Citrus Sinensis ID: 042035

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MGSNGAVTELQRNSTNWTNVVDEIVKMEKKIFPKHEPLARSFDEELKKKNSGLLYIQIHGQVVGYVMYAWPTSLSASITKLAVKENYRGQGHGEALLEAAIKKCRTRTVLRITLHVDPFRTPAVNLYKKFGFQVDALIQGYYSADRPAYRMYMDFDSN
ccccccccEEEEccccccccHHHHHHHHHHHcccccccHHHHHHHHHcccccEEEEEEccEEEEEEEEEEccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHcccEEccEEcccccccccEEEEEEEcccc
cccccEEEEEEEcccccHHcHHHHHHHHHHHccccccHHHHHHHHHHccccEEEEEEEccEEEEEEEEEEEEcccccEEEEEEcHHHccccHHHHHHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHcccccccEEcccccccccEEEEEEEcccc
MGSNGAVTELQRNSTNWTNVVDEIVKMEKkifpkheplarSFDEELKKKNSGLLYIQIHGQVVGYVMYAWPTSLSASITKLAVKenyrgqghGEALLEAAIKKCRTRTVLRItlhvdpfrtpavnlykkFGFQVDALIQGYysadrpayrmymdfdsn
mgsngavtelqrnstnwtnVVDEIVKMEKKIFPKHEPLARSFDEELKKKNSGLLYIQIHGQVVGYVMYAWPTSLSASITKLAVKENYRGQGHGEALLEAAIKKCRTRTVLRitlhvdpfrtpaVNLYKKFGFQVDALIQGYYSADRPAYRMYMDFDSN
MGSNGAVTELQRNSTNWTNVVDEIVKMEKKIFPKHEPLARSFDEELKKKNSGLLYIQIHGQVVGYVMYAWPTSLSASITKLAVKENYRGQGHGEALLEAAIKKCRTRTVLRITLHVDPFRTPAVNLYKKFGFQVDALIQGYYSADRPAYRMYMDFDSN
***************NWTNVVDEIVKMEKKIFP***************KNSGLLYIQIHGQVVGYVMYAWPTSLSASITKLAVKENYRGQGHGEALLEAAIKKCRTRTVLRITLHVDPFRTPAVNLYKKFGFQVDALIQGYYSADRPAYRMYM*****
*****AV*ELQRNSTNWTNVVDEIVKMEKKIFPKHEPLARSFDEELKKKNSGLLYIQIHGQVVGYVMYAWPTSLSASITKLAVKENYRGQGHGEALLEAAIKKCRTRTVLRITLHVDPFRTPAVNLYKKFGFQVDALIQGYYSADRPAYRMYMDFD**
**********QRNSTNWTNVVDEIVKMEKKIFPKHEPLARSFDEELKKKNSGLLYIQIHGQVVGYVMYAWPTSLSASITKLAVKENYRGQGHGEALLEAAIKKCRTRTVLRITLHVDPFRTPAVNLYKKFGFQVDALIQGYYSADRPAYRMYMDFDSN
***NGAVTELQRNSTNWTNVVDEIVKMEKKIFPKHEPLARSFDEELKKKNSGLLYIQIHGQVVGYVMYAWPTSLSASITKLAVKENYRGQGHGEALLEAAIKKCRTRTVLRITLHVDPFRTPAVNLYKKFGFQVDALIQGYYSADRPAYRMYMDFD**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSNGAVTELQRNSTNWTNVVDEIVKMEKKIFPKHEPLARSFDEELKKKNSGLLYIQIHGQVVGYVMYAWPTSLSASITKLAVKENYRGQGHGEALLEAAIKKCRTRTVLRITLHVDPFRTPAVNLYKKFGFQVDALIQGYYSADRPAYRMYMDFDSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query158 2.2.26 [Sep-21-2011]
Q976C3167 Uncharacterized N-acetylt yes no 0.822 0.778 0.328 1e-11
O05517151 Putative ribosomal-protei yes no 0.772 0.807 0.317 2e-11
Q4JBG0168 Uncharacterized N-acetylt yes no 0.822 0.773 0.307 4e-09
Q980R9167 Uncharacterized N-acetylt yes no 0.822 0.778 0.293 1e-07
Q6B949182 Uncharacterized N-acetylt N/A no 0.449 0.390 0.337 1e-05
Q58604226 Uncharacterized N-acetylt yes no 0.607 0.424 0.264 2e-05
Q5KQI6254 Probable acetyltransferas no no 0.455 0.283 0.333 0.0001
A2Y5T7254 Probable acetyltransferas N/A no 0.455 0.283 0.333 0.0001
P13018174 Streptothricin acetyltran yes no 0.392 0.356 0.370 0.0004
Q8NMJ7292 Mycothiol acetyltransfera yes no 0.544 0.294 0.279 0.0004
>sp|Q976C3|Y258_SULTO Uncharacterized N-acetyltransferase STK_02580 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_02580 PE=3 SV=1 Back     alignment and function desciption
 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 74/143 (51%), Gaps = 13/143 (9%)

Query: 21  VDEIVKMEKKIFPKHEPLARSFDEELKKKNSGLLYIQIHGQVVGYVM--YAW-------- 70
           VD+I+K+ +   P++ P    F E LK+  +     ++ G+VVGY+M    W        
Sbjct: 22  VDQIIKINRLALPENYPY-YFFVEHLKEYEAAFFVAEVDGEVVGYIMPRIEWGFSNLKQL 80

Query: 71  PTSLS-ASITKLAVKENYRGQGHGEALLEAAIKKCR-TRTVLRITLHVDPFRTPAVNLYK 128
           PT +    +  +AV E YR  G G ALL+A++K  +       + L V    +PA+NLYK
Sbjct: 81  PTLVKKGHVVSIAVLEQYRRLGIGTALLQASMKAMKEVYNAEEVYLEVRVSNSPAINLYK 140

Query: 129 KFGFQVDALIQGYYSADRPAYRM 151
           K GF+   +++ YY+    AY M
Sbjct: 141 KLGFKEVKVLRHYYADGEDAYLM 163

Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (taxid: 273063)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: -
>sp|O05517|RIMI_BACSU Putative ribosomal-protein-alanine acetyltransferase OS=Bacillus subtilis (strain 168) GN=rimI PE=3 SV=1 Back     alignment and function description
>sp|Q4JBG0|Y459_SULAC Uncharacterized N-acetyltransferase Saci_0459 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0459 PE=3 SV=1 Back     alignment and function description
>sp|Q980R9|Y209_SULSO Uncharacterized N-acetyltransferase SSO0209 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0209 PE=1 SV=2 Back     alignment and function description
>sp|Q6B949|YCF52_GRATL Uncharacterized N-acetyltransferase ycf52 OS=Gracilaria tenuistipitata var. liui GN=ycf52 PE=3 SV=1 Back     alignment and function description
>sp|Q58604|Y1207_METJA Uncharacterized N-acetyltransferase MJ1207 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1207 PE=3 SV=1 Back     alignment and function description
>sp|Q5KQI6|NSI_ORYSJ Probable acetyltransferase NSI OS=Oryza sativa subsp. japonica GN=NSI PE=2 SV=1 Back     alignment and function description
>sp|A2Y5T7|NSI_ORYSI Probable acetyltransferase NSI OS=Oryza sativa subsp. indica GN=NSI PE=3 SV=2 Back     alignment and function description
>sp|P13018|STA_ECOLX Streptothricin acetyltransferase OS=Escherichia coli GN=sat-1 PE=4 SV=1 Back     alignment and function description
>sp|Q8NMJ7|MSHD_CORGL Mycothiol acetyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=mshD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
147856839158 hypothetical protein VITISV_004799 [Viti 0.987 0.987 0.745 2e-65
225446926158 PREDICTED: uncharacterized N-acetyltrans 0.974 0.974 0.754 5e-65
224124540153 predicted protein [Populus trichocarpa] 0.968 1.0 0.727 3e-63
255553793156 ribosomal-protein-alanine acetyltransfer 0.987 1.0 0.737 4e-63
449444352154 PREDICTED: uncharacterized N-acetyltrans 0.968 0.993 0.692 4e-61
15218861158 Acyl-CoA N-acyltransferases -like protei 0.974 0.974 0.701 8e-61
449525682154 PREDICTED: uncharacterized N-acetyltrans 0.968 0.993 0.692 1e-60
297848582158 hypothetical protein ARALYDRAFT_311459 [ 0.981 0.981 0.690 3e-60
356542932154 PREDICTED: putative ribosomal-protein-al 0.949 0.974 0.705 2e-59
358345131154 N-acetyltransferase, putative [Medicago 0.968 0.993 0.685 4e-58
>gi|147856839|emb|CAN83475.1| hypothetical protein VITISV_004799 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 117/157 (74%), Positives = 137/157 (87%), Gaps = 1/157 (0%)

Query: 3   SNGAVTELQRNSTNWTNVVDEIVKMEKKIFPKHEPLARSFDEELKKKNSGLLYIQI-HGQ 61
           SN  V EL RNSTNW  VV++IV++EKKIFPKHE LARSFDEEL+K NSGLLYIQ+  G+
Sbjct: 2   SNCVVLELHRNSTNWAKVVEDIVRLEKKIFPKHESLARSFDEELRKNNSGLLYIQLADGE 61

Query: 62  VVGYVMYAWPTSLSASITKLAVKENYRGQGHGEALLEAAIKKCRTRTVLRITLHVDPFRT 121
           V GYVMY+WP+SL ASITKLAVKENYR QGHGEALLEAAI+KC+TR + RI+LHVDP RT
Sbjct: 62  VAGYVMYSWPSSLLASITKLAVKENYRRQGHGEALLEAAIQKCKTRNICRISLHVDPSRT 121

Query: 122 PAVNLYKKFGFQVDALIQGYYSADRPAYRMYMDFDSN 158
           PA++LYKK GFQVD LI+ YYS+DR AYRMY+DFD++
Sbjct: 122 PAMSLYKKHGFQVDNLIKSYYSSDRDAYRMYLDFDAD 158

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225446926|ref|XP_002267085.1| PREDICTED: uncharacterized N-acetyltransferase ST0258 [Vitis vinifera] gi|297739114|emb|CBI28765.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224124540|ref|XP_002319357.1| predicted protein [Populus trichocarpa] gi|222857733|gb|EEE95280.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255553793|ref|XP_002517937.1| ribosomal-protein-alanine acetyltransferase, putative [Ricinus communis] gi|223542919|gb|EEF44455.1| ribosomal-protein-alanine acetyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449444352|ref|XP_004139939.1| PREDICTED: uncharacterized N-acetyltransferase STK_02580-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15218861|ref|NP_171861.1| Acyl-CoA N-acyltransferases -like protein [Arabidopsis thaliana] gi|26452515|dbj|BAC43342.1| unknown protein [Arabidopsis thaliana] gi|28827284|gb|AAO50486.1| unknown protein [Arabidopsis thaliana] gi|332189472|gb|AEE27593.1| Acyl-CoA N-acyltransferases -like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449525682|ref|XP_004169845.1| PREDICTED: uncharacterized N-acetyltransferase STK_02580-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297848582|ref|XP_002892172.1| hypothetical protein ARALYDRAFT_311459 [Arabidopsis lyrata subsp. lyrata] gi|297338014|gb|EFH68431.1| hypothetical protein ARALYDRAFT_311459 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356542932|ref|XP_003539918.1| PREDICTED: putative ribosomal-protein-alanine acetyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|358345131|ref|XP_003636636.1| N-acetyltransferase, putative [Medicago truncatula] gi|355502571|gb|AES83774.1| N-acetyltransferase, putative [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
TAIR|locus:2020718158 AT1G03650 [Arabidopsis thalian 0.974 0.974 0.701 4.2e-56
ASPGD|ASPL0000054803161 ngn19 [Emericella nidulans (ta 0.879 0.863 0.308 3.5e-11
TIGR_CMR|BA_0260145 BA_0260 "ribosomal-protein-ala 0.759 0.827 0.312 4.7e-09
TIGR_CMR|CHY_0724144 CHY_0724 "ribosomal-protein-al 0.759 0.833 0.338 4.7e-09
TIGR_CMR|DET_0608213 DET_0608 "ribosomal-protein-al 0.917 0.680 0.253 5.4e-08
UNIPROTKB|Q722S6147 LMOf2365_0653 "Acetyltransfera 0.746 0.802 0.317 6.8e-08
TIGR_CMR|GSU_1757160 GSU_1757 "ribosomal-protein-al 0.829 0.818 0.3 1.4e-07
TAIR|locus:2147997164 AT5G11340 [Arabidopsis thalian 0.411 0.396 0.4 1.8e-07
DICTYBASE|DDB_G0295721169 naa50 "N(alpha)-acetyltransfer 0.462 0.431 0.364 3.8e-07
UNIPROTKB|Q8EKA3147 SO_0192 "Acteyltransferase GNA 0.575 0.619 0.357 3.8e-07
TAIR|locus:2020718 AT1G03650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 578 (208.5 bits), Expect = 4.2e-56, P = 4.2e-56
 Identities = 108/154 (70%), Positives = 126/154 (81%)

Query:     5 GAVTELQRNSTNWTNVVDEIVKMEKKIFPKHEPLARSFDEELKKKNSGLLYIQIHGQVVG 64
             G V EL R ST+W  VV++IVK+EKK FPKHE LA++FD EL+KKN+GLLY+   G  VG
Sbjct:     4 GVVVELIRGSTSWAKVVEDIVKLEKKTFPKHESLAQTFDAELRKKNAGLLYVDAEGDTVG 63

Query:    65 YVMYAWPTSLSASITKLAVKENYRGQGHGEALLEAAIKKCRTRTVLRITLHVDPFRTPAV 124
             Y MY+WP+SLSASITKLAVKEN R QGHGEALL AAI KCR+R V R++LHVDP RT AV
Sbjct:    64 YAMYSWPSSLSASITKLAVKENCRRQGHGEALLRAAIDKCRSRKVQRVSLHVDPTRTSAV 123

Query:   125 NLYKKFGFQVDALIQGYYSADRPAYRMYMDFDSN 158
             NLYKK GFQVD L++ YYSADR AYRMY+DFD +
Sbjct:   124 NLYKKLGFQVDCLVKSYYSADRDAYRMYLDFDDS 157
GO:0005737 "cytoplasm" evidence=ISM
GO:0008080 "N-acetyltransferase activity" evidence=IEA;ISS
GO:0008152 "metabolic process" evidence=ISS
ASPGD|ASPL0000054803 ngn19 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0260 BA_0260 "ribosomal-protein-alanine acetyltransferase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0724 CHY_0724 "ribosomal-protein-alanine acetyltransferase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0608 DET_0608 "ribosomal-protein-alanine acetyltransferase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
UNIPROTKB|Q722S6 LMOf2365_0653 "Acetyltransferase, GNAT family" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1757 GSU_1757 "ribosomal-protein-alanine acetyltransferase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TAIR|locus:2147997 AT5G11340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0295721 naa50 "N(alpha)-acetyltransferase 50, NatE catalytic subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q8EKA3 SO_0192 "Acteyltransferase GNAT family" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
TIGR01575131 TIGR01575, rimI, ribosomal-protein-alanine acetylt 2e-22
pfam0058380 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT 4e-18
COG0456177 COG0456, RimI, Acetyltransferases [General functio 4e-14
cd0430165 cd04301, NAT_SF, N-Acyltransferase superfamily: Va 5e-11
pfam1350879 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT 8e-11
PRK03624140 PRK03624, PRK03624, putative acetyltransferase; Pr 2e-07
PRK10975194 PRK10975, PRK10975, TDP-fucosamine acetyltransfera 2e-07
COG2153155 COG2153, ElaA, Predicted acyltransferase [General 2e-06
pfam13523152 pfam13523, Acetyltransf_8, Acetyltransferase (GNAT 6e-06
COG1246153 COG1246, ArgA, N-acetylglutamate synthase and rela 1e-05
PRK09491146 PRK09491, rimI, ribosomal-protein-alanine N-acetyl 2e-05
pfam13673118 pfam13673, Acetyltransf_10, Acetyltransferase (GNA 2e-05
PRK07757152 PRK07757, PRK07757, acetyltransferase; Provisional 5e-05
COG3153171 COG3153, COG3153, Predicted acetyltransferase [Gen 3e-04
COG1670187 COG1670, RimL, Acetyltransferases, including N-ace 4e-04
pfam0844586 pfam08445, FR47, FR47-like protein 4e-04
TIGR03448292 TIGR03448, mycothiol_MshD, mycothiol synthase 5e-04
COG0454156 COG0454, WecD, Histone acetyltransferase HPA2 and 7e-04
pfam13527127 pfam13527, Acetyltransf_9, Acetyltransferase (GNAT 8e-04
TIGR03448 292 TIGR03448, mycothiol_MshD, mycothiol synthase 0.001
PLN02825515 PLN02825, PLN02825, amino-acid N-acetyltransferase 0.003
>gnl|CDD|233477 TIGR01575, rimI, ribosomal-protein-alanine acetyltransferase Back     alignment and domain information 
 Score = 85.8 bits (213), Expect = 2e-22
 Identities = 43/124 (34%), Positives = 57/124 (45%), Gaps = 2/124 (1%)

Query: 21  VDEIVKMEKKIFPKHEPLARSFDEELKKKNSGLLYIQIHGQVVGYVMYAWPTSLSASITK 80
           +  ++++E   F      A  F EEL   +   L  +I G+VVGY          A I  
Sbjct: 2   LKAVLEIEAAAFAFPWTEA-QFAEELANYHLCYLLARIGGKVVGYAGV-QIVLDEAHILN 59

Query: 81  LAVKENYRGQGHGEALLEAAIKKCRTRTVLRITLHVDPFRTPAVNLYKKFGFQVDALIQG 140
           +AVK  Y+GQG G ALL   I + + R V  I L V      A  LYKK GF   A+ + 
Sbjct: 60  IAVKPEYQGQGIGRALLRELIDEAKGRGVNEIFLEVRVSNIAAQALYKKLGFNEIAIRRN 119

