Citrus Sinensis ID: 041984


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MKVSNLELVFTCTYGPMSFLNGKVVIKLSLEGHKSRSKALKIAVRVSGVESVALKGDDRSQIEVTGDGMDPVLLTSLLRKTMRFAELLTVINLKPKIM
cccccHHHHHHHcccccccEEEEEEEEEEcccccHHHHHHHHHHHcccEEEEEEcccccccEEEEcccccHHHHHHHHHHccccEEEEEEEccccccc
ccccHHHHHHHHHHcHHHHHHcEEEEEEEccccccHHHHHHHHHHccccEEEEEEcccccEEEEEcccccHHHHHHHHHHHcccEEEEEEEccccccc
mkvsnlelvftctygpmsflnGKVVIKLSLEGHKSRSKALKIAVRVSGVesvalkgddrsqievtgdgmdpVLLTSLLRKTMRFAELLTVinlkpkim
MKVSNLELVFTctygpmsflNGKVVIKLSLEGHKSRSKALKiavrvsgvesvalkgddrsqievtgdgmdpVLLTSLLRKTMRFAElltvinlkpkim
MKVSNLELVFTCTYGPMSFLNGKVVIKLSLEGHKSRSKALKIAVRVSGVESVALKGDDRSQIEVTGDGMDPVLLTSLLRKTMRFAELLTVINLKPKIM
*****LELVFTCTYGPMSFLNGKVVIKLSLEGHKSRSKALKIAVRVSGVESVALKG****QIEVTGDGMDPVLLTSLLRKTMRFAELLTVINL*****
***SNLELVFTCTYGPMSFLNGKVVIKLSLEGHKSRSKALKIAVRVSGVESVALKGDDRSQIEVTGDGMDPVLLTSLLRKTMRFAELLTVINL*****
MKVSNLELVFTCTYGPMSFLNGKVVIKLSLEGHKSRSKALKIAVRVSGVESVALKGDDRSQIEVTGDGMDPVLLTSLLRKTMRFAELLTVINLKPKIM
*KVSNLELVFTCTYGPMSFLNGKVVIKLSLEGHKSRSKALKIAVRVSGVESVALKGDDRSQIEVTGDGMDPVLLTSLLRKTMRFAELLTVINLK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiii
ooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVSNLELVFTCTYGPMSFLNGKVVIKLSLEGHKSRSKALKIAVRVSGVESVALKGDDRSQIEVTGDGMDPVLLTSLLRKTMRFAELLTVINLKPKIM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
255567218125 metal ion binding protein, putative [Ric 0.693 0.544 0.647 9e-16
296085070 213 unnamed protein product [Vitis vinifera] 0.693 0.319 0.602 6e-15
225447460118 PREDICTED: uncharacterized protein LOC10 0.693 0.576 0.602 6e-15
224150813118 predicted protein [Populus trichocarpa] 0.693 0.576 0.632 1e-14
225447462114 PREDICTED: uncharacterized protein LOC10 0.683 0.587 0.647 1e-14
224104235114 predicted protein [Populus trichocarpa] 0.693 0.596 0.617 4e-14
224104585121 predicted protein [Populus trichocarpa] 0.693 0.561 0.588 7e-14
225447458127 PREDICTED: uncharacterized protein LOC10 0.693 0.535 0.617 2e-13
357462411115 hypothetical protein MTR_3g082210 [Medic 0.693 0.591 0.608 3e-13
357462421 220 ATFP4 [Medicago truncatula] gi|355490540 0.765 0.340 0.48 4e-12
>gi|255567218|ref|XP_002524590.1| metal ion binding protein, putative [Ricinus communis] gi|223536143|gb|EEF37798.1| metal ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 87.4 bits (215), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 44/68 (64%), Positives = 55/68 (80%)

Query: 23 KVVIKLSLEGHKSRSKALKIAVRVSGVESVALKGDDRSQIEVTGDGMDPVLLTSLLRKTM 82
          KVVI++S+ G KSRSKALKIAV VSGVES +L G D+SQIEV GDG+D V L ++LRK +
Sbjct: 4  KVVIRVSMNGQKSRSKALKIAVSVSGVESASLGGQDKSQIEVVGDGVDAVELATMLRKNV 63

Query: 83 RFAELLTV 90
            AEL++V
Sbjct: 64 GHAELVSV 71




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296085070|emb|CBI28485.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225447460|ref|XP_002266819.1| PREDICTED: uncharacterized protein LOC100242530 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224150813|ref|XP_002337014.1| predicted protein [Populus trichocarpa] gi|222837833|gb|EEE76198.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225447462|ref|XP_002263769.1| PREDICTED: uncharacterized protein LOC100252914 [Vitis vinifera] gi|296085069|emb|CBI28484.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224104235|ref|XP_002313367.1| predicted protein [Populus trichocarpa] gi|222849775|gb|EEE87322.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224104585|ref|XP_002333922.1| predicted protein [Populus trichocarpa] gi|224129254|ref|XP_002320539.1| predicted protein [Populus trichocarpa] gi|222839172|gb|EEE77523.1| predicted protein [Populus trichocarpa] gi|222861312|gb|EEE98854.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225447458|ref|XP_002263660.1| PREDICTED: uncharacterized protein LOC100258045 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357462411|ref|XP_003601487.1| hypothetical protein MTR_3g082210 [Medicago truncatula] gi|355490535|gb|AES71738.1| hypothetical protein MTR_3g082210 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357462421|ref|XP_003601492.1| ATFP4 [Medicago truncatula] gi|355490540|gb|AES71743.1| ATFP4 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
TAIR|locus:2091112157 AT3G07600 [Arabidopsis thalian 0.744 0.464 0.438 3.1e-12
TAIR|locus:2156253 181 AT5G48290 [Arabidopsis thalian 0.744 0.403 0.438 6.4e-12
TAIR|locus:2138376110 AT4G05030 "AT4G05030" [Arabido 0.928 0.827 0.347 8.4e-10
TAIR|locus:2087580118 AT3G20180 "AT3G20180" [Arabido 0.734 0.610 0.397 2.6e-08
TAIR|locus:2025421 177 AT1G01490 [Arabidopsis thalian 0.673 0.372 0.323 0.00012
TAIR|locus:2091112 AT3G07600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 164 (62.8 bits), Expect = 3.1e-12, P = 3.1e-12
 Identities = 32/73 (43%), Positives = 53/73 (72%)

Query:    23 KVVIKLSLEGHKSRSKALKIAVRVSGVESVALKGDDRSQIEVTGDGMDPVLLTSLLRKTM 82
             K++I++++    +R+KA+K AV+  GV +V +KGD R+QIEVTG  +D + L + LRK +
Sbjct:     4 KILIRIAMTDDTTRAKAMKTAVQFKGVNAVEIKGDHRNQIEVTGVEVDMIALINTLRKKV 63

Query:    83 RFAELLTVINLKP 95
              FAEL++V  ++P
Sbjct:    64 AFAELVSVAKVEP 76




GO:0005634 "nucleus" evidence=ISM
GO:0030001 "metal ion transport" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA;ISS
TAIR|locus:2156253 AT5G48290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138376 AT4G05030 "AT4G05030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087580 AT3G20180 "AT3G20180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025421 AT1G01490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 98
KOG160373 consensus Copper chaperone [Inorganic ion transpor 99.74
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.24
COG260871 CopZ Copper chaperone [Inorganic ion transport and 98.51
KOG4656 247 consensus Copper chaperone for superoxide dismutas 98.15
PLN02957 238 copper, zinc superoxide dismutase 97.99
PRK10671 834 copA copper exporting ATPase; Provisional 97.68
TIGR0000368 copper ion binding protein. This model describes a 94.55
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 92.89
PRK10671 834 copA copper exporting ATPase; Provisional 91.95
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 89.74
PF0268095 DUF211: Uncharacterized ArCR, COG1888; InterPro: I 88.73
COG188897 Uncharacterized protein conserved in archaea [Func 84.79
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 80.75
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
Probab=99.74  E-value=1.8e-17  Score=105.67  Aligned_cols=68  Identities=31%  Similarity=0.412  Sum_probs=61.8

Q ss_pred             cceeEEEEEeecchhhHHHHHHHhcCCCceeEEEecCCCCCeEEEEecccCHHHHHHHHHhcCC-ceEEEE
Q 041984           20 LNGKVVIKLSLEGHKSRSKALKIAVRVSGVESVALKGDDRSQIEVTGDGMDPVLLTSLLRKTMR-FAELLT   89 (98)
Q Consensus        20 m~qkvVlKV~m~ce~C~~Kv~k~i~~~~GV~SV~id~~~k~kvtV~G~~vDp~~lv~kLrKk~~-~aeivs   89 (98)
                      ..+..+++|+|||+||++++.+.+..++||+++.+|.++ +++||.|+ +||..|+++|+|.++ ++++|.
T Consensus         3 ~~~~~v~kv~~~C~gc~~kV~~~l~~~~GV~~v~id~~~-~kvtV~g~-~~p~~vl~~l~k~~~k~~~~~~   71 (73)
T KOG1603|consen    3 PIKTVVLKVNMHCEGCARKVKRVLQKLKGVESVDIDIKK-QKVTVKGN-VDPVKLLKKLKKTGGKRAELWK   71 (73)
T ss_pred             CccEEEEEECcccccHHHHHHHHhhccCCeEEEEecCCC-CEEEEEEe-cCHHHHHHHHHhcCCCceEEec
Confidence            348899999999999999999999999999999999987 69999999 999999999999774 566653



>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF02680 DUF211: Uncharacterized ArCR, COG1888; InterPro: IPR003831 This entry describes proteins of unknown function Back     alignment and domain information
>COG1888 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.4
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.35
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 99.22
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.09
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 98.94
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 98.92
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 98.81
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 98.81
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 98.76
1qup_A 222 Superoxide dismutase 1 copper chaperone; two domai 98.75
2l3m_A71 Copper-ION-binding protein; structural genomics, c 98.69
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 98.62
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 98.57
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 98.57
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 98.56
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 98.55
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 98.52
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 98.51
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.49
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 98.46
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 98.45
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 98.43
1opz_A76 Potential copper-transporting ATPase; mutation, fo 98.41
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.41
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.4
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 98.4
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 98.39
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 98.37
1yg0_A66 COP associated protein; open-faced beta-sandwich, 98.36
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 98.33
2kyz_A67 Heavy metal binding protein; structural genomics, 98.31
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 98.22
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 98.22
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.21
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.18
2kkh_A95 Putative heavy metal transporter; zinc transport, 98.09
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.08
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 97.94
2rop_A 202 Copper-transporting ATPase 2; wilson protein, mobi 97.73
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 97.52
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 97.05
3bpd_A100 Uncharacterized protein; heptamer, Mg+2 ION, PSI-2 88.3
2x3d_A96 SSO6206; unknown function; 2.70A {Sulfolobus solfa 86.75
2raq_A97 Conserved protein MTH889; alpha-beta protein, stru 86.31
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
Probab=99.40  E-value=1.4e-12  Score=78.29  Aligned_cols=65  Identities=11%  Similarity=0.140  Sum_probs=60.1

Q ss_pred             eeEEEEEeecchhhHHHHHHHhcCCCceeEEEecCCCCCeEEEEecccCHHHHHHHHHhcCC-ceEEEEc
Q 041984           22 GKVVIKLSLEGHKSRSKALKIAVRVSGVESVALKGDDRSQIEVTGDGMDPVLLTSLLRKTMR-FAELLTV   90 (98)
Q Consensus        22 qkvVlKV~m~ce~C~~Kv~k~i~~~~GV~SV~id~~~k~kvtV~G~~vDp~~lv~kLrKk~~-~aeivsv   90 (98)
                      ++..|+|+|+|.+|..++.+++.+++|| ++.+|... ++++|.|+ +++..|.+.+++ .| .+++|++
T Consensus         2 ~~~~~~vgm~C~~C~~~i~~~l~~~~gV-~v~v~~~~-~~~~v~~~-~~~~~i~~~i~~-~Gy~~~~~~~   67 (68)
T 3iwl_A            2 PKHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPN-KKVCIESE-HSMDTLLATLKK-TGKTVSYLGL   67 (68)
T ss_dssp             CEEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTT-TEEEEEES-SCHHHHHHHHHT-TCSCEEEEEC
T ss_pred             ceEEEEECcCcHHHHHHHHHHHHcCCCe-EEEEEcCC-CEEEEEec-CCHHHHHHHHHH-cCCceEecCC
Confidence            5788899999999999999999999999 99999976 69999997 999999999998 66 8999886



>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1 Back     alignment and structure
>2x3d_A SSO6206; unknown function; 2.70A {Sulfolobus solfataricus} Back     alignment and structure
>2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.11A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: d.58.61.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.54
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.54
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.51
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.26
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.17
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.16
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.16
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.07
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.05
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.05
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 98.96
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 98.95
d1p6ta172 Potential copper-translocating P-type ATPase CopA 98.94
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 98.87
d3bpda191 Uncharacterized protein AF1549 {Archaeoglobus fulg 89.42
d2raqa193 Uncharacterized protein MTH889 {Methanobacterium t 88.88
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone for superoxide dismutase, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.54  E-value=1.4e-14  Score=89.76  Aligned_cols=64  Identities=13%  Similarity=0.163  Sum_probs=59.0

Q ss_pred             eeEEEEEeecchhhHHHHHHHhcCCCceeEEEecCCCCCeEEEEecccCHHHHHHHHHhcCC-ceEEE
Q 041984           22 GKVVIKLSLEGHKSRSKALKIAVRVSGVESVALKGDDRSQIEVTGDGMDPVLLTSLLRKTMR-FAELL   88 (98)
Q Consensus        22 qkvVlKV~m~ce~C~~Kv~k~i~~~~GV~SV~id~~~k~kvtV~G~~vDp~~lv~kLrKk~~-~aeiv   88 (98)
                      .++.|+|+|||++|.+++.+++.+++||+++.+|... ++++|.|+ +||..|+++|++ .| .|.|.
T Consensus         6 ~~~~f~V~M~C~~C~~~Iek~l~~~~gV~~v~vdl~~-~~v~V~~~-~~~~~i~~~I~~-~G~~A~l~   70 (72)
T d1qupa2           6 YEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQ-QIMSVESS-VAPSTIINTLRN-CGKDAIIR   70 (72)
T ss_dssp             EEEEEECCCCSTTHHHHHHHHHTTCTTEEEEEEETTT-TEEEEEES-SCHHHHHHHHHH-TTCCCEEE
T ss_pred             EEEEEEEccCCHHHHHHHHHHHhcCCCeeEEEEECCC-CEEEEEee-CCHHHHHHHHHH-hCCCEEEe
Confidence            5778999999999999999999999999999999977 69999998 999999999998 66 67764



>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bpda1 d.58.61.1 (A:1-91) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure