Citrus Sinensis ID: 041992

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470---
MELEEQMSNLYKPSLEEGEPQPRRNFNHNLEEVQLMCVDQCDGIQEMDDLQLVGAPEDPCIKDDDGAVRQDRGMVDVEVKLAETGTAMSRVKQKAGRRPPRGGKVKTTARQPPPGRRKTEEEDVCFICFDGGSLVLCDRKGCPKAYHPACIKREESFFRSKAKWNCGWHICSICEKASYYMCYTCTYSLCKGCTKGADYYSLRGNKGFCGICMRTIMLIENCAPGNQEKVVVDFDDKTSWEYLFKVYWIFLKEKLSLTLDELTGAKNPWKEPAITAPKGKSSCQVYNGDCSRGLSSENFCGDLDANHAKRRKTKKQAEFPNQLHSEITDNSGRVKGMPLIKGTSKVGKPYKIGDRTADVILEIRNLQKKEVVAIDAISNQEFSEDECSRLRQSIKCGFIKHLTVGEIQEKAMSLQALRVNDLLESEILRLNNLRDRASEKGHRKEYPLFLWNSTFYCYLIFPCLRDISALKCC
cHHHHccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccEEcccccccccccccEEEcccccccccccccccccEEEcccccccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHcccccccccHHHHHHHHccccc
cccccccHccccccccccccccccccccccccHcccccccccccEEccccHcccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccEEEEEccccEEEEEccccccccccHHHccccccccccccccEccccEccccccccHHHHccccHHHHHHHccccEEEEEcccccccHHHHHHHHHHHccccccccccEEccccccHHHHHHHHHHHHHHHHccccHHHHHHHHcHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccEEEcccEEEccEccccccccccccccEEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHcHHHHHHHHHEHEEEHHHHHHHHHHccc
MELEEQmsnlykpsleegepqprrnfnhnLEEVQLMCVDQCdgiqemddlqlvgapedpcikdddgavrqdrgmVDVEVKLAETGTAMSRVkqkagrrpprggkvkttarqpppgrrkteeedvcficfdggslvlcdrkgcpkayhpacikREESFFRSKakwncgwhicsicekasyymcytctyslckgctkgadyyslrgnkgfcgiCMRTIMLIencapgnqekvvvdfddktsWEYLFKVYWIFLKEKLSLTLDeltgaknpwkepaitapkgksscqvyngdcsrglssenfcgdldaNHAKRrktkkqaefpnqlhseitdnsgrvkgmplikgtskvgkpykigdrTADVILEIRNLQKKEVVAIDAisnqefseDECSRLRQSIKCGFIKHLTVGEIQEKAMSLQALRVNDLLESEILRLNNLRDrasekghrkeyplflwnstfycylifpclrdisalkcc
meleeqmsnlykpsleegepqpRRNFNHNLEEVQLMCVDQCDGIQEMDDLQLVGAPEDPCIKdddgavrqdrGMVDVEVKlaetgtamsrvkqkagrrpprggkvkttarqpppgrrkteeedvCFICFDGGSLVLCDRKGCPKAYHPACIKREESFFRSKAKWNCGWHICSICEKASYYMCYTCTYSLCKGCTKGADYYSLRGNKGFCGICMRTIMLIENCAPGNQEKVVVDFDDKTSWEYLFKVYWIFLKEKLSLTLDELTGaknpwkepaitapkgksscQVYNGDCSRGLSSENFCGDLDANHAKRRKtkkqaefpnqlhseitdnsgrvkgmplikgtskvgkpykigdRTADVILEIRNLQKKEVVAIDaisnqefsedeCSRLRQSIKCGFIKHLTVGEIQEKAMSLQALRVNDLLESEILRLNnlrdrasekghrkeyplflWNSTFYCYLIFPCLRDISALKCC
MELEEQMSNLYKPSLEEGEPQPRRNFNHNLEEVQLMCVDQCDGIQEMDDLQLVGAPEDPCIKDDDGAVRQDRGMVDVEVKLAETGTAMSRVKQKAGRRPPRGGKVKTTARQPPPGRRKTEEEDVCFICFDGGSLVLCDRKGCPKAYHPACIKREESFFRSKAKWNCGWHICSICEKASYYMCYTCTYSLCKGCTKGADYYSLRGNKGFCGICMRTIMLIENCAPGNQEKVVVDFDDKTSWEYLFKVYWIFLKEKLSLTLDELTGAKNPWKEPAITAPKGKSSCQVYNGDCSRGLSSENFCGDLDANHAKRRKTKKQAEFPNQLHSEITDNSGRVKGMPLIKGTSKVGKPYKIGDRTADVILEIRNLQKKEVVAIDAISNQEFSEDECSRLRQSIKCGFIKHLTVGEIQEKAMSLQALRVNDLLESEILRLNNLRDRASEKGHRKEYPLFLWNSTFYCYLIFPCLRDISALKCC
