Citrus Sinensis ID: 041978


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
LLIQLINLRGNVVHTIKGDTCQEGLGQCGASNDCDLHCKTRHAGQGQGSCDRTIQPPLCTCFYPCGSPSKRPSSPKKCTAGLGACDQCRDLCCNGKCAAQFKGGQGFCDNIGAQYLCQCTYDC
cHHHHHHHHHHEEEEEEcccccccccccccccHHHHHHHHcccccccccccccccccccEEEcccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccEEEEEEccc
cHHHHHHHHHHHHHEEccccccHccccccccccHHHHHHHHccccccccccccccccEEEEEccccccccccccccccccccccccccccHcccHHHHHHHcccccccccccccEEEEEEccc
LLIQLINLRgnvvhtikgdtcqeglgqcgasndcdlhcktrhagqgqgscdrtiqpplctcfypcgspskrpsspkkctaglgacdqcrdlccngkcaaqfkggqgfcdnigaqylcqctydc
LLIQLINLRGNVVHTIKGDTCQEGLGQCGASNDCDLHCKTRHAGQGQGSCDRTIQPPLCTCFYPCGSPSKRPSSPKKCTAGLGACDQCRDLCCNGKCAAQFKGGQGFCDNIGAQYLCQCTYDC
LLIQLINLRGNVVHTIKGDTCQEGLGQCGASNDCDLHCKTRHAGQGQGSCDRTIQPPLCTCFYPCGspskrpsspkkCTAGLGACDQCRDLCCNGKCAAQFKGGQGFCDNIGAQYLCQCTYDC
*LIQLINLRGNVVHTIKGDTCQEGLGQCGASNDCDLHCKTRHAGQGQGSCDRTIQPPLCTCFYPCG***********CTAGLGACDQCRDLCCNGKCAAQFKGGQGFCDNIGAQYLCQCTY**
LLIQLINLRGNVVHTIKGDTCQEGLGQCGASNDCDLHCKTRHA**GQGSCDRTIQPPLCTCFYPCG**********KCTAGLGACDQCRDLCCNGKCAAQFKGGQGFCDNIGAQYLCQCTYDC
LLIQLINLRGNVVHTIKGDTCQEGLGQCGASNDCDLHCKTR********CDRTIQPPLCTCFYPCGS************AGLGACDQCRDLCCNGKCAAQFKGGQGFCDNIGAQYLCQCTYDC
LLIQLINLRGNVVHTIKGDTCQEGLGQCGASNDCDLHCKTRHAGQGQGSCDRTIQPPLCTCFYPCGSPSKRPSSPKKCTAGLGACDQCRDLCCNGKCAAQFKGGQGFCDNIGAQYLCQCTYDC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LLIQLINLRGNVVHTIKGDTCQEGLGQCGASNDCDLHCKTRHAGQGQGSCDRTIQPPLCTCFYPCGSPSKRPSSPKKCTAGLGACDQCRDLCCNGKCAAQFKGGQGFCDNIGAQYLCQCTYDC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query123 2.2.26 [Sep-21-2011]
P82773129 Defensin-like protein 182 yes no 0.975 0.930 0.435 3e-20
P82733126 Defensin-like protein 183 no no 0.943 0.920 0.44 5e-19
P82789122 Defensin-like protein 181 no no 0.910 0.918 0.341 1e-11
P82772127 Putative defensin-like pr no no 0.959 0.929 0.330 2e-11
P82771120 Putative defensin-like pr no no 0.821 0.841 0.286 0.0002
>sp|P82773|DF182_ARATH Defensin-like protein 182 OS=Arabidopsis thaliana GN=PDF3.2 PE=2 SV=1 Back     alignment and function desciption
 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/124 (43%), Positives = 75/124 (60%), Gaps = 4/124 (3%)

Query: 1   LLIQLINLRGNVVHTIKGDTCQEGLGQCGASNDCDLHCKTRHAGQGQGSCDRTIQPPLCT 60
            ++ L+ +  +VV+  +GDTC +GLG C   N+CD  CK +H    + SCDR++  PLC 
Sbjct: 9   FIVNLLIIFTSVVNQARGDTCIDGLGYC---NNCDERCKAKHGPSSESSCDRSVGVPLCK 65

Query: 61  CFYPCGSPSKRPSSPKKCTAGLGACDQ-CRDLCCNGKCAAQFKGGQGFCDNIGAQYLCQC 119
           C+Y C SP   P+ PKKC  G G C Q C+  CC+  CA ++ GG GFC+ +G    CQC
Sbjct: 66  CYYECESPPSPPAPPKKCDGGAGICSQRCQGQCCDMNCAQKYIGGHGFCNTLGTFSFCQC 125

Query: 120 TYDC 123
            Y C
Sbjct: 126 EYPC 129




Confers broad-spectrum resistance to pathogens.
Arabidopsis thaliana (taxid: 3702)
>sp|P82733|DF183_ARATH Defensin-like protein 183 OS=Arabidopsis thaliana GN=LCR19 PE=2 SV=1 Back     alignment and function description
>sp|P82789|DF181_ARATH Defensin-like protein 181 OS=Arabidopsis thaliana GN=PDF3.1 PE=2 SV=2 Back     alignment and function description
>sp|P82772|DF180_ARATH Putative defensin-like protein 180 OS=Arabidopsis thaliana GN=LCR58 PE=3 SV=1 Back     alignment and function description
>sp|P82771|DF179_ARATH Putative defensin-like protein 179 OS=Arabidopsis thaliana GN=LCR57 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
21618072129 unknown [Arabidopsis thaliana] 0.975 0.930 0.435 3e-22
297803024127 hypothetical protein ARALYDRAFT_491747 [ 0.959 0.929 0.435 1e-19
18417524129 defensin-like protein 182 [Arabidopsis t 0.975 0.930 0.435 1e-18
116831413130 unknown [Arabidopsis thaliana] 0.975 0.923 0.435 1e-18
297798972119 predicted protein [Arabidopsis lyrata su 0.951 0.983 0.443 4e-18
79325742126 defensin-like protein 183 [Arabidopsis t 0.943 0.920 0.44 2e-17
356530322134 PREDICTED: defensin-like protein 183-lik 0.959 0.880 0.441 4e-15
4938483161 hypothetical protein [Arabidopsis thalia 0.804 0.614 0.466 4e-14
449461213115 PREDICTED: defensin-like protein 182-lik 0.837 0.895 0.458 4e-14
356530320137 PREDICTED: uncharacterized protein LOC10 0.845 0.759 0.418 1e-11
>gi|21618072|gb|AAM67122.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/124 (43%), Positives = 75/124 (60%), Gaps = 4/124 (3%)

Query: 1   LLIQLINLRGNVVHTIKGDTCQEGLGQCGASNDCDLHCKTRHAGQGQGSCDRTIQPPLCT 60
            ++ L+ +  +VV+  +GDTC +GLG C   N+CD  CK +H    + SCDR++  PLC 
Sbjct: 9   FIVNLLIIFTSVVNQARGDTCIDGLGYC---NNCDERCKAKHGPSSESSCDRSVGVPLCK 65

Query: 61  CFYPCGSPSKRPSSPKKCTAGLGACDQ-CRDLCCNGKCAAQFKGGQGFCDNIGAQYLCQC 119
           C+Y C SP   P+ PKKC  G G C Q C+  CC+  CA ++ GG GFC+ +G    CQC
Sbjct: 66  CYYECESPPSPPAQPKKCDGGAGICSQRCQGQCCDMNCAQKYIGGHGFCNTLGTFSFCQC 125