Query: 141 YYSA 144
           YY  
Sbjct: 120 YYPD 123

Members of this model belong to the GCN5-related N-acetyltransferase (GNAT) superfamily. This model covers prokarotes and the archaea. The seed contains a characterized accession for Gram negative E. coli. An untraceable characterized accession (PIR|S66013) for Gram positive B. subtilis scores well (205.0) in the full alignment. Characterized members are lacking in the archaea. Noise cutoff (72.4) was set to exclude M. loti paralog of rimI. Trusted cutoff (80.0) was set at next highest scoring member in the mini-database [Protein synthesis, Ribosomal proteins: synthesis and modification]. Length = 131
>gnl|CDD|216007 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family Back     alignment and domain information
>gnl|CDD|223532 COG0456, RimI, Acetyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>gnl|CDD|222185 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain Back     alignment and domain information
>gnl|CDD|235142 PRK03624, PRK03624, putative acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|182877 PRK10975, PRK10975, TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225064 COG2153, ElaA, Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|222196 pfam13523, Acetyltransf_8, Acetyltransferase (GNAT) domain Back     alignment and domain information
>gnl|CDD|224167 COG1246, ArgA, N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181904 PRK09491, rimI, ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|222309 pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain Back     alignment and domain information
>gnl|CDD|236088 PRK07757, PRK07757, acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225695 COG3153, COG3153, Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224584 COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|117022 pfam08445, FR47, FR47-like protein Back     alignment and domain information
>gnl|CDD|132489 TIGR03448, mycothiol_MshD, mycothiol synthase Back     alignment and domain information
>gnl|CDD|223530 COG0454, WecD, Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>gnl|CDD|222199 pfam13527, Acetyltransf_9, Acetyltransferase (GNAT) domain Back     alignment and domain information
>gnl|CDD|132489 TIGR03448, mycothiol_MshD, mycothiol synthase Back     alignment and domain information
>gnl|CDD|215441 PLN02825, PLN02825, amino-acid N-acetyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 158
KOG3139165 consensus N-acetyltransferase [General function pr 99.94
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 99.92
PRK09491146 rimI ribosomal-protein-alanine N-acetyltransferase 99.91
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 99.91
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 99.9
PRK10140162 putative acetyltransferase YhhY; Provisional 99.9
PTZ00330147 acetyltransferase; Provisional 99.89
PRK03624140 putative acetyltransferase; Provisional 99.89
COG0456177 RimI Acetyltransferases [General function predicti 99.89
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 99.89
KOG3216163 consensus Diamine acetyltransferase [Amino acid tr 99.88
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 99.88
TIGR02406157 ectoine_EctA L-2,4-diaminobutyric acid acetyltrans 99.87
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 99.87
PF13523152 Acetyltransf_8: Acetyltransferase (GNAT) domain; P 99.87
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 99.85
COG1247169 Sortase and related acyltransferases [Cell envelop 99.85
PRK10151179 ribosomal-protein-L7/L12-serine acetyltransferase; 99.85
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 99.85
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 99.84
PRK07922169 N-acetylglutamate synthase; Validated 99.84
KOG3235193 consensus Subunit of the major N alpha-acetyltrans 99.84
PRK15130186 spermidine N1-acetyltransferase; Provisional 99.84
PRK10314153 putative acyltransferase; Provisional 99.83
PHA00673154 acetyltransferase domain containing protein 99.83
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 99.83
PRK10809194 ribosomal-protein-S5-alanine N-acetyltransferase; 99.83
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 99.83
PRK07757152 acetyltransferase; Provisional 99.82
TIGR03585156 PseH pseudaminic acid biosynthesis N-acetyl transf 99.81
PRK10514145 putative acetyltransferase; Provisional 99.8
PHA01807153 hypothetical protein 99.8
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 99.79
PLN02825515 amino-acid N-acetyltransferase 99.79
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 99.79
PRK10562145 putative acetyltransferase; Provisional 99.79
PRK05279441 N-acetylglutamate synthase; Validated 99.78
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 99.78
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 99.78
COG1246153 ArgA N-acetylglutamate synthase and related acetyl 99.77
PRK09831147 putative acyltransferase; Provisional 99.77
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 99.77
COG3153171 Predicted acetyltransferase [General function pred 99.76
PRK01346 411 hypothetical protein; Provisional 99.76
TIGR03448 292 mycothiol_MshD mycothiol biosynthesis acetyltransf 99.76
KOG3396150 consensus Glucosamine-phosphate N-acetyltransferas 99.74
KOG3138187 consensus Predicted N-acetyltransferase [General f 99.74
KOG3234173 consensus Acetyltransferase, (GNAT) family [Genera 99.73
PF13302142 Acetyltransf_3: Acetyltransferase (GNAT) domain; P 99.72
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 99.67
PRK13688156 hypothetical protein; Provisional 99.66
KOG2488202 consensus Acetyltransferase (GNAT) domain-containi 99.65
cd02169 297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 99.62
COG3393268 Predicted acetyltransferase [General function pred 99.6
TIGR00124 332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 99.57
COG2153155 ElaA Predicted acyltransferase [General function p 99.53
COG1670187 RimL Acetyltransferases, including N-acetylases of 99.53
COG3981174 Predicted acetyltransferase [General function pred 99.51
PF12746265 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S 99.5
KOG3397225 consensus Acetyltransferases [General function pre 99.5
PF13718196 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z 99.43
TIGR01211522 ELP3 histone acetyltransferase, ELP3 family. The S 99.41
cd0430165 NAT_SF N-Acyltransferase superfamily: Various enzy 99.3
KOG4144190 consensus Arylalkylamine N-acetyltransferase [Gene 99.23
PF12568128 DUF3749: Acetyltransferase (GNAT) domain; InterPro 99.22
PF0844489 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt 99.22
PF1454278 Acetyltransf_CG: GCN5-related N-acetyl-transferase 99.15
COG3818167 Predicted acetyltransferase, GNAT superfamily [Gen 99.11
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 99.04
COG238899 Predicted acetyltransferase [General function pred 99.0
KOG4135185 consensus Predicted phosphoglucosamine acetyltrans 99.0
COG5628143 Predicted acetyltransferase [General function pred 98.9
COG4552 389 Eis Predicted acetyltransferase involved in intrac 98.86
COG3375 266 Uncharacterized conserved protein [Function unknow 98.85
PF00765182 Autoind_synth: Autoinducer synthetase; InterPro: I 98.69
PRK13834207 putative autoinducer synthesis protein; Provisiona 98.56
COG3053 352 CitC Citrate lyase synthetase [Energy production a 98.45
COG3916209 LasI N-acyl-L-homoserine lactone synthetase [Signa 98.4
COG0454156 WecD Histone acetyltransferase HPA2 and related ac 98.39
PF13480142 Acetyltransf_6: Acetyltransferase (GNAT) domain 98.35
COG3882574 FkbH Predicted enzyme involved in methoxymalonyl-A 98.32
TIGR03694241 exosort_acyl putative PEP-CTERM/exosortase system- 98.31
PF06852181 DUF1248: Protein of unknown function (DUF1248); In 98.28
PF04958 342 AstA: Arginine N-succinyltransferase beta subunit; 98.21
PF01233162 NMT: Myristoyl-CoA:protein N-myristoyltransferase, 98.21
PRK10456 344 arginine succinyltransferase; Provisional 97.93
cd0426499 DUF619-NAGS DUF619 domain of various N-acetylgluta 97.87
PF11039151 DUF2824: Protein of unknown function (DUF2824); In 97.86
PRK14852 989 hypothetical protein; Provisional 97.85
PF04377128 ATE_C: Arginine-tRNA-protein transferase, C termin 97.82
TIGR03245 336 arg_AOST_alph arginine/ornithine succinyltransfera 97.78
TIGR03244 336 arg_catab_AstA arginine N-succinyltransferase. In 97.75
PF1388070 Acetyltransf_13: ESCO1/2 acetyl-transferase 97.74
TIGR03243 335 arg_catab_AOST arginine and ornithine succinyltran 97.72
PF05301120 Mec-17: Touch receptor neuron protein Mec-17; Inte 97.69
COG1243515 ELP3 Histone acetyltransferase [Transcription / Ch 97.67
cd0426599 DUF619-NAGS-U DUF619 domain of various N-acetylglu 97.64
TIGR03827 266 GNAT_ablB putative beta-lysine N-acetyltransferase 97.63
PRK01305240 arginyl-tRNA-protein transferase; Provisional 97.54
TIGR03019330 pepcterm_femAB FemAB-related protein, PEP-CTERM sy 97.54
PHA01733153 hypothetical protein 97.43
PHA00432137 internal virion protein A 97.41
PF01853188 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i 97.37
KOG2535554 consensus RNA polymerase II elongator complex, sub 97.09
PLN03238290 probable histone acetyltransferase MYST; Provision 96.97
KOG2036 1011 consensus Predicted P-loop ATPase fused to an acet 96.94
PF09924299 DUF2156: Uncharacterized conserved protein (DUF215 96.84
PF13444101 Acetyltransf_5: Acetyltransferase (GNAT) domain 96.66
PLN03239351 histone acetyltransferase; Provisional 96.56
KOG2779 421 consensus N-myristoyl transferase [Lipid transport 96.54
PTZ00064552 histone acetyltransferase; Provisional 96.53
COG3138 336 AstA Arginine/ornithine N-succinyltransferase beta 96.23
PLN00104450 MYST -like histone acetyltransferase; Provisional 96.16
cd04266108 DUF619-NAGS-FABP DUF619 domain of N-acetylglutamat 95.98
KOG4601264 consensus Uncharacterized conserved protein [Funct 95.93
PF09390161 DUF1999: Protein of unknown function (DUF1999); In 95.61
PF04768170 DUF619: Protein of unknown function (DUF619); Inte 95.5
PF02474196 NodA: Nodulation protein A (NodA); InterPro: IPR00 95.32
KOG2747396 consensus Histone acetyltransferase (MYST family) 95.2
COG2401 593 ABC-type ATPase fused to a predicted acetyltransfe 95.17
PF02388 406 FemAB: FemAB family; InterPro: IPR003447 The femAB 94.98
KOG3014257 consensus Protein involved in establishing cohesio 94.76
KOG2696 403 consensus Histone acetyltransferase type b catalyt 94.41
COG2935253 Putative arginyl-tRNA:protein arginylyltransferase 94.3
COG5092 451 NMT1 N-myristoyl transferase [Lipid metabolism] 94.23
cd0317398 DUF619-like DUF619 domain of various N-acetylgluta 93.81
PF12261179 T_hemolysin: Thermostable hemolysin; InterPro: IPR 93.54
PRK02983 1094 lysS lysyl-tRNA synthetase; Provisional 93.33
COG5027395 SAS2 Histone acetyltransferase (MYST family) [Chro 93.32
PF11124304 Pho86: Inorganic phosphate transporter Pho86; Inte 92.47
PF04339370 DUF482: Protein of unknown function, DUF482; Inter 92.37
PF1109086 DUF2833: Protein of unknown function (DUF2833); In 91.88
KOG4387191 consensus Ornithine decarboxylase antizyme [Amino 91.63
PRK04531398 acetylglutamate kinase; Provisional 91.39
KOG2779421 consensus N-myristoyl transferase [Lipid transport 91.03
PHA02769154 hypothetical protein; Provisional 89.1
COG2348 418 Peptidoglycan interpeptide bridge formation enzyme 88.28
PRK00756196 acyltransferase NodA; Provisional 87.95
COG2898538 Uncharacterized conserved protein [Function unknow 87.62
KOG3698891 consensus Hyaluronoglucosaminidase [Posttranslatio 86.13
COG5630495 ARG2 Acetylglutamate synthase [Amino acid transpor 83.84
PF02799190 NMT_C: Myristoyl-CoA:protein N-myristoyltransferas 81.93
PF02100108 ODC_AZ: Ornithine decarboxylase antizyme; InterPro 80.27
>KOG3139 consensus N-acetyltransferase [General function prediction only] Back     alignment and domain information 
Probab=99.94  E-value=1.6e-24  Score=129.45  Aligned_cols=134  Identities=25%  Similarity=0.342  Sum_probs=110.3