*****************************LEEVQLMCVDQCDGI******************************************************************************DVCFICFDGGSLVLCDRKGCPKAYHPACIKREESFFRSKAKWNCGWHICSICEKASYYMCYTCTYSLCKGCTKGADYYSLRGNKGFCGICMRTIMLIENCAPGNQEKVVVDFDDKTSWEYLFKVYWIFLKEKLSLTLDELTGAKNPW*************CQVYNGDC******************************************************KVGKPYKIGDRTADVILEIRNLQKKEVVAIDAISNQEFSEDECSRLRQSIKCGFIKHLTVGEIQEKAMSLQALRVNDLLESEILRLNNLR*******HRKEYPLFLWNSTFYCYLIFPCLRDISALK**
**************************************************************************************************************************DVCFICFDGGSLVLCDRKGCPKAYHPACIKREESFFRSKAKWNCGWHICSICEKASYYMCYTCTYSLCKGCTKGADYYSLRGNKGFCGICMRTIMLIEN************FDDKTSWEYLFKVYWIFLKEK**LT*DELTGAK********************************************************************************************VILEIRNLQKKEVV***AISNQEFSEDECSRLRQSIKCGFIKHLTVGEIQEKAMSLQALRVNDLLESEILRLNNL*********RKEYPLFLWNSTFYCYLIFPCLRDISALKCC
********NLYKPSLEEGEPQPRRNFNHNLEEVQLMCVDQCDGIQEMDDLQLVGAPEDPCIKDDDGAVRQDRGMVDVEVKLAETGTA**********************************EDVCFICFDGGSLVLCDRKGCPKAYHPACIKREESFFRSKAKWNCGWHICSICEKASYYMCYTCTYSLCKGCTKGADYYSLRGNKGFCGICMRTIMLIENCAPGNQEKVVVDFDDKTSWEYLFKVYWIFLKEKLSLTLDELTGAKNPWKEPAITAPKGKSSCQVYNGDCSRGLSSENFCGDLDANH***********FPNQLHSEITDNSGRVKGMPLIKGTSKVGKPYKIGDRTADVILEIRNLQKKEVVAIDAISNQEFSEDECSRLRQSIKCGFIKHLTVGEIQEKAMSLQALRVNDLLESEILRLNNLRDRASEKGHRKEYPLFLWNSTFYCYLIFPCLRDISALKCC
***************************HNLEEVQLMCVDQCDGIQEMDDLQLVGAPE**************************************************************EEEDVCFICFDGGSLVLCDRKGCPKAYHPACIKREESFFRSKAKWNCGWHICSICEKASYYMCYTCTYSLCKGCTKGADYYSLRGNKGFCGICMRTIMLIENCAPGNQEKVVVDFDDKTSWEYLFKVYWIFLKEKLSLTLDELTGAKNP******************************************************LHSEITDNSGRVKGMPLIKGTSKVGKPYKIGDRTADVILEIRNLQKKEVVAIDAISNQEFSEDECSRLRQSIKCGFIKHLTVGEIQEKAMSLQALRVNDLLESEILRLNNLRDRASEKGHRKEYPLFLWNSTFYCYLIFPCLRDISALKCC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELEEQMSNLYKPSLEEGEPQPRRNFNHNLEEVQLMCVDQCDGIQEMDDLQLVGAPEDPCIKDDDGAVRQDRGMVDVEVKLAETGTAMSRVKQKAGRRPPRGGKVKTTARQPPPGRRKTEEEDVCFICFDGGSLVLCDRKGCPKAYHPACIKREESFFRSKAKWNCGWHICSICEKASYYMCYTCTYSLCKGCTKGADYYSLRGNKGFCGICMRTIMLIENCAPGNQEKVVVDFDDKTSWEYLFKVYWIFLKEKLSLTLDELTGAKNPWKEPAITAPKGKSSCQVYNGDCSRGLSSENFCGDLDANHAKRRKTKKQAEFPNQLHSEITDNSGRVKGMPLIKGTSKVGKPYKIGDRTADVILEIRNLQKKEVVAIDAISNQEFSEDECSRLRQSIKCGFIKHLTVGEIQEKAMSLQALRVxxxxxxxxxxxxxxxxxxxxxGHRKEYPLFLWNSTFYCYLIFPCLRDISALKCC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query473 2.2.26 [Sep-21-2011]
Q9SD34 1292 Zinc finger CCCH domain-c no no 0.562 0.205 0.503 6e-73
Q9SIV5 1773 Zinc finger CCCH domain-c no no 0.391 0.104 0.532 2e-56
Q8BVE81365 Histone-lysine N-methyltr yes no 0.190 0.065 0.431 6e-15
Q9BZ951437 Histone-lysine N-methyltr yes no 0.236 0.077 0.376 5e-14
O960281365 Histone-lysine N-methyltr no no 0.190 0.065 0.421 5e-14
Q6P2L61439 Histone-lysine N-methyltr no no 0.154 0.050 0.460 7e-13
O88491 2588 Histone-lysine N-methyltr no no 0.181 0.033 0.389 9e-13
Q96L73 2696 Histone-lysine N-methyltr no no 0.177 0.031 0.413 1e-12
Q9FT92 553 Uncharacterized protein A no no 0.196 0.168 0.4 6e-09
>sp|Q9SD34|C3H44_ARATH Zinc finger CCCH domain-containing protein 44 OS=Arabidopsis thaliana GN=At3g51120 PE=2 SV=3 Back     alignment and function desciption
 Score =  275 bits (703), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 150/298 (50%), Positives = 179/298 (60%), Gaps = 32/298 (10%)