Query: 120 TYDC 123
            Y C
Sbjct: 126 EYPC 129




Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297803024|ref|XP_002869396.1| hypothetical protein ARALYDRAFT_491747 [Arabidopsis lyrata subsp. lyrata] gi|297315232|gb|EFH45655.1| hypothetical protein ARALYDRAFT_491747 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18417524|ref|NP_567840.1| defensin-like protein 182 [Arabidopsis thaliana] gi|46396245|sp|P82773.1|DF182_ARATH RecName: Full=Defensin-like protein 182; AltName: Full=Low-molecular-weight cysteine-rich protein 59; Short=Protein LCR59; AltName: Full=Plant defensin 3.2; Flags: Precursor gi|91806752|gb|ABE66103.1| plant defensin-fusion protein [Arabidopsis thaliana] gi|332660316|gb|AEE85716.1| defensin-like protein 182 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|116831413|gb|ABK28659.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297798972|ref|XP_002867370.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297313206|gb|EFH43629.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|79325742|ref|NP_001031755.1| defensin-like protein 183 [Arabidopsis thaliana] gi|46396210|sp|P82733.1|DF183_ARATH RecName: Full=Defensin-like protein 183; AltName: Full=Low-molecular-weight cysteine-rich protein 19; Short=Protein LCR19; Flags: Precursor gi|332660317|gb|AEE85717.1| defensin-like protein 183 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356530322|ref|XP_003533731.1| PREDICTED: defensin-like protein 183-like [Glycine max] Back     alignment and taxonomy information
>gi|4938483|emb|CAB43842.1| hypothetical protein [Arabidopsis thaliana] gi|7269907|emb|CAB81000.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449461213|ref|XP_004148336.1| PREDICTED: defensin-like protein 182-like [Cucumis sativus] gi|449510579|ref|XP_004163705.1| PREDICTED: defensin-like protein 182-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356530320|ref|XP_003533730.1| PREDICTED: uncharacterized protein LOC100812103 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
TAIR|locus:2126545129 LCR59 "low-molecular-weight cy 0.967 0.922 0.390 1.2e-24
TAIR|locus:1009023378126 LCR19 "low-molecular-weight cy 0.869 0.849 0.421 2.1e-22
TAIR|locus:2173288122 LCR80 "AT5G38330" [Arabidopsis 0.910 0.918 0.333 4.6e-18
TAIR|locus:1009023434127 LCR58 "low-molecular-weight cy 0.861 0.834 0.348 8.6e-17
TAIR|locus:1009023418120 LCR57 "low-molecular-weight cy 0.886 0.908 0.276 2.8e-11
TAIR|locus:100902318978 LCR62 "low-molecular-weight cy 0.365 0.576 0.422 2.6e-06
UNIPROTKB|F1M4R9188 F1M4R9 "Uncharacterized protei 0.666 0.436 0.311 3.3e-06
TAIR|locus:100902336678 LCR61 "low-molecular-weight cy 0.365 0.576 0.422 3.4e-06
UNIPROTKB|F1M211 240 F1M211 "Uncharacterized protei 0.796 0.408 0.283 3.4e-06
MGI|MGI:2149673 241 Krtap5-5 "keratin associated p 0.739 0.377 0.287 1.3e-05
TAIR|locus:2126545 LCR59 "low-molecular-weight cysteine-rich 59" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 281 (104.0 bits), Expect = 1.2e-24, P = 1.2e-24
 Identities = 48/123 (39%), Positives = 68/123 (55%)

Query:     2 LIQLINLRGNVVHTIKGDTCQEGLGQCGASNDCDLHCKTRHAGQGQGSCDRTIQPPLCTC 61
             ++ L+ +  +VV+  +GDTC +GLG C   N+CD  CK +H    + SCDR++  PLC C
Sbjct:    10 IVNLLIIFTSVVNQARGDTCIDGLGYC---NNCDERCKAKHGPSSESSCDRSVGVPLCKC 66

Query:    62 FYPCGXXXXXXXXXXXCTAGLGACDQ-CRDLCCNGKCAAQFKGGQGFCDNIGAQYLCQCT 120
             +Y C            C  G G C Q C+  CC+  CA ++ GG GFC+ +G    CQC 
Sbjct:    67 YYECESPPSPPAPPKKCDGGAGICSQRCQGQCCDMNCAQKYIGGHGFCNTLGTFSFCQCE 126

Query:   121 YDC 123
             Y C
Sbjct:   127 YPC 129




GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=ISS
TAIR|locus:1009023378 LCR19 "low-molecular-weight cysteine-rich 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173288 LCR80 "AT5G38330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023434 LCR58 "low-molecular-weight cysteine-rich 58" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023418 LCR57 "low-molecular-weight cysteine-rich 57" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023189 LCR62 "low-molecular-weight cysteine-rich 62" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1M4R9 F1M4R9 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:1009023366 LCR61 "low-molecular-weight cysteine-rich 61" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1M211 F1M211 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2149673 Krtap5-5 "keratin associated protein 5-5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P82773DF182_ARATHNo assigned EC number0.43540.97560.9302yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 123
PF0733358 SLR1-BP: S locus-related glycoprotein 1 binding po 97.8
PF0733358 SLR1-BP: S locus-related glycoprotein 1 binding po 96.76
PF1086890 DUF2667: Protein of unknown function (DUF2667); In 96.74
PF0030447 Gamma-thionin: Gamma-thionin family; InterPro: IPR 91.85
cd0010733 Knot1 The "knottin" fold is stable cysteine-rich s 84.66
PF0045132 Toxin_2: Scorpion short toxin, BmKK2; InterPro: IP 82.51
>PF07333 SLR1-BP: S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP); InterPro: IPR010851 This entry consists of a number of cysteine rich SLR1 binding pollen coat like proteins Back     alignment and domain information
Probab=97.80  E-value=2.1e-05  Score=50.56  Aligned_cols=46  Identities=33%  Similarity=0.758  Sum_probs=37.3

Q ss_pred             cccccccC-ccCCcchhhHHHHhcccCceeeeee-cCCccceEEEecC
Q 041978           78 CTAGLGAC-DQCRDLCCNGKCAAQFKGGQGFCDN-IGAQYLCQCTYDC  123 (123)
Q Consensus        78 C~~G~GlC-~~C~~~CCn~~Ca~kY~~G~G~C~~-~~~~~~C~C~Y~C  123 (123)
                      |..-+-+= ..|..+=|++.|++||+.+.|.|.. ..+...|+|+|+|
T Consensus        11 C~~~l~~~~~~C~~~~C~~~C~~k~~g~~G~C~~~~~~~~~C~C~Y~C   58 (58)
T PF07333_consen   11 CHEVLPNKPGPCDPQDCRSLCKKKYKGGVGTCIPKPKGPKQCLCTYNC   58 (58)
T ss_pred             CceeCccCCCCCChHHHHHHHHHHcCCCceEeccCCCCCCeeEEEeeC
Confidence            55554444 5677778999999999999999999 5555899999998



Adhesion of pollen grains to the stigmatic surface is a critical step during sexual reproduction in plants. In Brassica, S locus-related glycoprotein 1 (SLR1), a stigma-specific protein belonging to the S gene family of proteins, has been shown to be involved in this step. SLR1-BP specifically binds SLR1 with high affinity. The SLR1-BP gene is specifically expressed in pollen at late stages of development and is a member of the class A pollen coat protein (PCP) family, which includes PCP-A1, an SLG (S locus glycoprotein)-binding protein []. This entry also includes defensin-like proteins. The function of these proteins is uncharacterised.

>PF07333 SLR1-BP: S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP); InterPro: IPR010851 This entry consists of a number of cysteine rich SLR1 binding pollen coat like proteins Back     alignment and domain information
>PF10868 DUF2667: Protein of unknown function (DUF2667); InterPro: IPR022618 This family of proteins with unknown function appears to be restricted to Arabidopsis thaliana Back     alignment and domain information
>PF00304 Gamma-thionin: Gamma-thionin family; InterPro: IPR008176 The following small plant proteins are evolutionary related: Gamma-thionins from Triticum aestivum (Wheat) endosperm (gamma-purothionins) and gamma-hordothionins from Hordeum vulgare(Barley) are toxic to animal cells and inhibit protein synthesis in cell free systems [] Back     alignment and domain information
>cd00107 Knot1 The "knottin" fold is stable cysteine-rich scaffold, in which one disulfide bridge crosses the macrocycle made by two other disulfide bridges and the connecting backbone segments Back     alignment and domain information
>PF00451 Toxin_2: Scorpion short toxin, BmKK2; InterPro: IPR001947 Scorpion venoms contain a variety of peptides toxic to mammals, insects and crustaceans Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
2ksk_A71 Sugarcane defensin 5; csalphabeta motif, antimicro 95.21
3psm_A47 Defensin, SPE10; dimer, antimicrobial protein; 0.9 93.81
1c49_A35 Toxin K-beta; scorpion toxin, potassium channels b 93.21
1quz_A35 HSTX1 toxin; scorpion toxin, alpha beta, molecular 93.19
1n8m_A38 PI4, potassium channel blocking toxin 4; potassium 92.41
1qky_A38 PI7, toxin 7 from pandinus imperator; neurotoxin; 92.31
1ayj_A51 RS-AFP1, antifungal protein 1; fungicide, plant de 92.24
2kpy_A108 Major pollen allergen ART V 1; defensin-like, poly 91.83
1bk8_A50 AH-AMP1, antimicrobial protein 1; plant defensin, 91.73
2k9o_A36 VM24 scorpion toxin; ALFA/beta scaffold, beta shee 91.09
1wt7_A41 BUTX-MTX; maurotoxin, butantoxin, scorpion toxin, 90.74
1wmt_A41 ISTX; neurotoxin, potassium channel blocker, solut 90.29
1jkz_A46 PSD1, defense-related peptide 1; plant defensin, C 89.51
1mr4_A47 Nicotiana alata plant defensin 1 (NAD1); cysteine- 87.71
1n4n_A47 PHD1, floral defensin-like protein 1; cysteine-sta 87.13
1gps_A47 Gamma-1-P thionin; plant toxin; NMR {Triticum turg 86.66
1ti5_A46 Plant defensin; insecticidal activity, MUNG bean, 85.49
2lt8_A42 Eurocin; A/B-fold, cysteine stabilised, antimicrob 83.92
1bah_A37 Charybdotoxin, chabii; neurotoxin, potassium chann 83.8
1wz5_A35 Potassium channel blocking toxin 1; ionic channel 83.31
1j5j_A36 BEKM-1 toxin; alpha-beta motif, cysteine-knot moti 81.48
1hly_A39 Hongotoxin 1; scorpion, centruroides limbatus HGTX 81.15
1hp2_A37 Tityustoxin K alpha; K+ channel, scorpion toxin, a 80.71
>2ksk_A Sugarcane defensin 5; csalphabeta motif, antimicrobial protein; NMR {Saccharum officinarum} Back     alignment and structure
Probab=95.21  E-value=0.017  Score=38.49  Aligned_cols=52  Identities=23%  Similarity=0.543  Sum_probs=37.9

Q ss_pred             eeccccccc----ccCCCCCccchHHhhhccCCCCcccccCCCCCCccEEEcCCCC
Q 041978           16 IKGDTCQEG----LGQCGASNDCDLHCKTRHAGQGQGSCDRTIQPPLCTCFYPCGS   67 (123)
Q Consensus        16 V~g~tCt~~----lG~C~~~~dC~~~Ck~~~~~~~~g~Cd~~~g~nlCtC~Y~C~~   67 (123)
                      +||-+|...    -|.|....+|+..|+.++-+...|+|.+......|+|+++|..
T Consensus         4 aEAr~C~s~S~~fkG~C~~~~nC~~vC~~~~Egf~~G~C~g~~~~rrC~Ctk~C~~   59 (71)
T 2ksk_A            4 TPTPICKSRSHEYKGRCIQDMDCNAACVKESESYTGGFCNGRPPFKQCFCTKPCKR   59 (71)
T ss_dssp             CSSCCEEEECSSSCSSCCCHHHHHHHHHHHCSSCCEEEEECCSSSCEEEEEECCSS
T ss_pred             ccchhhhccCCCCeEEcCCCccHHHhccCcCCCCCCCCcCCCCCCceEEEECCcCC
Confidence            455567654    5899877889999998622346799986333357999999974



>3psm_A Defensin, SPE10; dimer, antimicrobial protein; 0.98A {Pachyrhizus erosus} SCOP: g.3.7.5 PDB: 2gl1_A 2lj7_A Back     alignment and structure
>1c49_A Toxin K-beta; scorpion toxin, potassium channels blockers, alpha-K toxin family, neurotoxin, solution structure; NMR {Pandinus imperator} SCOP: g.3.7.2 PDB: 2pta_A Back     alignment and structure
>1quz_A HSTX1 toxin; scorpion toxin, alpha beta, molecular modeling, potassium channel; NMR {Synthetic} SCOP: k.23.1.1 PDB: 1y2p_A 1wpd_A Back     alignment and structure
>1n8m_A PI4, potassium channel blocking toxin 4; potassium channel blocker, disulfide bridge stabilized alpha beta motif; NMR {Synthetic} SCOP: g.3.7.2 PDB: 1v56_A 1txm_A Back     alignment and structure
>1qky_A PI7, toxin 7 from pandinus imperator; neurotoxin; NMR {Pandinus imperator} SCOP: g.3.7.2 Back     alignment and structure
>1ayj_A RS-AFP1, antifungal protein 1; fungicide, plant defensin, cysteine-stabilized ALFA/beta motif; HET: PCA; NMR {Raphanus sativus var} SCOP: g.3.7.5 Back     alignment and structure
>2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Back     alignment and structure
>1bk8_A AH-AMP1, antimicrobial protein 1; plant defensin, cysteine-stabilized ALFA/ beta motif; NMR {Aesculus hippocastanum} SCOP: g.3.7.5 Back     alignment and structure
>2k9o_A VM24 scorpion toxin; ALFA/beta scaffold, beta sheet, ALFA helix, scorpion K+ toxin; NMR {Synthetic} Back     alignment and structure
>1wt7_A BUTX-MTX; maurotoxin, butantoxin, scorpion toxin, K+ channels, molecular contacts, toxin affinity; NMR {Synthetic} SCOP: g.3.7.2 PDB: 2z3s_A Back     alignment and structure
>1wmt_A ISTX; neurotoxin, potassium channel blocker, solution structure, alpha-K toxin family, scorpion toxin; NMR {Synthetic} SCOP: g.3.7.2 Back     alignment and structure
>1jkz_A PSD1, defense-related peptide 1; plant defensin, Cys-rich, antifungal, antifungal protein; NMR {Pisum sativum} SCOP: g.3.7.5 Back     alignment and structure
>1mr4_A Nicotiana alata plant defensin 1 (NAD1); cysteine-stabilized alpha-beta motif, plant defensin fold, plant protein; NMR {Nicotiana tabacum} SCOP: g.3.7.5 PDB: 4aaz_A 4ab0_A Back     alignment and structure
>1n4n_A PHD1, floral defensin-like protein 1; cysteine-stabilised alpha-beta motif, fifth disulfide bond, plant protein; NMR {Petunia x hybrida} SCOP: g.3.7.5 Back     alignment and structure
>1gps_A Gamma-1-P thionin; plant toxin; NMR {Triticum turgidum} SCOP: g.3.7.5 PDB: 1gpt_A Back     alignment and structure
>1ti5_A Plant defensin; insecticidal activity, MUNG bean, plant protein; NMR {Vigna radiata} Back     alignment and structure
>2lt8_A Eurocin; A/B-fold, cysteine stabilised, antimicrobial protein; NMR {Eurotium amstelodami} Back     alignment and structure
>1bah_A Charybdotoxin, chabii; neurotoxin, potassium channel inhibitor; HET: PCA ABA; NMR {Leiurus quinquestriatus} SCOP: g.3.7.2 PDB: 2a9h_E* 2crd_A* 1lir_A* Back     alignment and structure
>1wz5_A Potassium channel blocking toxin 1; ionic channel inhibitor; HET: ABA; NMR {Pandinus imperator} Back     alignment and structure
>1j5j_A BEKM-1 toxin; alpha-beta motif, cysteine-knot motif; NMR {Mesobuthus eupeus} SCOP: g.3.7.2 PDB: 1lgl_A Back     alignment and structure
>1hly_A Hongotoxin 1; scorpion, centruroides limbatus HGTX1, potassium channel; NMR {Centruroides limbatus} SCOP: g.3.7.2 PDB: 1mtx_A 1sxm_A Back     alignment and structure
>1hp2_A Tityustoxin K alpha; K+ channel, scorpion toxin, alpha-K toxin,; NMR {Tityus serrulatus} SCOP: g.3.7.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
d1ayja_51 Antifungal protein 1 (RS-AFP1) {Radish (Raphanus s 97.72
d1bk8a_50 Antimicrobial protein 1 (AH-AMP1) {Horse chestnut 97.7
d1sxma_39 Noxiustoxin {Mexican scorpion (Centruroides noxius 86.17
>d1ayja_ g.3.7.5 (A:) Antifungal protein 1 (RS-AFP1) {Radish (Raphanus sativus) [TaxId: 3726]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: Scorpion toxin-like
family: Plant defensins
domain: Antifungal protein 1 (RS-AFP1)
species: Radish (Raphanus sativus) [TaxId: 3726]
Probab=97.72  E-value=6.4e-06  Score=50.61  Aligned_cols=40  Identities=33%  Similarity=0.944  Sum_probs=36.6

Q ss_pred             ccCCCCCccchHHhhhccCCCCcccccCCCCCCccEEEcCC
Q 041978           25 LGQCGASNDCDLHCKTRHAGQGQGSCDRTIQPPLCTCFYPC   65 (123)
Q Consensus        25 lG~C~~~~dC~~~Ck~~~~~~~~g~Cd~~~g~nlCtC~Y~C   65 (123)
                      .|.|+.+..||.+|+.+.+ +..|+|....+..+|.|+|+|
T Consensus        12 sG~Cgn~~~C~~qC~~~E~-A~hGaCh~~f~~~~CfCYF~C   51 (51)
T d1ayja_          12 SGVCGNNNACKNQCINLEK-ARHGSCNYVFPAHKCICYFPC   51 (51)
T ss_dssp             CSCCSCHHHHHHHHHHHSC-CSCEEEECCSSSCEEEEEECC
T ss_pred             eeccCCchHHHHHHHhhhh-ccccccccccCCccEEEeccC
Confidence            5789988899999999998 689999988889999999987



>d1bk8a_ g.3.7.5 (A:) Antimicrobial protein 1 (AH-AMP1) {Horse chestnut (Aesculus hippocastanum) [TaxId: 43364]} Back     information, alignment and structure
>d1sxma_ g.3.7.2 (A:) Noxiustoxin {Mexican scorpion (Centruroides noxius) [TaxId: 6878]} Back     information, alignment and structure