Q ss_pred             hHHHHHHHHhhhcCCChhhHHHHHHHHh-cCCceEEEEEECCe-EEEEEEEeecCC---CeEEEEEEEeccCccCCcHHH
Q 042035           20 VVDEIVKMEKKIFPKHEPLARSFDEELK-KKNSGLLYIQIHGQ-VVGYVMYAWPTS---LSASITKLAVKENYRGQGHGE   94 (158)
Q Consensus        20 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~-~vG~~~~~~~~~---~~~~i~~~~v~~~~r~~Gig~   94 (158)
                      .+..+.++....++.+....  ....+. +.+..++++.+++. .||.+.+..+..   ..++|..++|+++|||+|||+
T Consensus        26 ~l~~im~Li~k~lsepyS~~--tyrYf~~~wp~~~~~a~d~~~~~VGai~ck~~~~r~~~rgyi~mLaV~~e~Rg~GIg~  103 (165)
T KOG3139|consen   26 YLADIMRLIDKDLSEPYSIY--TYRYFVPNWPCFCFLALDEKGDTVGAIVCKLDTHRNTLRGYIAMLAVDSEYRGQGIGK  103 (165)
T ss_pred             HHHHHHHHHhhhcCchhHHH--HHHhcccCCceEEEEEEcCCCceEEEEEEeccccCCcceEEEEEEEechhhccccHHH
Confidence            45567777777777655422  222222 33556677776444 799999985443   359999999999999999999


Q ss_pred             HHHHHHHHHHHhCCccEEEEEEcCCChhhHHHHHhCCCEEeeeeccccccCCcceEEEeec
Q 042035           95 ALLEAAIKKCRTRTVLRITLHVDPFRTPAVNLYKKFGFQVDALIQGYYSADRPAYRMYMDF  155 (158)
Q Consensus        95 ~l~~~~~~~~~~~g~~~i~~~~~~~n~~~~~~y~~~Gf~~~~~~~~~~~~~~~~~~m~~~l  155 (158)
                      +|++.+++.++.+|++.|.++|...|.+|.++|+++||...++...||.++.+++.|++.+
T Consensus       104 aLvr~aId~m~~~g~~eVvLeTe~~n~~A~~LY~sLGF~r~~r~~~YYlng~dA~rl~L~~  164 (165)
T KOG3139|consen  104 ALVRKAIDAMRSRGYSEVVLETEVTNLSALRLYESLGFKRDKRLFRYYLNGMDALRLKLFF  164 (165)
T ss_pred             HHHHHHHHHHHHCCCcEEEEeccccchHHHHHHHhcCceEecceeEEEECCcceEEEEeec
Confidence            9999999999999999999999999999999999999999999999999999999998875

>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK15130 spermidine N1-acetyltransferase; Provisional Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information
>PHA00673 acetyltransferase domain containing protein Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PRK10562 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>COG3153 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK01346 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] Back     alignment and domain information
>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>COG3393 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>COG2153 ElaA Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3981 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B Back     alignment and domain information
>KOG3397 consensus Acetyltransferases [General function prediction only] Back     alignment and domain information
>PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>KOG4144 consensus Arylalkylamine N-acetyltransferase [General function prediction only] Back     alignment and domain information
>PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length Back     alignment and domain information
>PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 Back     alignment and domain information
>PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A Back     alignment and domain information
>COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>COG2388 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG4135 consensus Predicted phosphoglucosamine acetyltransferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5628 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] Back     alignment and domain information
>COG3375 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth Back     alignment and domain information
>PRK13834 putative autoinducer synthesis protein; Provisional Back     alignment and domain information
>COG3053 CitC Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>COG3916 LasI N-acyl-L-homoserine lactone synthetase [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase Back     alignment and domain information
>PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans Back     alignment and domain information
>PF04958 AstA: Arginine N-succinyltransferase beta subunit; InterPro: IPR007041 Arginine N-succinyltransferase catalyses the transfer of succinyl-CoA to arginine to produce succinylarginine Back     alignment and domain information
>PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 Back     alignment and domain information
>PRK10456 arginine succinyltransferase; Provisional Back     alignment and domain information
>cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish Back     alignment and domain information
>PF11039 DUF2824: Protein of unknown function (DUF2824); InterPro: IPR022568 This family of proteins has no known function Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PF04377 ATE_C: Arginine-tRNA-protein transferase, C terminus; InterPro: IPR007472 Arginine-tRNA-protein transferase catalyses the post-translational conjugation of arginine to the N terminus of a protein Back     alignment and domain information
>TIGR03245 arg_AOST_alph arginine/ornithine succinyltransferase, alpha subunit Back     alignment and domain information
>TIGR03244 arg_catab_AstA arginine N-succinyltransferase Back     alignment and domain information
>PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase Back     alignment and domain information
>TIGR03243 arg_catab_AOST arginine and ornithine succinyltransferase subunits Back     alignment and domain information
>PF05301 Mec-17: Touch receptor neuron protein Mec-17; InterPro: IPR007965 Mec-17 is the protein product of one of the 18 genes required for the development and function of the touch receptor neuron for gentle touch Back     alignment and domain information
>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>cd04265 DUF619-NAGS-U DUF619 domain of various N-acetylglutamate Synthases (NAGS) of the urea (U) cycle of humans and fish Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>PRK01305 arginyl-tRNA-protein transferase; Provisional Back     alignment and domain information
>TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated Back     alignment and domain information
>PHA01733 hypothetical protein Back     alignment and domain information
>PHA00432 internal virion protein A Back     alignment and domain information
>PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus Back     alignment and domain information
>KOG2535 consensus RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PLN03238 probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PF09924 DUF2156: Uncharacterized conserved protein (DUF2156); InterPro: IPR024320 This domain of unknown function is found in uncharacterised proteins and in Lysylphosphatidylglycerol synthetase, which catalyses the transfer of a lysyl group from L-lysyl-tRNA(Lys) to membrane-bound phosphatidylglycerol [] Back     alignment and domain information
>PF13444 Acetyltransf_5: Acetyltransferase (GNAT) domain Back     alignment and domain information
>PLN03239 histone acetyltransferase; Provisional Back     alignment and domain information
>KOG2779 consensus N-myristoyl transferase [Lipid transport and metabolism] Back     alignment and domain information
>PTZ00064 histone acetyltransferase; Provisional Back     alignment and domain information
>COG3138 AstA Arginine/ornithine N-succinyltransferase beta subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>cd04266 DUF619-NAGS-FABP DUF619 domain of N-acetylglutamate Synthase of the fungal arginine-biosynthetic pathway Back     alignment and domain information
>KOG4601 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09390 DUF1999: Protein of unknown function (DUF1999); InterPro: IPR018987 This family contains a putative Fe-S binding reductase (Q72J89 from SWISSPROT) whose structure adopts an alpha and beta fold Back     alignment and domain information
>PF04768 DUF619: Protein of unknown function (DUF619); InterPro: IPR006855 This region of unknown function is found at the C terminus of Neurospora crassa acetylglutamate synthase (2 Back     alignment and domain information
>PF02474 NodA: Nodulation protein A (NodA); InterPro: IPR003484 Rhizobial nodulation (Nod) factors are signalling molecules secreted by root-nodulating rhizobia in response to flavanoids excreted by the host plant Back     alignment and domain information
>KOG2747 consensus Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>PF02388 FemAB: FemAB family; InterPro: IPR003447 The femAB operon codes for two nearly identical approximately 50kDa proteins involved in the formation of the Staphylococcal pentaglycine interpeptide bridge in peptidoglycan [] Back     alignment and domain information
>KOG3014 consensus Protein involved in establishing cohesion between sister chromatids during DNA replication [Replication, recombination and repair] Back     alignment and domain information
>KOG2696 consensus Histone acetyltransferase type b catalytic subunit [Chromatin structure and dynamics] Back     alignment and domain information
>COG2935 Putative arginyl-tRNA:protein arginylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5092 NMT1 N-myristoyl transferase [Lipid metabolism] Back     alignment and domain information
>cd03173 DUF619-like DUF619 domain of various N-acetylglutamate Kinases and N-acetylglutamate Synthases Back     alignment and domain information
>PF12261 T_hemolysin: Thermostable hemolysin; InterPro: IPR022050 This family of proteins is found in bacteria Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>PF11124 Pho86: Inorganic phosphate transporter Pho86; InterPro: IPR024297 Pho86p is an ER protein which is produced in response to phosphate starvation Back     alignment and domain information
>PF04339 DUF482: Protein of unknown function, DUF482; InterPro: IPR007434 This family contains several proteins of uncharacterised function Back     alignment and domain information
>PF11090 DUF2833: Protein of unknown function (DUF2833); InterPro: IPR020335 This entry contains proteins with no known function Back     alignment and domain information
>KOG4387 consensus Ornithine decarboxylase antizyme [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04531 acetylglutamate kinase; Provisional Back     alignment and domain information
>KOG2779 consensus N-myristoyl transferase [Lipid transport and metabolism] Back     alignment and domain information
>PHA02769 hypothetical protein; Provisional Back     alignment and domain information
>COG2348 Peptidoglycan interpeptide bridge formation enzyme [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK00756 acyltransferase NodA; Provisional Back     alignment and domain information
>COG2898 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3698 consensus Hyaluronoglucosaminidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5630 ARG2 Acetylglutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02799 NMT_C: Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain; InterPro: IPR022677 Myristoyl-CoA:protein N-myristoyltransferase (2 Back     alignment and domain information
>PF02100 ODC_AZ: Ornithine decarboxylase antizyme; InterPro: IPR002993 Ornithine decarboxylase antizyme (ODC-AZ) [] binds to, and destabilises, ornithine decarboxylase (ODC), a key enzyme in polyamine synthesis Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
2x7b_A168 Crystal Structure Of The N-Terminal Acetylase Ard1 9e-09
2ae6_A166 Crystal Structure Of Acetyltransferase Of Gnat Fami 8e-05
3ld2_A197 The Crystal Structure Of Smu.2055 From Streptococcu 1e-04
2cnm_A160 Rimi - Ribosomal S18 N-Alpha-Protein Acetyltransfer 5e-04
3pp9_A187 1.6 Angstrom Resolution Crystal Structure Of Putati 9e-04
>pdb|2X7B|A Chain A, Crystal Structure Of The N-Terminal Acetylase Ard1 From Sulfolobus Solfataricus P2 Length = 168 Back     alignment and structure 
Iteration: 1

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 65/143 (45%), Gaps = 13/143 (9%)
Query: 21  VDEIVKMEKKIFPKHEPLARSFDEELKKKNSGLLYIQIHGQVVGYVM--YAWPTS----- 73
           +D+I+K+ +   P++ P    F E LK+         +   VVGY+M    W  S     
Sbjct: 23  IDQIIKINRLTLPENYPYY-FFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQL 81
Query: 74  ----LSASITKLAVKENYRGQGHGEALLEAAIKKCRTR-TVLRITLHVDPFRTPAVNLYK 128
                   +  +AV E YR +G    LLEA++K  +       I L V     PA+ LY+
Sbjct: 82  PSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYE 141
Query: 129 KFGFQVDALIQGYYSADRPAYRM 151
           K  F+   +++GYY+    AY M
Sbjct: 142 KLNFKKVKVLKGYYADGEDAYLM 164
>pdb|2AE6|A Chain A, Crystal Structure Of Acetyltransferase Of Gnat Family From Enterococcus Faecalis V583 Length = 166 Back     alignment and structure
>pdb|3LD2|A Chain A, The Crystal Structure Of Smu.2055 From Streptococcus Mutans Ua159 Length = 197 Back     alignment and structure
>pdb|2CNM|A Chain A, Rimi - Ribosomal S18 N-Alpha-Protein Acetyltransferase In Complex With A Bisubstrate Inhibitor (Cterm-Arg-Arg-Phe- Tyr-Arg-Ala-N-Alpha-Acetyl-S-Coa). Length = 160 Back     alignment and structure
>pdb|3PP9|A Chain A, 1.6 Angstrom Resolution Crystal Structure Of Putative Streptothricin Acetyltransferase From Bacillus Anthracis Str. Ames In Complex With Acetyl Coenzyme A Length = 187 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 7e-30
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 1e-25
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 4e-25
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 7e-24
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 7e-24
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 3e-23
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 5e-23
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 6e-23
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 7e-23
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 9e-23
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 5e-22
2aj6_A159 Hypothetical protein MW0638; structural genomics, 6e-22
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 6e-22
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 1e-21
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 1e-21
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 1e-21
3kkw_A182 Putative uncharacterized protein; acetyltransferas 3e-21
2i6c_A160 Putative acetyltransferase; GNAT family, structura 4e-21
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 4e-21
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 6e-21
1vkc_A158 Putative acetyl transferase; structural genomics, 1e-20
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 2e-20
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 4e-20
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A 1e-19
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 4e-19
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 6e-19
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 7e-19
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 2e-18
1wwz_A159 Hypothetical protein PH1933; structural genomics, 2e-18
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 5e-18
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 5e-18
2fl4_A149 Spermine/spermidine acetyltransferase; structural 6e-18
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 8e-18
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 1e-17
1tiq_A180 Protease synthase and sporulation negative regulat 3e-17
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 1e-16
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 2e-16
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 4e-16
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 4e-16
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 5e-16
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 6e-16
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 7e-16
3mgd_A157 Predicted acetyltransferase; structural genomics, 1e-15
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 2e-15
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 2e-15
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 2e-15
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 2e-15
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structura 2e-15
2eui_A153 Probable acetyltransferase; dimer, structural geno 3e-15
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 4e-15
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 6e-15
1y7r_A133 Hypothetical protein SA2161; structural genomics, 2e-14
3frm_A254 Uncharacterized conserved protein; APC61048, staph 3e-14
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 5e-14
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 6e-14
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 8e-14
3efa_A147 Putative acetyltransferase; structural genom 2, pr 1e-13
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 1e-13
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 2e-13
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 3e-13
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 3e-13
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 4e-13
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 7e-13
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 8e-13
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 1e-12
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 2e-12
3owc_A188 Probable acetyltransferase; structural genomics, P 2e-12
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 3e-12
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 3e-12
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 4e-12
1p0h_A 318 Hypothetical protein RV0819; GNAT fold, acetyltran 4e-07
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 8e-12
2fe7_A166 Probable N-acetyltransferase; structural genomics, 1e-11
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 1e-11
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 1e-11
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 3e-11
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 3e-11
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 3e-11
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 3e-11
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 1e-10
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 1e-10
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 1e-10
2gan_A190 182AA long hypothetical protein; alpha-beta protei 2e-10
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 2e-10
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 2e-10
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 3e-10
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 3e-10
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 3e-10
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 5e-10
3sxn_A 422 Enhanced intracellular surviVal protein; GNAT fold 1e-09
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 1e-09
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, ace 1e-09
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 2e-09
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 2e-09
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 3e-09
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 3e-09
2hv2_A 400 Hypothetical protein; PSI, protein structure initi 6e-09
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, a 1e-08
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic 1e-08
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 3e-07
3r1k_A 428 Enhanced intracellular surviVal protein; GNAT, ace 9e-08
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 2e-07
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 3e-07
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 4e-07
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 4e-07
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 4e-07
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 5e-07
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 5e-07
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 6e-07
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 8e-07
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 9e-07
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 9e-07
2i00_A 406 Acetyltransferase, GNAT family; structural genomic 1e-06
1xeb_A150 Hypothetical protein PA0115; midwest center for st 1e-06
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 1e-06
2qml_A198 BH2621 protein; structural genomics, joint center 1e-06
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 1e-06
1z4r_A168 General control of amino acid synthesis protein 5- 2e-06
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 3e-06
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 6e-06
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 6e-06
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 8e-06
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 2e-05
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 4e-05
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 5e-05
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 1e-04
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransfera 2e-04
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 2e-04
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 3e-04
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 5e-04
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Length = 187 Back     alignment and structure
 Score =  106 bits (266), Expect = 7e-30
 Identities = 33/154 (21%), Positives = 64/154 (41%), Gaps = 6/154 (3%)

Query: 9   ELQRNSTNWTNVVDEIVKMEKKIFPKHEPLARSFDEELKKKNSGLLYIQIHGQVVGYVMY 68
            L + +      V+++   EK  + +++     ++E + K N  +    +H Q++G+++ 
Sbjct: 35  SLSKVNRRIEYTVEDVPSYEKS-YLQNDNEELVYNEYINKPNQIIYIALLHNQIIGFIVL 93

Query: 69  AWPTSLSASITKLAVKENYRGQGHGEALLEAAIKKCRTRTVLRITLHVDPFRTPAVNLYK 128
               +  A I  + V + YR  G G+ L+  A +  +   +  I L        A   Y+
Sbjct: 94  KKNWNNYAYIEDITVDKKYRTLGVGKRLIAQAKQWAKEGNMPGIMLETQNNNVAACKFYE 153

Query: 129 KFGFQVDALIQGYYS-----ADRPAYRMYMDFDS 157
           K GF +       Y      +D  A   Y+ FDS
Sbjct: 154 KCGFVIGGFDFLVYKGLNMTSDEVAIYWYLHFDS 187
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Length = 157 Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Length = 170 Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Length = 160 Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Length = 143 Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Length = 144 Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Length = 168 Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Length = 168 Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Length = 158 Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Length = 181 Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 180 Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Length = 159 Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Length = 176 Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Length = 177 Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Length = 153 Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Length = 165 Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Length = 182 Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Length = 160 Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 157 Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 163 Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Length = 158 Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Length = 166 Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Length = 166 Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Length = 266 Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Length = 228 Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Length = 150 Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Length = 150 Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 166 Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 159 Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Length = 172 Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Length = 157 Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 149 Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Length = 197 Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Length = 170 Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Length = 180 Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Length = 164 Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Length = 235 Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Length = 177 Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Length = 207 Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Length = 166 Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Length = 145 Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Length = 180 Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Length = 157 Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 199 Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Length = 172 Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Length = 138 Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Length = 160 Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Length = 288 Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Length = 153 Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Length = 163 Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Length = 160 Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Length = 133 Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Length = 254 Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Length = 169 Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Length = 181 Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153 Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Length = 147 Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Length = 177 Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Length = 149 Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Length = 183 Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Length = 189 Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Length = 312 Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Length = 142 Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Length = 190 Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Length = 140 Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Length = 146 Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Length = 188 Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Length = 184 Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Length = 152 Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Length = 318 Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Length = 318 Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 162 Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Length = 166 Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Length = 160 Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Length = 330 Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Length = 150 Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Length = 152 Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Length = 165 Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Length = 140 Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} Length = 163 Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Length = 171 Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Length = 147 Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 190 Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Length = 174 Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Length = 162 Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Length = 161 Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Length = 170 Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Length = 183 Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 159 Back     alignment and structure
>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Length = 422 Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Length = 150 Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Length = 396 Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Length = 182 Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Length = 172 Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Length = 179 Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Length = 224 Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Length = 400 Back     alignment and structure
>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Length = 249 Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Length = 339 Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Length = 339 Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} Length = 428 Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Length = 388 Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Length = 181 Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Length = 175 Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Length = 201 Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Length = 202 Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} PDB: 3dr8_A* Length = 174 Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Length = 204 Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Length = 276 Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Length = 188 Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Length = 164 Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Length = 175 Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Length = 406 Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Length = 150 Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Length = 197 Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Length = 198 Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Length = 172 Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Length = 168 Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Length = 182 Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Length = 170 Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} Length = 176 Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Length = 222 Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Length = 160 Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} Length = 215 Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Length = 456 Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Length = 211 Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Length = 210 Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Length = 217 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Length = 238 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 99.97
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 99.96
1tiq_A180 Protease synthase and sporulation negative regulat 99.96
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 99.96
3kkw_A182 Putative uncharacterized protein; acetyltransferas 99.95
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 99.95
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 99.95
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 99.95
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 99.95
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 99.95
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 99.95
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 99.95
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 99.95
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 99.95
2i6c_A160 Putative acetyltransferase; GNAT family, structura 99.95
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 99.95
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 99.95
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 99.94
3efa_A147 Putative acetyltransferase; structural genom 2, pr 99.94
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 99.94
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 99.94
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 99.94
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 99.94
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 99.94
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 99.94
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 99.94
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 99.94
1wwz_A159 Hypothetical protein PH1933; structural genomics, 99.94
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 99.94
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 99.94
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 99.94
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 99.94
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 99.94
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 99.94
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 99.94
2fl4_A149 Spermine/spermidine acetyltransferase; structural 99.93
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 99.93
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 99.93
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 99.93
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 99.93
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 99.93
3owc_A188 Probable acetyltransferase; structural genomics, P 99.93
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 99.93
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 99.93
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 99.93
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 99.93
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 99.93
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 99.92
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 99.92
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 99.92
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 99.92
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A 99.92
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 99.92
2fe7_A166 Probable N-acetyltransferase; structural genomics, 99.92
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 99.92
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 99.92
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 99.92
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 99.92
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 99.92
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 99.92
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 99.92
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 99.92
1xeb_A150 Hypothetical protein PA0115; midwest center for st 99.92
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 99.92
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 99.92
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 99.92
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 99.92
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 99.92
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 99.91
3mgd_A157 Predicted acetyltransferase; structural genomics, 99.91
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 99.91
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 99.91
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 99.91
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 99.91
2eui_A153 Probable acetyltransferase; dimer, structural geno 99.91
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 99.91
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 99.91
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 99.91
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 99.91
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 99.91
1nsl_A184 Probable acetyltransferase; structural genomics, h 99.91
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 99.91
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 99.91
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 99.91
1vkc_A158 Putative acetyl transferase; structural genomics, 99.91
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 99.91
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 99.9
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 99.9
1z4r_A168 General control of amino acid synthesis protein 5- 99.9
1y7r_A133 Hypothetical protein SA2161; structural genomics, 99.9
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 99.9
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 99.9
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 99.9
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 99.9
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, prote 99.9
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 99.9
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 99.9
3tcv_A246 GCN5-related N-acetyltransferase; GRAM negative co 99.9
3pzj_A209 Probable acetyltransferases; MCSG, PSI-2, structur 99.9
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 99.9
2fck_A181 Ribosomal-protein-serine acetyltransferase, putat; 99.9
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 99.9
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 99.9
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 99.9
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 99.9
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 99.9
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 99.89
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 99.89
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 99.89
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 99.89
2aj6_A159 Hypothetical protein MW0638; structural genomics, 99.89
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 99.89
2qml_A198 BH2621 protein; structural genomics, joint center 99.89
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransfera 99.88
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 99.88
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 99.88
2gan_A190 182AA long hypothetical protein; alpha-beta protei 99.88
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structura 99.88
3juw_A175 Probable GNAT-family acetyltransferase; structural 99.88
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 99.87
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 99.87
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 99.87
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 99.87
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 99.87
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransfe 99.87
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 99.86
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 99.86
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 99.85
3frm_A254 Uncharacterized conserved protein; APC61048, staph 99.85
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic 99.85
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 99.85
2d4p_A141 Hypothetical protein TTHA1254; structural genomics 99.85
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 99.85
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 99.84
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 99.84
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, ace 99.84
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 99.82
2zw5_A 301 Bleomycin acetyltransferase; dimer, two domains; H 99.82
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 99.82
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 99.82
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 99.81
3r1k_A 428 Enhanced intracellular surviVal protein; GNAT, ace 99.81
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 99.81
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 99.8
3tt2_A 330 GCN5-related N-acetyltransferase; structural genom 99.8
2hv2_A 400 Hypothetical protein; PSI, protein structure initi 99.79
3sxn_A 422 Enhanced intracellular surviVal protein; GNAT fold 99.79
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, a 99.79
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 99.78
2i00_A 406 Acetyltransferase, GNAT family; structural genomic 99.77
1p0h_A 318 Hypothetical protein RV0819; GNAT fold, acetyltran 99.74
3shp_A176 Putative acetyltransferase STHE_0691; PSI-biology, 99.73
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 99.71
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 99.68
1ro5_A201 Autoinducer synthesis protein LASI; alpha-beta-alp 99.61
3p2h_A201 AHL synthase; acyl-ACP binding, SAM binding, signa 99.46
3dns_A135 Ribosomal-protein-alanine acetyltransferase; N-ter 99.44
1kzf_A230 Acyl-homoserinelactone synthase ESAI; alpha-beta, 99.36
1xmt_A103 Putative acetyltransferase; structural genomics, p 99.22
1bob_A320 HAT1, histone acetyltransferase; histone modificat 99.03
1yle_A 342 Arginine N-succinyltransferase, alpha chain; struc 99.0
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 98.54
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 98.05
4hkf_A191 Alpha-tubulin N-acetyltransferase; tubulin acetylt 97.89
4b14_A 385 Glycylpeptide N-tetradecanoyltransferase; malaria, 97.89
3gkr_A336 FEMX; FEMX, peptidoglycan, hexapeptide, transferas 97.79
3iu1_A 383 Glycylpeptide N-tetradecanoyltransferase 1; N-myri 97.78
1iic_A 422 Peptide N-myristoyltransferase; HET: MYA; 2.20A {S 97.61
1iyk_A 392 Myristoyl-COA:protein N-myristoyltransferase; HET: 97.58
2wuu_A 421 N-myristoyltransferase; acyltransferase; HET: NHM; 97.52
3s6g_A460 N-acetylglutamate kinase / N-acetylglutamate SYNT; 97.5
4h6u_A200 Alpha-tubulin N-acetyltransferase; tubulin acetylt 97.43
4b5o_A200 Alpha-tubulin N-acetyltransferase; microtubules, c 97.39
4gs4_A240 Alpha-tubulin N-acetyltransferase; acetyl coenzyme 97.28
3iwg_A 276 Acetyltransferase, GNAT family; structural genomic 97.27
1rxt_A 496 Myristoyl-, glycylpeptide N-tetradecanoyltransfera 97.22
3to7_A276 Histone acetyltransferase ESA1; MYST family; HET: 97.09
2ozu_A284 Histone acetyltransferase MYST3; structural genomi 97.05
2pq8_A278 Probable histone acetyltransferase MYST1; MOF, str 96.99
2ou2_A280 Histone acetyltransferase htatip; structural genom 96.99
3s6k_A467 Acetylglutamate kinase; synthase, transferase; 2.8 96.87
1lrz_A426 FEMA, factor essential for expression of methicill 96.45
4ab7_A464 Protein Arg5,6, mitochondrial; transferase, argini 96.39
3gkr_A 336 FEMX; FEMX, peptidoglycan, hexapeptide, transferas 95.8
2ozg_A396 GCN5-related N-acetyltransferase; YP_325469.1, ace 95.65
2hqy_A305 Conserved hypothetical protein; PSI2, MAD, structu 94.48
2hv2_A400 Hypothetical protein; PSI, protein structure initi 93.4
1lrz_A 426 FEMA, factor essential for expression of methicill 93.36
3n7z_A388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 92.52
4b14_A385 Glycylpeptide N-tetradecanoyltransferase; malaria, 91.28
3fxt_A113 Nucleoside diphosphate-linked moiety X motif 6; nu 91.16
2i00_A406 Acetyltransferase, GNAT family; structural genomic 90.99
2wuu_A421 N-myristoyltransferase; acyltransferase; HET: NHM; 88.94
1zo0_A126 ODC-AZ, ornithine decarboxylase antizyme; ornithin 85.5
1iic_A422 Peptide N-myristoyltransferase; HET: MYA; 2.20A {S 82.62
3iu1_A383 Glycylpeptide N-tetradecanoyltransferase 1; N-myri 80.95
1qys_A106 TOP7; alpha-beta, novel fold, de novo protein; 2.5 80.63
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
Probab=99.97  E-value=5.4e-29  Score=155.60  Aligned_cols=146  Identities=27%  Similarity=0.456  Sum_probs=119.2

Q ss_pred             CCCcccccccCCccchhhHHHHHHHHhhhcCCChhhHHHHHHHHhcCCceEEEEEECCeEEEEEEEeecCC---------
Q 042035            3 SNGAVTELQRNSTNWTNVVDEIVKMEKKIFPKHEPLARSFDEELKKKNSGLLYIQIHGQVVGYVMYAWPTS---------   73 (158)
Q Consensus         3 ~~~~ir~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vG~~~~~~~~~---------   73 (158)
                      ..+.||+++++      |+..+.++....++...+. ..+...+......++++..+|++||++.+.....         
T Consensus        11 ~~~~iR~~~~~------D~~~i~~l~~~~~~~~~~~-~~~~~~~~~~~~~~~va~~~~~ivG~~~~~~~~~~~~~~~~~~   83 (168)
T 2x7b_A           11 RDFTLRNARMD------DIDQIIKINRLTLPENYPY-YFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPS   83 (168)
T ss_dssp             -CCEEEECCGG------GHHHHHHHHHHHCSCCCCH-HHHHHHHHHHGGGCEEEEETTEEEEEEEEEEEEEECSSCSSCC
T ss_pred             ccEEEEeCCHH------HHHHHHHHHHHHCCCCccH-HHHHHHHhcCCceEEEEEECCeEEEEEEEEEeccccccccccC
Confidence            45889999999      8888888888777655432 2333334333345677778999999998764211         


Q ss_pred             --CeEEEEEEEeccCccCCcHHHHHHHHHHHHHHhC-CccEEEEEEcCCChhhHHHHHhCCCEEeeeeccccccCCcceE
Q 042035           74 --LSASITKLAVKENYRGQGHGEALLEAAIKKCRTR-TVLRITLHVDPFRTPAVNLYKKFGFQVDALIQGYYSADRPAYR  150 (158)
Q Consensus        74 --~~~~i~~~~v~~~~r~~Gig~~l~~~~~~~~~~~-g~~~i~~~~~~~n~~~~~~y~~~Gf~~~~~~~~~~~~~~~~~~  150 (158)
                        ..+++..++|+|+|||+|+|++|++++++++++. |+..+.+.|...|.+|++||+|+||+..+..+.++.++.+.+.
T Consensus        84 ~~~~~~i~~l~V~p~~rg~GiG~~Ll~~~~~~a~~~~g~~~i~l~v~~~N~~A~~~Yek~GF~~~~~~~~~~~~g~~~~~  163 (168)
T 2x7b_A           84 LVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYL  163 (168)
T ss_dssp             EEEEEEEEEEEECGGGTTSSHHHHHHHHHHHHHHHTTCCSEEEEEEETTCHHHHHHHHHTTCEEEEEETTCSTTSCCEEE
T ss_pred             CCcEEEEEEEEECHHHhccCHHHHHHHHHHHHHHHhcCeeEEEEEEEeCCHHHHHHHHHCCCEEEEEeecccCCCCcEEE
Confidence              2678889999999999999999999999999998 9999999999999999999999999999999888877789999


Q ss_pred             EEeec
Q 042035          151 MYMDF  155 (158)
Q Consensus       151 m~~~l  155 (158)
                      |.+.|
T Consensus       164 m~~~l  168 (168)
T 2x7b_A          164 MARPL  168 (168)
T ss_dssp             EEEC-
T ss_pred             EEecC
Confidence            99865
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* Back     alignment and structure
>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Back     alignment and structure
>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 Back     alignment and structure
>3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* Back     alignment and structure
>3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A Back     alignment and structure
>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Back     alignment and structure
>4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A* Back     alignment and structure
>4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* Back     alignment and structure
>3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A Back     alignment and structure
>3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* Back     alignment and structure
>1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* Back     alignment and structure
>1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A Back     alignment and structure
>2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* Back     alignment and structure
>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* Back     alignment and structure
>4h6u_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase; HET: ACO; 2.45A {Danio rerio} PDB: 4h6z_A* Back     alignment and structure
>4b5o_A Alpha-tubulin N-acetyltransferase; microtubules, cilium, intraflagellar transport; HET: ACO; 1.05A {Homo sapiens} PDB: 4b5p_A* Back     alignment and structure
>4gs4_A Alpha-tubulin N-acetyltransferase; acetyl coenzyme A binding, cytosolic; HET: ACO; 2.11A {Homo sapiens} Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 Back     alignment and structure
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Back     alignment and structure
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Back     alignment and structure
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Back     alignment and structure
>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} Back     alignment and structure
>1lrz_A FEMA, factor essential for expression of methicillin resistance; peptidoglycan, X-RAY crystallography, multiple anomalous dispersion; 2.10A {Staphylococcus aureus} SCOP: a.2.7.4 d.108.1.4 d.108.1.4 Back     alignment and structure
>4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* Back     alignment and structure
>3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2hqy_A Conserved hypothetical protein; PSI2, MAD, structural G protein structure initiative, midwest center for structural genomics; HET: COA; 1.80A {Bacteroides thetaiotaomicron} SCOP: d.108.1.4 d.108.1.4 Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>1lrz_A FEMA, factor essential for expression of methicillin resistance; peptidoglycan, X-RAY crystallography, multiple anomalous dispersion; 2.10A {Staphylococcus aureus} SCOP: a.2.7.4 d.108.1.4 d.108.1.4 Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* Back     alignment and structure
>3fxt_A Nucleoside diphosphate-linked moiety X motif 6; nudix, NUDT6, GFG, FGF2AS, antisense basic fibroblast growth FGF-2 regulation, hydrolase; 2.30A {Homo sapiens} Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* Back     alignment and structure
>1zo0_A ODC-AZ, ornithine decarboxylase antizyme; ornithine decarboxylase inhibitor, lyase inhibitor; NMR {Rattus norvegicus} SCOP: d.108.1.7 Back     alignment and structure
>1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* Back     alignment and structure
>3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* Back     alignment and structure
>1qys_A TOP7; alpha-beta, novel fold, de novo protein; 2.50A {Computationally designed sequence} SCOP: k.41.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 158
d1n71a_180 d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransfera 5e-15
d1sqha_297 d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fr 2e-14
d1z4ea1150 d.108.1.1 (A:4-153) Transcriptional regulator BH19 2e-14
d1y9ka1152 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillu 3e-14
d1s3za_147 d.108.1.1 (A:) Aminoglycoside N-acetyltransferase 3e-13
d1vkca_149 d.108.1.1 (A:) Putative acetyltransferase PF0028 { 4e-13
d2atra1137 d.108.1.1 (A:1-137) Probable acetyltransferase SP0 4e-13
d1p0ha_308 d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacter 2e-12
d1p0ha_ 308 d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacter 4e-06
d1i12a_157 d.108.1.1 (A:) Glucosamine-phosphate N-acetyltrans 4e-12
d1tiqa_173 d.108.1.1 (A:) Protease synthase and sporulation n 1e-11
d2jdca1145 d.108.1.1 (A:2-146) Probable acetyltransferase Yit 6e-11
d1yvka1152 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu 7e-11
d2gana1182 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {P 2e-10
d2hv2a2 285 d.108.1.10 (A:2-286) Hypothetical protein EF1021 { 2e-10
d2fiwa1156 d.108.1.1 (A:2-157) Probable N-acetyltransferase R 3e-10
d1y7ra1133 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {S 5e-10
d1bo4a_137 d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferas 8e-10
d1u6ma_189 d.108.1.1 (A:) Putative acetyltransferase EF0945 { 2e-09
d1qsra_162 d.108.1.1 (A:) Catalytic domain of GCN5 histone ac 2e-09
d1yx0a1151 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bac 2e-09
d1z4ra1162 d.108.1.1 (A:497-658) Catalytic domain of GCN5 his 2e-09
d1q2ya_140 d.108.1.1 (A:) Probable acetyltransferase YjcF {Ba 6e-09
d1cjwa_166 d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep 8e-09
d1ygha_164 d.108.1.1 (A:) Catalytic domain of GCN5 histone ac 9e-09
d2cy2a1174 d.108.1.1 (A:1-174) Probable acetyltransferase TTH 2e-08
d2b5ga1167 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {H 2e-08
d1y9wa1140 d.108.1.1 (A:1-140) Probable acetyltransferase BC2 3e-08
d2fe7a1156 d.108.1.1 (A:3-158) Probable N-acetyltransferase P 3e-08
d1ufha_155 d.108.1.1 (A:) Putative acetyltransferase YycN {Ba 3e-08
d1r57a_102 d.108.1.1 (A:) Hypothetical protein SA2309 {Staphy 3e-08
d2beia1167 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {H 4e-08
d2ozga2 283 d.108.1.10 (A:8-290) Putative acetyltransferase Av 4e-08
d1xeba_149 d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudo 4e-08
d2fl4a1146 d.108.1.1 (A:1-146) Probable spermine/spermidine a 2e-07
d2fiaa1157 d.108.1.1 (A:1-157) Probable acetyltransferase EF1 1e-06
d1mk4a_157 d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus 2e-06
d2g3aa1137 d.108.1.1 (A:1-137) Probable acetyltransferase Atu 2e-06
d1ghea_170 d.108.1.1 (A:) Tabtoxin resistance protein {Pseudo 3e-06
d2aj6a1118 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {S 4e-06
d1m4ia_181 d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransfera 5e-06
d1wwza1157 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {P 5e-06
d1yk3a1198 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/ 2e-05
d1ro5a_197 d.108.1.3 (A:) Autoinducer synthesis protein LasI 5e-05
d2ae6a1161 d.108.1.1 (A:1-161) Putative acetyltransferase EF0 9e-05
d2euia1153 d.108.1.1 (A:1-153) Probable acetyltransferase PA4 3e-04
d2ge3a1164 d.108.1.1 (A:6-169) Probable acetyltransferase Atu 5e-04
d1qsma_150 d.108.1.1 (A:) Histone acetyltransferase HPA2 {Bak 5e-04
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Length = 180 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Aminoglycoside 6'-N-acetyltransferase
species: Enterococcus faecium [TaxId: 1352]

 Score = 66.8 bits (162), Expect = 5e-15
 Identities = 26/172 (15%), Positives = 58/172 (33%), Gaps = 30/172 (17%)

Query: 7   VTELQRNSTNWTNVVDEIVKMEKKIFPKHEPLARSFD-EELKKKNSGLLYIQIHGQVVGY 65
           ++E  RN      + D++  + +  +P+    + + + EE+       +      ++VG+
Sbjct: 3   ISEFDRN---NPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMNPERIAVAAVDQDELVGF 59

Query: 66  VMYAWPTS-LSASITKLAVKENYRGQGHGEALLEAAIKKCRTRTVLRITLHVDP------ 118
           +            +  L V+ + R    G  L+    K+  +R  + I L  D       
Sbjct: 60  IGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHGTT 119

Query: 119 -------------------FRTPAVNLYKKFGFQVDALIQGYYSADRPAYRM 151
                               R      Y+K G+++  ++      D+P   M
Sbjct: 120 LSQTDLYEHTFDKVASIQNLREHPYEFYEKLGYKIVGVLPNANGWDKPDIWM 171
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 297 Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Length = 150 Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Length = 152 Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Length = 147 Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Length = 149 Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Length = 137 Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 308 Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 308 Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 157 Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Length = 173 Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Length = 145 Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Length = 152 Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Length = 182 Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Length = 285 Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Length = 156 Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Length = 133 Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Length = 137 Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Length = 189 Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Length = 162 Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Length = 151 Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Length = 140 Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Length = 166 Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Length = 140 Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Length = 156 Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Length = 155 Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Length = 102 Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Length = 283 Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Length = 149 Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Length = 146 Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Length = 157 Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Length = 157 Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Length = 137 Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Length = 170 Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Length = 118 Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Length = 157 Back     information, alignment and structure
>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 198 Back     information, alignment and structure
>d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} Length = 197 Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Length = 161 Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Length = 153 Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Length = 164 Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 150 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 99.96
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 99.96
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 99.96
d1tiqa_173 Protease synthase and sporulation negative regulat 99.96
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 99.95
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxI 99.95
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 99.95
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 99.95
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 99.95
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 99.95
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium 99.94
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 99.94
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 99.94
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 99.94
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 99.94
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 99.94
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 99.94
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 99.94
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus therm 99.93
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 99.93
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 99.93
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 99.93
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 99.92
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 99.92
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 99.92
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 99.92
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 99.92
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 99.92
d2euia1153 Probable acetyltransferase PA4026 {Pseudomonas aer 99.91
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 99.91
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 99.91
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 99.91
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 99.91
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 99.9
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 99.9
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) 99.89
d1s7ka1174 L7/L12-Ribosomal-protein-serine acetyltransferase 99.89
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 99.89
d2beia1167 Diamine acetyltransferase 2 {Human (Homo sapiens) 99.89
d1nsla_180 Probable acetyltransferase YdaF {Bacillus subtilis 99.89
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 99.89
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 99.88
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 99.88
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 99.87
d1yrea1183 Hypothetical protein PA3270 {Pseudomonas aeruginos 99.87
d2fcka1178 Putative ribosomal-protein-serine acetyltransferas 99.85
d1yk3a1198 Hypothetical protein Rv1347c/MT1389 {Mycobacterium 99.83
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 99.81
d2hv2a2 285 Hypothetical protein EF1021 {Enterococcus faecalis 99.81
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 99.81
d2ozga2 283 Putative acetyltransferase Ava4977 {Anabaena varia 99.8
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 99.77
d2i00a2 291 Putative acetyltransferase EF2353 {Enterococcus fa 99.74
d1m4ia_181 Aminoglycoside 2'-N-acetyltransferase {Mycobacteri 99.74
d2fsra1164 Probable acetyltranferase Atu2435 {Agrobacterium t 99.73
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 99.59
d1p0ha_ 308 Mycothiol synthase MshD {Mycobacterium tuberculosi 99.29
d1ro5a_197 Autoinducer synthesis protein LasI {Pseudomonas ae 99.26
d1kzfa_210 Acyl-homoserinelactone synthase EsaI {Pantoea stew 98.92
d1xmta_95 Hypothetical protein AT1g77540 {Thale cress (Arabi 98.5
d1lrza3182 Methicillin resistance protein FemA {Staphylococcu 98.44
d1ylea1 338 Arginine N-succinyltransferase, alpha chain, AstA 98.42
d1rxta1141 N-myristoyl transferase, NMT {Human (Homo sapiens) 98.28
d1iyka1165 N-myristoyl transferase, NMT {Yeast (Candida albic 98.22
d1iica1185 N-myristoyl transferase, NMT {Baker's yeast (Sacch 98.15
d1boba_315 Histone acetyltransferase HAT1 {Baker's yeast (Sac 98.11
d1lrza2165 Methicillin resistance protein FemA {Staphylococcu 97.98
d1ne9a2171 Peptidyltransferase FemX {Weissella viridescens [T 97.94
d2d4pa1130 Hypothetical protein TTHA1254 {Thermus thermophilu 97.27
d2giva1271 Probable histone acetyltransferase MYST1 {Human (H 97.25
d2ozua1270 Histone acetyltransferase MYST3 {Human (Homo sapie 97.18
d1fy7a_273 Histone acetyltransferase ESA1 {Baker's yeast (Sac 97.09
d2hqya1164 Hypothetical protein BT3689 {Bacteroides thetaiota 95.88
d1ne9a1164 Peptidyltransferase FemX {Weissella viridescens [T 94.93
d2hv2a2285 Hypothetical protein EF1021 {Enterococcus faecalis 92.95
d1cjxa1150 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 91.89
d1xqaa_113 Hypothetical protein BC3580 {Bacillus cereus [TaxI 86.5
d1ecsa_120 Bleomycin resistance protein, BRP {Klebsiella pneu 83.98
d1iica2237 N-myristoyl transferase, NMT {Baker's yeast (Sacch 83.91
d2ozga2283 Putative acetyltransferase Ava4977 {Anabaena varia 82.85
d1t47a1 163 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 80.46
d1iyka2227 N-myristoyl transferase, NMT {Yeast (Candida albic 80.33
d2i00a2291 Putative acetyltransferase EF2353 {Enterococcus fa 80.01
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Phosphinothricin acetyltransferase
species: Agrobacterium tumefaciens [TaxId: 358]

Probab=99.96  E-value=1.2e-27  Score=147.41  Aligned_cols=146  Identities=15%  Similarity=0.223  Sum_probs=113.8

Q ss_pred             CCcccccccCCccchhhHHHHHHHHhhh-------cCC---ChhhHHHHHHHHhcCCceEEEEEECCeEEEEEEEeecCC
Q 042035            4 NGAVTELQRNSTNWTNVVDEIVKMEKKI-------FPK---HEPLARSFDEELKKKNSGLLYIQIHGQVVGYVMYAWPTS   73 (158)
Q Consensus         4 ~~~ir~~~~~~~~~~~~~~~~~~~~~~~-------~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~vG~~~~~~~~~   73 (158)
                      +++||+++++      |++.+.++..+.       +..   .......+..........++++..+|++||++.+.....
T Consensus         1 ~i~IR~a~~~------D~~~i~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~va~~~~~ivG~~~~~~~~~   74 (163)
T d1yr0a1           1 SVELRDATVD------DLSGIMEIYNDAVVNTTAIWNEVVVDLENRKDWFAARTSRGFPVIVAILDGKVAGYASYGDWRA   74 (163)
T ss_dssp             CCEEEECCGG------GHHHHHHHHHHHHHHCSSSSSCCCCCHHHHHHHHHHHHHHTCCEEEEEETTEEEEEEEEEESSS
T ss_pred             CEEEEeCCHH------HHHHHHHHHHHHHhhcccccccCCCCHHHHHHHHHhhccCCCcEEEEEECCeEEEeecceeecc
Confidence            4889999999      788777775542       111   111112222333344556778888999999998875322


Q ss_pred             ----CeEEEEEEEeccCccCCcHHHHHHHHHHHHHHhCCccEEEEEEcCCChhhHHHHHhCCCEEeeeeccccc-cCC--
Q 042035           74 ----LSASITKLAVKENYRGQGHGEALLEAAIKKCRTRTVLRITLHVDPFRTPAVNLYKKFGFQVDALIQGYYS-ADR--  146 (158)
Q Consensus        74 ----~~~~i~~~~v~~~~r~~Gig~~l~~~~~~~~~~~g~~~i~~~~~~~n~~~~~~y~~~Gf~~~~~~~~~~~-~~~--  146 (158)
                          ....+..++|+|+|||+|+|++|+.+++++|++.|++++.+.|.+.|.++++||+|+||+.+|+.+.... .+.  
T Consensus        75 ~~~~~~~~~~~~~v~p~~rg~Glg~~ll~~~~~~a~~~g~~~l~~~v~~~N~~a~~~y~k~GF~~~G~~~~~~~~~g~~~  154 (163)
T d1yr0a1          75 FDGYRHTREHSVYVHKDARGHGIGKRLMQALIDHAGGNDVHVLIAAIEAENTASIRLHESLGFRVVGRFSEVGTKFGRWL  154 (163)
T ss_dssp             SGGGTTEEEEEEEECTTSTTSSHHHHHHHHHHHHHHTTTCCEEEEEEETTCHHHHHHHHHTTCEEEEEEEEEEEETTEEE
T ss_pred             cccccceEEEEeeeeecccCCCCceeeeecccccccccccceEEEEEecCCHHHHHHHHHCCCEEEEEEeeeEEECCEEE
Confidence                4567788999999999999999999999999999999999999999999999999999999999887643 343  


Q ss_pred             cceEEEeec
Q 042035          147 PAYRMYMDF  155 (158)
Q Consensus       147 ~~~~m~~~l  155 (158)
                      |.++|.|.|
T Consensus       155 D~~~m~k~L  163 (163)
T d1yr0a1         155 DLTCMELKL  163 (163)
T ss_dssp             EEEEEEEEC
T ss_pred             EEEEEEEEC
Confidence            788999876
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} Back     information, alignment and structure
>d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ylea1 d.108.1.8 (A:1-338) Arginine N-succinyltransferase, alpha chain, AstA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lrza2 d.108.1.4 (A:1-165) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} Back     information, alignment and structure
>d2d4pa1 d.108.1.1 (A:1-130) Hypothetical protein TTHA1254 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hqya1 d.108.1.4 (A:135-298) Hypothetical protein BT3689 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ne9a1 d.108.1.4 (A:1-164) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1iica2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1iyka2 d.108.1.2 (A:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure