment and structure |
|---|
| >1jkz_A PSD1, defense-related peptide 1; plant defensin, Cys-rich, antifungal, antifungal protein; NMR {Pisum sativum} SCOP: g.3.7.5 | Back alignment and structure |
|---|
| >1mr4_A Nicotiana alata plant defensin 1 (NAD1); cysteine-stabilized alpha-beta motif, plant defensin fold, plant protein; NMR {Nicotiana tabacum} SCOP: g.3.7.5 PDB: 4aaz_A 4ab0_A | Back alignment and structure |
|---|
| >1n4n_A PHD1, floral defensin-like protein 1; cysteine-stabilised alpha-beta motif, fifth disulfide bond, plant protein; NMR {Petunia x hybrida} SCOP: g.3.7.5 | Back alignment and structure |
|---|
| >1gps_A Gamma-1-P thionin; plant toxin; NMR {Triticum turgidum} SCOP: g.3.7.5 PDB: 1gpt_A | Back alignment and structure |
|---|
| >1ti5_A Plant defensin; insecticidal activity, MUNG bean, plant protein; NMR {Vigna radiata} | Back alignment and structure |
|---|
| >2lt8_A Eurocin; A/B-fold, cysteine stabilised, antimicrobial protein; NMR {Eurotium amstelodami} | Back alignment and structure |
|---|
| >1bah_A Charybdotoxin, chabii; neurotoxin, potassium channel inhibitor; HET: PCA ABA; NMR {Leiurus quinquestriatus} SCOP: g.3.7.2 PDB: 2a9h_E* 2crd_A* 1lir_A* | Back alignment and structure |
|---|
| >1wz5_A Potassium channel blocking toxin 1; ionic channel inhibitor; HET: ABA; NMR {Pandinus imperator} | Back alignment and structure |
|---|
| >1j5j_A BEKM-1 toxin; alpha-beta motif, cysteine-knot motif; NMR {Mesobuthus eupeus} SCOP: g.3.7.2 PDB: 1lgl_A | Back alignment and structure |
|---|
| >1hly_A Hongotoxin 1; scorpion, centruroides limbatus HGTX1, potassium channel; NMR {Centruroides limbatus} SCOP: g.3.7.2 PDB: 1mtx_A 1sxm_A | Back alignment and structure |
|---|
| >1hp2_A Tityustoxin K alpha; K+ channel, scorpion toxin, alpha-K toxin,; NMR {Tityus serrulatus} SCOP: g.3.7.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| d1ayja_ | 51 | Antifungal protein 1 (RS-AFP1) {Radish (Raphanus s | 97.72 | |
| d1bk8a_ | 50 | Antimicrobial protein 1 (AH-AMP1) {Horse chestnut | 97.7 | |
| d1sxma_ | 39 | Noxiustoxin {Mexican scorpion (Centruroides noxius | 86.17 |
| >d1ayja_ g.3.7.5 (A:) Antifungal protein 1 (RS-AFP1) {Radish (Raphanus sativus) [TaxId: 3726]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: Scorpion toxin-like family: Plant defensins domain: Antifungal protein 1 (RS-AFP1) species: Radish (Raphanus sativus) [TaxId: 3726]
Probab=97.72 E-value=6.4e-06 Score=50.61 Aligned_cols=40 Identities=33% Similarity=0.944 Sum_probs=36.6
Q ss_pred ccCCCCCccchHHhhhccCCCCcccccCCCCCCccEEEcCC
Q 041978 25 LGQCGASNDCDLHCKTRHAGQGQGSCDRTIQPPLCTCFYPC 65 (123)
Q Consensus 25 lG~C~~~~dC~~~Ck~~~~~~~~g~Cd~~~g~nlCtC~Y~C 65 (123)
.|.|+.+..||.+|+.+.+ +..|+|....+..+|.|+|+|
T Consensus 12 sG~Cgn~~~C~~qC~~~E~-A~hGaCh~~f~~~~CfCYF~C 51 (51)
T d1ayja_ 12 SGVCGNNNACKNQCINLEK-ARHGSCNYVFPAHKCICYFPC 51 (51)
T ss_dssp CSCCSCHHHHHHHHHHHSC-CSCEEEECCSSSCEEEEEECC
T ss_pred eeccCCchHHHHHHHhhhh-ccccccccccCCccEEEeccC
Confidence 5789988899999999998 689999988889999999987
|
| >d1bk8a_ g.3.7.5 (A:) Antimicrobial protein 1 (AH-AMP1) {Horse chestnut (Aesculus hippocastanum) [TaxId: 43364]} | Back information, alignment and structure |
|---|
| >d1sxma_ g.3.7.2 (A:) Noxiustoxin {Mexican scorpion (Centruroides noxius) [TaxId: 6878]} | Back information, alignment and structure |
|---|