Query: 33  VQLMCVDQCDGIQEMDDLQLVGAPEDPCIKDDDGAVRQDRGMVDVEVKLAETGTAMSRVK 92
           + LM VDQC+ I  ++ +  +  P         GAV       + EVK+ +       +K
Sbjct: 29  IDLMRVDQCEEIG-VNQVPALSVPASTVA----GAVAVPMSN-EQEVKVIDEAAP---IK 79

Query: 93  QKAGRRPPRGGKVKTTARQPPPGRRKTEEED-------VCFICFDGGSLVLCDRKGCPKA 145
           +K GR PPR       A  P   R              VCFICFDGG LVLCDR+ CPKA
Sbjct: 80  RKRGR-PPRA-----QANTPLHIRPPPPPPKKEDKEEDVCFICFDGGDLVLCDRRNCPKA 133

Query: 146 YHPACIKREESFFRSKAKWNCGWHICSICEKASYYMCYTCTYSLCKGCTKGADYYSLRGN 205
           YHPACIKR+E+FFR+ AKWNCGWHIC  C+KAS YMCYTCT+S+CK C K ADY  +RGN
Sbjct: 134 YHPACIKRDEAFFRTTAKWNCGWHICGTCQKASSYMCYTCTFSVCKRCIKDADYVIVRGN 193

Query: 206 KGFCGICMRTIMLIENCAPGNQEKVVVDFDDKTSWEYLFKVYWIFLKEKLSLTLDELTGA 265
            G CG C++ IMLIEN A G+ E V VDFDDK SWEYLFKVYW+ LKE+LSLT+DELT A
Sbjct: 194 MGLCGTCIKPIMLIENIAQGDNEAVKVDFDDKLSWEYLFKVYWLCLKEELSLTVDELTRA 253

Query: 266 KNPWKEPAITAPKGKSSCQVYNGDCSRGLSSENFCGDLDANHAKRRKTKKQAEFPNQL 323
            NPWKE   TAPK +S     N          N   D+  N  KRR+T      PN+L
Sbjct: 254 NNPWKEVPNTAPKVESQNDHTN----------NRALDVAVNGTKRRRTSDSPTLPNKL 301

Arabidopsis thaliana (taxid: 3702)
>sp|Q9SIV5|C3H19_ARATH Zinc finger CCCH domain-containing protein 19 OS=Arabidopsis thaliana GN=NERD PE=1 SV=3 Back     alignment and function description
>sp|Q8BVE8|NSD2_MOUSE Histone-lysine N-methyltransferase NSD2 OS=Mus musculus GN=Whsc1 PE=1 SV=2 Back     alignment and function description
>sp|Q9BZ95|NSD3_HUMAN Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens GN=WHSC1L1 PE=1 SV=1 Back     alignment and function description
>sp|O96028|NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens GN=WHSC1 PE=1 SV=1 Back     alignment and function description
>sp|Q6P2L6|NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus GN=Whsc1l1 PE=1 SV=2 Back     alignment and function description
>sp|O88491|NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Mus musculus GN=Nsd1 PE=1 SV=1 Back     alignment and function description
>sp|Q96L73|NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Homo sapiens GN=NSD1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FT92|Y5843_ARATH Uncharacterized protein At5g08430 OS=Arabidopsis thaliana GN=At5g08430 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query473
255586318 1586 nuclear receptor binding set domain cont 0.697 0.208 0.561 1e-100
255581535 1058 set domain protein, putative [Ricinus co 0.655 0.293 0.520 3e-90
297735049 1362 unnamed protein product [Vitis vinifera] 0.684 0.237 0.531 1e-89
359476848 1643 PREDICTED: zinc finger CCCH domain-conta 0.684 0.197 0.531 1e-89
224097122 1256 predicted protein [Populus trichocarpa] 0.492 0.185 0.647 2e-85
356540797 1365 PREDICTED: zinc finger CCCH domain-conta 0.564 0.195 0.561 8e-85
224133770 825 predicted protein [Populus trichocarpa] 0.505 0.289 0.605 7e-84
356495372 1953 PREDICTED: zinc finger CCCH domain-conta 0.543 0.131 0.542 4e-82
357483665 1255 Zinc finger CCCH domain-containing prote 0.463 0.174 0.637 2e-80
297819812 1292 hypothetical protein ARALYDRAFT_906461 [ 0.583 0.213 0.516 5e-76
>gi|255586318|ref|XP_002533810.1| nuclear receptor binding set domain containing protein 1, nsd, putative [Ricinus communis] gi|223526264|gb|EEF28579.1| nuclear receptor binding set domain containing protein 1, nsd, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 196/349 (56%), Positives = 241/349 (69%), Gaps = 19/349 (5%)

Query: 11  YKPSLEEGEPQPRRNFNHNLEEVQLMCVDQCDGIQEMDDLQLVGAPEDPCIKDDDGAVRQ 70
           Y+P ++E E Q  R F +++++ +LM +DQC+ ++E+DD QLVG P  P +     A   
Sbjct: 19  YRPRIQENEQQ--RLFGNSIQDPELMTIDQCETMRELDDSQLVGPPPPPSLPPPAAAATA 76

Query: 71  DRGMVDVEVKLAETGTAMSRVKQKAGRRPPRGGKVKTTARQPPPGRRKT---EEEDVCFI 127
              MVDVEV+ A     +S VK+K GR PPR     T      P R+ T   +EEDVCFI
Sbjct: 77  IVNMVDVEVRSAVKAVDVSTVKRKRGR-PPRIQGKTTGPPSSQPKRKTTTTDDEEDVCFI 135

Query: 128 CFDGGSLVLCDRKGCPKAYHPACIKREESFFRSKAKWNCGWHICSICEKASYYMCYTCTY 187
           CFDGGSLVLCDR+GCPKAYHPACIKR+ESFFRSKAKWNCGWHICS C+KAS+YMCYTCTY
Sbjct: 136 CFDGGSLVLCDRRGCPKAYHPACIKRDESFFRSKAKWNCGWHICSNCQKASHYMCYTCTY 195

Query: 188 SLCKGCTKGADYYSLRGNKGFCGICMRTIMLIENCAPGNQEKVVVDFDDKTSWEYLFKVY 247
           SLCKGCTK ADY  +RGNKG CG CMRTIMLIEN   GN E V VDFDDKTSWEYLFK+Y
Sbjct: 196 SLCKGCTKDADYVCVRGNKGLCGTCMRTIMLIENVTVGNTEAVQVDFDDKTSWEYLFKIY 255

Query: 248 WIFLKEKLSLTLDELTGAKNPWKEP-------------AITAPKGKSSCQVYNGDCSRGL 294
           WIFLK KLSLT+DELT AKNPWK               +I APK   + ++ +G+  +  
Sbjct: 256 WIFLKGKLSLTVDELTKAKNPWKGDELPKAKNSWRGFGSIFAPKEVHTGELIHGNDEKSP 315

Query: 295 SSENFCGDLDANHAKRRKTKKQAEFPNQLHSEITDNSGRVKGMPLIKGT 343
             +N  G+++ANH+KRRKTK Q E  ++ +S + + S   K  PL +GT
Sbjct: 316 FLDNCYGNVEANHSKRRKTKDQPEDLSEQNSVVMEKSVVDKVTPLPEGT 364

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255581535|ref|XP_002531573.1| set domain protein, putative [Ricinus communis] gi|223528803|gb|EEF30809.1| set domain protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297735049|emb|CBI17411.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359476848|ref|XP_002267100.2| PREDICTED: zinc finger CCCH domain-containing protein 44-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224097122|ref|XP_002310841.1| predicted protein [Populus trichocarpa] gi|222853744|gb|EEE91291.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356540797|ref|XP_003538871.1| PREDICTED: zinc finger CCCH domain-containing protein 44-like [Glycine max] Back     alignment and taxonomy information
>gi|224133770|ref|XP_002327676.1| predicted protein [Populus trichocarpa] gi|222836761|gb|EEE75154.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356495372|ref|XP_003516552.1| PREDICTED: zinc finger CCCH domain-containing protein 44-like [Glycine max] Back     alignment and taxonomy information
>gi|357483665|ref|XP_003612119.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355513454|gb|AES95077.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297819812|ref|XP_002877789.1| hypothetical protein ARALYDRAFT_906461 [Arabidopsis lyrata subsp. lyrata] gi|297323627|gb|EFH54048.1| hypothetical protein ARALYDRAFT_906461 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query473
TAIR|locus:2080863 1292 AT3G51120 [Arabidopsis thalian 0.640 0.234 0.495 4.2e-103
TAIR|locus:2827287 1773 NERD "Needed for RDR2-independ 0.541 0.144 0.455 1.5e-92
TAIR|locus:2060949 824 AT2G18090 "AT2G18090" [Arabido 0.520 0.298 0.546 1.1e-78
UNIPROTKB|F1S8S01361 WHSC1 "Uncharacterized protein 0.260 0.090 0.398 3.5e-16
MGI|MGI:12765741365 Whsc1 "Wolf-Hirschhorn syndrom 0.260 0.090 0.390 3.5e-16
UNIPROTKB|J9NUG71359 WHSC1 "Uncharacterized protein 0.260 0.090 0.398 4.1e-16
UNIPROTKB|F1PK461362 WHSC1 "Uncharacterized protein 0.260 0.090 0.398 4.1e-16
RGD|13079551346 Whsc1 "Wolf-Hirschhorn syndrom 0.213 0.075 0.423 7.3e-16
RGD|15831541366 LOC686349 "similar to Wolf-Hir 0.213 0.073 0.423 7.4e-16
ZFIN|ZDB-GENE-030131-25811461 whsc1 "Wolf-Hirschhorn syndrom 0.209 0.067 0.431 2.2e-15
TAIR|locus:2080863 AT3G51120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 765 (274.4 bits), Expect = 4.2e-103, Sum P(2) = 4.2e-103
 Identities = 163/329 (49%), Positives = 201/329 (61%)

Query:     7 MSNLYKPSLEEGEPQPRR---NFNHNLEEVQLMCVDQCDGIQEMDDLQLVGAPEDPCIKD 63
             M N  K  L++G P+          ++  + LM VDQC+ I  ++ +  +  P       
Sbjct:     1 MENQQK-QLQQGVPELASLAGREESSVRGIDLMRVDQCEEIG-VNQVPALSVPASTVA-- 56

Query:    64 DDGAVRQDRGMVDVEVKLAETGTAMSRVKQKAGRRPPRG-GKVKTTARQPPPGRRKTE-E 121
               GAV       + EVK+ +       +K+K GR PPR         R PPP  +K + E
Sbjct:    57 --GAVAVPMSN-EQEVKVIDEAAP---IKRKRGR-PPRAQANTPLHIRPPPPPPKKEDKE 109

Query:   122 EDVCFICFDGGSLVLCDRKGCPKAYHPACIKREESFFRSKAKWNCGWHICSICEKASYYM 181
             EDVCFICFDGG LVLCDR+ CPKAYHPACIKR+E+FFR+ AKWNCGWHIC  C+KAS YM
Sbjct:   110 EDVCFICFDGGDLVLCDRRNCPKAYHPACIKRDEAFFRTTAKWNCGWHICGTCQKASSYM 169

Query:   182 CYTCTYSLCKGCTKGADYYSLRGNKGFCGICMRTIMLIENCAPGNQEKVVVDFDDKTSWE 241
             CYTCT+S+CK C K ADY  +RGN G CG C++ IMLIEN A G+ E V VDFDDK SWE
Sbjct:   170 CYTCTFSVCKRCIKDADYVIVRGNMGLCGTCIKPIMLIENIAQGDNEAVKVDFDDKLSWE 229

Query:   242 YLFKVYWIFLKEKLSLTLDELTGAKNPWKEPAITAPKGKSSCQVYNGDCSRGLSSENFCG 301
             YLFKVYW+ LKE+LSLT+DELT A NPWKE   TAPK +S     N   +R L       
Sbjct:   230 YLFKVYWLCLKEELSLTVDELTRANNPWKEVPNTAPKVESQNDHTN---NRAL------- 279

Query:   302 DLDANHAKRRKTKKQAEFPNQLHSEITDN 330
             D+  N  KRR+T      PN+L  +   N
Sbjct:   280 DVAVNGTKRRRTSDSPTLPNKLDGKNPSN 308
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0006352 "DNA-dependent transcription, initiation" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016570 "histone modification" evidence=IEA
GO:0007346 "regulation of mitotic cell cycle" evidence=RCA
TAIR|locus:2827287 NERD "Needed for RDR2-independent DNA methylation" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060949 AT2G18090 "AT2G18090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8S0 WHSC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1276574 Whsc1 "Wolf-Hirschhorn syndrome candidate 1 (human)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J9NUG7 WHSC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PK46 WHSC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1307955 Whsc1 "Wolf-Hirschhorn syndrome candidate 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1583154 LOC686349 "similar to Wolf-Hirschhorn syndrome candidate 1 protein isoform 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2581 whsc1 "Wolf-Hirschhorn syndrome candidate 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
smart00719109 smart00719, Plus3, Short conserved domain in trans 3e-15
pfam03126105 pfam03126, Plus-3, Plus-3 domain 2e-09
smart0024947 smart00249, PHD, PHD zinc finger 1e-04
>gnl|CDD|197843 smart00719, Plus3, Short conserved domain in transcriptional regulators Back     alignment and domain information 
 Score = 71.2 bits (175), Expect = 3e-15
 Identities = 24/56 (42%), Positives = 39/56 (69%)

Query: 340 IKGTSKVGKPYKIGDRTADVILEIRNLQKKEVVAIDAISNQEFSEDECSRLRQSIK 395
           + G  +  KPY +G +T +V+LE+ N   ++VV I+ ISNQ+F+E+E  R +Q+IK
Sbjct: 54  VTGVKEADKPYSLGGKTTNVLLEVLNGDSEKVVQINFISNQDFTEEEFQRWKQAIK 109

Plus3 domains occur in the Saccharomyces cerevisiae Rtf1p protein, which interacts with Spt6p, and in parsley CIP, which interacts with the bZIP protein CPRF1. Length = 109
>gnl|CDD|190531 pfam03126, Plus-3, Plus-3 domain Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 473
smart00719109 Plus3 Short conserved domain in transcriptional re 99.13
PF03126108 Plus-3: Plus-3 domain; InterPro: IPR004343 The yea 98.9
KOG1244336 consensus Predicted transcription factor Requiem/N 98.42
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 98.42
KOG1512381 consensus PHD Zn-finger protein [General function 98.42
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 98.39
KOG4299613 consensus PHD Zn-finger protein [General function 98.24
KOG4299613 consensus PHD Zn-finger protein [General function 98.2
KOG1973274 consensus Chromatin remodeling protein, contains P 98.16
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.15
KOG0383 696 consensus Predicted helicase [General function pre 98.01
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 97.89
KOG1081463 consensus Transcription factor NSD1 and related SE 97.67
KOG0383 696 consensus Predicted helicase [General function pre 97.63
KOG2402 525 consensus Paf1/RNA polymerase II complex, RTF1 com 97.55
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 97.4
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 97.39
KOG0956 900 consensus PHD finger protein AF10 [General functio 97.34
COG5296 521 Transcription factor involved in TATA site selecti 97.31
KOG1244336 consensus Predicted transcription factor Requiem/N 96.9
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 96.87
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 96.82
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.55
KOG0954 893 consensus PHD finger protein [General function pre 96.47
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 96.41
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 96.18
COG5141 669 PHD zinc finger-containing protein [General functi 96.01
KOG1512381 consensus PHD Zn-finger protein [General function 95.76
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 95.69
KOG0825 1134 consensus PHD Zn-finger protein [General function 95.22
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 94.84
KOG1946240 consensus RNA polymerase I transcription factor UA 94.71
PF1377190 zf-HC5HC2H: PHD-like zinc-binding domain 94.28
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 93.54
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 92.95
KOG0957707 consensus PHD finger protein [General function pre 92.58
KOG0957707 consensus PHD finger protein [General function pre 92.17
KOG1973274 consensus Chromatin remodeling protein, contains P 91.81
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 91.37
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 90.24
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 86.55
KOG3362156 consensus Predicted BBOX Zn-finger protein [Genera 85.49
COG5141 669 PHD zinc finger-containing protein [General functi 82.09
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 81.42
>smart00719 Plus3 Short conserved domain in transcriptional regulators Back     alignment and domain information 
Probab=99.13  E-value=7.7e-11  Score=102.66  Aligned_cols=59  Identities=41%  Similarity=0.717  Sum_probs=56.3

Q ss_pred             ceeeeeeeecCcccccCCcccceEEEeeCCCccceeeeecccCCCCCHHHHHHHHHHhh
Q 041992          337 MPLIKGTSKVGKPYKIGDRTADVILEIRNLQKKEVVAIDAISNQEFSEDECSRLRQSIK  395 (473)
Q Consensus       337 l~qV~G~~k~~e~yk~~~~~~~i~L~i~nl~k~~~i~i~~ls~~df~eeEC~~lrq~ik  395 (473)
                      |+||+|+.+..++|++++++|++.|.+.+-...++++|++|||++|||+||++++|.++
T Consensus        51 l~qI~gv~~~~k~Y~~~~~~t~~~L~v~~g~~~~~~~i~~iSn~~fte~E~~~w~~~~~  109 (109)
T smart00719       51 LVQVTGVKEADKPYELGGKTTNVLLEVLNGDSEKVVQINFISNQDFTEEEFQRWKQAIK  109 (109)
T ss_pred             EEEEeeEEecCcceecCCceeeEEEEEecCCceEEEEEEEecCCCCCHHHHHHHHHHhC
Confidence            99999999999999999999999999988777889999999999999999999999875

Plus3 domains occur in the Saccharomyces cerevisiae Rtf1p protein, which interacts with Spt6p, and in parsley CIP, which interacts with the bZIP protein CPRF1.
>PF03126 Plus-3: Plus-3 domain; InterPro: IPR004343 The yeast Paf1 complex consists of Pfa1, Rtf1, Cdc73, Ctr9, and Leo1 Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1081 consensus Transcription factor NSD1 and related SET domain proteins [Transcription] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG2402 consensus Paf1/RNA polymerase II complex, RTF1 component (involved in regulation of TATA box-binding protein) [Transcription] Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>COG5296 Transcription factor involved in TATA site selection and in elongation by RNA polymerase II [Transcription] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1946 consensus RNA polymerase I transcription factor UAF [Transcription] Back     alignment and domain information
>PF13771 zf-HC5HC2H: PHD-like zinc-binding domain Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>KOG3362 consensus Predicted BBOX Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
4gnd_A107 Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains 2e-13
2db9_A149 Solution Structure Of The Plus-3 Domain Of Human Ki 7e-04
2bze_A153 Nmr Structure Of Human Rtf1 Plus3 Domain Length = 1 7e-04
2l5u_A61 Structure Of The First Phd Finger (Phd1) From Chd4 8e-04
>pdb|4GND|A Chain A, Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains Length = 107 Back     alignment and structure 
Iteration: 1

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 49/94 (52%), Gaps = 11/94 (11%)
Query: 104 KVKTTARQPPPGRRKTEEEDVCFICFDGGSLVLCDRKGCPKAYHPACIKREESFFRSKAK 163
           K+KT  +Q          ED CF C DGG LV+CD+K CPKAYH  C+   +  +    K
Sbjct: 5   KIKTEPKQ--------MHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPY---GK 53
Query: 164 WNCGWHICSICEKASYYMCYTCTYSLCKGCTKGA 197
           W C WH C  C  A+   C  C +S CK   KGA
Sbjct: 54  WECPWHQCDECSSAAVSFCEFCPHSFCKDHEKGA 87
>pdb|2DB9|A Chain A, Solution Structure Of The Plus-3 Domain Of Human Kiaa0252 Protein Length = 149 Back     alignment and structure
>pdb|2BZE|A Chain A, Nmr Structure Of Human Rtf1 Plus3 Domain Length = 153 Back     alignment and structure
>pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
3u1u_A137 RNA polymerase-associated protein RTF1 homolog; pl 3e-18
2bze_A153 KIAA0252 protein; human RTF1 PLUS3 domain, transcr 3e-18
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 6e-08
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 7e-08
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 4e-07
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 5e-07
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 6e-07
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 9e-07
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 2e-06
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 5e-06
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 6e-06
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 9e-06
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 2e-05
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 5e-05
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 5e-05
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 4e-04
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 5e-04
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 5e-04
3kv5_D488 JMJC domain-containing histone demethylation prote 6e-04
>3u1u_A RNA polymerase-associated protein RTF1 homolog; plus-3, transcription elongation, structural genomics, struc genomics consortium, SGC; 1.80A {Homo sapiens} PDB: 2db9_A Length = 137 Back     alignment and structure
 Score = 80.0 bits (197), Expect = 3e-18
 Identities = 20/76 (26%), Positives = 44/76 (57%)

Query: 340 IKGTSKVGKPYKIGDRTADVILEIRNLQKKEVVAIDAISNQEFSEDECSRLRQSIKCGFI 399
           I G  +  K Y++G    +  L++R+   + V  ++ +SNQEF+E E  + ++++    +
Sbjct: 60  ITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGM 119

Query: 400 KHLTVGEIQEKAMSLQ 415
           +  T+ EI +K +S++
Sbjct: 120 QLPTLDEINKKELSIK 135
>2bze_A KIAA0252 protein; human RTF1 PLUS3 domain, transcription, elongation, PAF1 complex, histone H3 methylation, H2B ubiquitination, CDC73, LEO1, CTR9; NMR {Homo sapiens} SCOP: b.34.21.1 Length = 153 Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query473
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.8
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.73
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.61
2bze_A153 KIAA0252 protein; human RTF1 PLUS3 domain, transcr 99.6
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.59
3u1u_A137 RNA polymerase-associated protein RTF1 homolog; pl 99.54
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.24
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.2
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.16
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.14
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.14
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.13
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.12
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.06
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.03
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.92
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.91
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.88
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.83
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.8
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.8
2yt5_A66 Metal-response element-binding transcription facto 98.8
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.72
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.72
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.68
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.62
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.59
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.57
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.52
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.44
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.43
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.43
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.41
1weu_A91 Inhibitor of growth family, member 4; structural g 98.4
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.4
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.39
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.39
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 98.37
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 98.34
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 98.33
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 98.33
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.28
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 98.26
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 98.13
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.11
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.08
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.05
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.04
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.02
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.01
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.01
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.0
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.0
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 97.83
1x4i_A70 Inhibitor of growth protein 3; structural genomics 97.75
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 97.75
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 97.69
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 97.65
1we9_A64 PHD finger family protein; structural genomics, PH 97.63
1wil_A89 KIAA1045 protein; ring finger domain, structural g 97.57
2yt5_A66 Metal-response element-binding transcription facto 97.57
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 97.43
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 97.38
1wew_A78 DNA-binding family protein; structural genomics, P 97.28
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 97.21
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 97.07
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 97.01
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 96.99
3o70_A68 PHD finger protein 13; PHF13, structural genomics 96.96
1wee_A72 PHD finger family protein; structural genomics, PH 96.91
1wem_A76 Death associated transcription factor 1; structura 96.87
2k16_A75 Transcription initiation factor TFIID subunit 3; p 96.83
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 96.54
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 96.54
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 96.44
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 96.4
3kv5_D488 JMJC domain-containing histone demethylation prote 96.31
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 96.29
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 96.24
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 96.22
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 96.16
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 96.04
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 96.04
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 95.99
1weu_A91 Inhibitor of growth family, member 4; structural g 95.93
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 95.86
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 95.56
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 95.35
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 94.92
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 94.83
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 94.55
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 94.17
1wil_A89 KIAA1045 protein; ring finger domain, structural g 94.05
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 93.66
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 91.5
1we9_A64 PHD finger family protein; structural genomics, PH 91.48
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 90.98
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 89.63
1x4i_A70 Inhibitor of growth protein 3; structural genomics 89.37
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 89.26
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 87.89
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 87.71
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 87.44
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 86.09
3o70_A68 PHD finger protein 13; PHF13, structural genomics 85.68
1wee_A72 PHD finger family protein; structural genomics, PH 85.19
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 82.99
2lq6_A87 Bromodomain-containing protein 1; PHD finger, meta 81.98
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 80.85
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
Probab=99.80  E-value=4.1e-20  Score=159.89  Aligned_cols=91  Identities=42%  Similarity=0.890  Sum_probs=80.2

Q ss_pred             CCccccccccccccccCceeecCCCCCCCcccccccCcccccCCCCCceeecCcccccccCCceeeccCCCccccccccC
Q 041992          116 RRKTEEEDVCFICFDGGSLVLCDRKGCPKAYHPACIKREESFFRSKAKWNCGWHICSICEKASYYMCYTCTYSLCKGCTK  195 (473)
Q Consensus       116 ~~~~~ned~CfVC~dGGeLv~CD~~gCPraYH~~CL~p~~~~~~p~g~W~CP~H~C~vC~k~sl~~C~~Cp~AyH~~CL~  195 (473)
                      ..+..++++|++|++||+||+||+++||++||+.||++..   .|.|.|+||+|.|.+|++.+.++|..||+|||..|+.
T Consensus         9 ~~~~~~~~~C~~C~~~G~ll~CD~~~Cp~~fH~~Cl~L~~---~P~g~W~Cp~c~C~~C~k~~~~~C~~Cp~sfC~~c~~   85 (107)
T 4gne_A            9 EPKQMHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQ---PPYGKWECPWHQCDECSSAAVSFCEFCPHSFCKDHEK   85 (107)
T ss_dssp             -CCCSSCSSCTTTCCCSEEEECCSTTCCCEECTGGGTCSS---CCSSCCCCGGGBCTTTCSBCCEECSSSSCEECTTTCT
T ss_pred             CCcCCCCCCCCcCCCCCcEeEECCCCCCcccccccCcCCc---CCCCCEECCCCCCCcCCCCCCcCcCCCCcchhhhccC
Confidence            3456899999999999999999977899999999999553   5899999999999999999999999999999999998


Q ss_pred             CCccccccCCeeecC
Q 041992          196 GADYYSLRGNKGFCG  210 (473)
Q Consensus       196 ~~~~~sv~~~kwfC~  210 (473)
                      ++. ...+.+.|+|.
T Consensus        86 g~l-~~~~~~~~~c~   99 (107)
T 4gne_A           86 GAL-VPSALEGRLCC   99 (107)
T ss_dssp             TSC-EECTTTTCEEC
T ss_pred             Ccc-eecCCCCceec
Confidence            654 44567889984
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2bze_A KIAA0252 protein; human RTF1 PLUS3 domain, transcription, elongation, PAF1 complex, histone H3 methylation, H2B ubiquitination, CDC73, LEO1, CTR9; NMR {Homo sapiens} SCOP: b.34.21.1 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3u1u_A RNA polymerase-associated protein RTF1 homolog; plus-3, transcription elongation, structural genomics, struc genomics consortium, SGC; 1.80A {Homo sapiens} PDB: 2db9_A Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 473
d2bzea1132 b.34.21.1 (A:345-476) RNA polymerase-associated pr 3e-19
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 2e-07
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 9e-06
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 9e-04
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 0.002
>d2bzea1 b.34.21.1 (A:345-476) RNA polymerase-associated protein RTF1 homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 132 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Plus3-like
family: Plus3
domain: RNA polymerase-associated protein RTF1 homolog
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 81.4 bits (201), Expect = 3e-19
 Identities = 20/79 (25%), Positives = 44/79 (55%)

Query: 339 LIKGTSKVGKPYKIGDRTADVILEIRNLQKKEVVAIDAISNQEFSEDECSRLRQSIKCGF 398
            I G  +  K Y++G    +  L++R+   + V  ++ +SNQEF+E E  + ++++    
Sbjct: 52  EITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAG 111

Query: 399 IKHLTVGEIQEKAMSLQAL 417
           ++  T+ EI +K +S++  
Sbjct: 112 MQLPTLDEINKKELSIKEA 130
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query473
d2bzea1132 RNA polymerase-associated protein RTF1 homolog {Hu 99.59
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.18
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.9
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.47
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.06
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.03
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 97.87
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 97.8
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 97.76
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 97.73
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 97.64
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 97.39
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 97.37
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.02
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 96.72
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 96.5
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 95.82
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 94.85
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 93.82
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 93.0
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 92.61
d1wema_76 Death associated transcription factor 1, Datf1 (DI 92.52
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 88.66
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 86.1
>d2bzea1 b.34.21.1 (A:345-476) RNA polymerase-associated protein RTF1 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Plus3-like
family: Plus3
domain: RNA polymerase-associated protein RTF1 homolog
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.59  E-value=7.1e-16  Score=134.74  Aligned_cols=82  Identities=24%  Similarity=0.409  Sum_probs=79.0

Q ss_pred             ceeeeeeeecCcccccCCcccceEEEeeCCCccceeeeecccCCCCCHHHHHHHHHHhhhcccccchHHHHHHHHHHHHH
Q 041992          337 MPLIKGTSKVGKPYKIGDRTADVILEIRNLQKKEVVAIDAISNQEFSEDECSRLRQSIKCGFIKHLTVGEIQEKAMSLQA  416 (473)
Q Consensus       337 l~qV~G~~k~~e~yk~~~~~~~i~L~i~nl~k~~~i~i~~ls~~df~eeEC~~lrq~ik~gl~kr~tv~~~eeka~~l~~  416 (473)
                      |+||+|+.+..++|++++++|++.|.+.......+++|++|||++|||+||++++|.++++.+++||+.+|++|++.||+
T Consensus        50 l~~I~gv~~~~k~Y~~~~~~T~~~L~l~~g~~~~~~~l~~vSn~~fte~E~~~w~~~~~~~~~~~Pt~~~l~~K~~~i~~  129 (132)
T d2bzea1          50 VAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKE  129 (132)
T ss_dssp             EEEEEEEEEEEEEEEETTEEEEEEEEEESSSCEEEECGGGBCCSCCCHHHHHHHHHHHHHHTCCCCBHHHHHHHHHHHHH
T ss_pred             EEEEEeeeecCcccccCCCcccEEEEEEECCceeEEEeEEEeCCCCCHHHHHHHHHHHHHcCCCCCCHHHHHHHHHHHHH
Confidence            99999999999999999999999999998887889999999999999999999999999999999999999999999998


Q ss_pred             HH
Q 041992          417 LR  418 (473)
Q Consensus       417 ~~  418 (473)
                      .+
T Consensus       130 a~  131 (132)
T d2bzea1         130 AL  131 (132)
T ss_dssp             HC
T ss_pred             Hh
Confidence            64
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure