Citrus Sinensis ID: 042047


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80---
MEGVGIARKINLSLYNSFETLANSLIHMFATYQKSEKRGVRYTLTYQDKEGDWLIAGDVPWQTFIESVQRLEILRCGAVESRP
ccccccEEEccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccEEEcccccHHHHHHHccEEEEEccccccccc
ccccccEEEEcHHHHccHHHHHHHHHHHHHcccccccccccEEEEEEcccccEEEEccccHHHHHHHHHHHEEEcccHccccc
MEGVGIARKINLSLYNSFETLANSLIHMFATYQksekrgvrytltyqdkegdwliagdvpwQTFIESVQRLEILRcgavesrp
MEGVGIARKINLSLYNSFETLANSLIHMFATyqksekrgVRYTLTYQDKEGDWLIAGDVPWQTFIESVQRLEILRCGAVESRP
MEGVGIARKINLSLYNSFETLANSLIHMFATYQKSEKRGVRYTLTYQDKEGDWLIAGDVPWQTFIESVQRLEILRCGAVESRP
****GIARKINLSLYNSFETLANSLIHMFATYQKSEKRGVRYTLTYQDKEGDWLIAGDVPWQTFIESVQRLEILRCGA*****
*EGVGIARKINLSLYNSFETLANSLIHMFATYQKSEKRGVRYTLTYQDKEGDWLIAGDVPWQTFIESVQRLEI**********
MEGVGIARKINLSLYNSFETLANSLIHMFATYQKSEKRGVRYTLTYQDKEGDWLIAGDVPWQTFIESVQRLEILRCGAVESRP
**GVGIARKINLSLYNSFETLANSLIHMFATYQKSEKRGVRYTLTYQDKEGDWLIAGDVPWQTFIESVQRLEILRCGAV****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
iiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGVGIARKINLSLYNSFETLANSLIHMFATYQKSEKRGVRYTLTYQDKEGDWLIAGDVPWQTFIESVQRLEILRCGAVESRP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query83 2.2.26 [Sep-21-2011]
Q93WC4251 Auxin-responsive protein yes no 0.903 0.298 0.533 6e-20
Q8H174158 Auxin-responsive protein no no 0.903 0.474 0.460 3e-15
Q38830239 Auxin-responsive protein no no 0.891 0.309 0.435 1e-14
Q10D34236 Auxin-responsive protein yes no 0.903 0.317 0.425 1e-14
A2XLV9236 Auxin-responsive protein N/A no 0.903 0.317 0.425 1e-14
Q9XFM0175 Auxin-responsive protein no no 0.915 0.434 0.428 6e-14
Q38831247 Auxin-responsive protein no no 0.915 0.307 0.388 1e-13
P13089243 Auxin-induced protein AUX no no 0.903 0.308 0.365 2e-13
Q5VRR0183 Auxin-responsive protein no no 0.891 0.404 0.435 3e-13
P33077186 Auxin-responsive protein no no 0.963 0.430 0.364 1e-12
>sp|Q93WC4|IAA29_ARATH Auxin-responsive protein IAA29 OS=Arabidopsis thaliana GN=IAA29 PE=2 SV=2 Back     alignment and function desciption
 Score = 95.9 bits (237), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 55/75 (73%)

Query: 1   MEGVGIARKINLSLYNSFETLANSLIHMFATYQKSEKRGVRYTLTYQDKEGDWLIAGDVP 60
           M+GV IARK+++ L+NS+E+L NSLI MF  Y+  ++    YT T+Q KEGDWL+ GDV 
Sbjct: 166 MDGVAIARKVDIKLFNSYESLTNSLITMFTEYEDCDREDTNYTFTFQGKEGDWLLRGDVT 225

Query: 61  WQTFIESVQRLEILR 75
           W+ F ESV R+ I+R
Sbjct: 226 WKIFAESVHRISIIR 240




Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8H174|IAA31_ARATH Auxin-responsive protein IAA31 OS=Arabidopsis thaliana GN=IAA31 PE=2 SV=2 Back     alignment and function description
>sp|Q38830|IAA12_ARATH Auxin-responsive protein IAA12 OS=Arabidopsis thaliana GN=IAA12 PE=1 SV=1 Back     alignment and function description
>sp|Q10D34|IAA13_ORYSJ Auxin-responsive protein IAA13 OS=Oryza sativa subsp. japonica GN=IAA13 PE=2 SV=1 Back     alignment and function description
>sp|A2XLV9|IAA13_ORYSI Auxin-responsive protein IAA13 OS=Oryza sativa subsp. indica GN=IAA13 PE=2 SV=1 Back     alignment and function description
>sp|Q9XFM0|IAA28_ARATH Auxin-responsive protein IAA28 OS=Arabidopsis thaliana GN=IAA28 PE=1 SV=1 Back     alignment and function description
>sp|Q38831|IAA13_ARATH Auxin-responsive protein IAA13 OS=Arabidopsis thaliana GN=IAA13 PE=1 SV=2 Back     alignment and function description
>sp|P13089|AUX28_SOYBN Auxin-induced protein AUX28 OS=Glycine max GN=AUX28 PE=2 SV=1 Back     alignment and function description
>sp|Q5VRR0|IAA20_ORYSJ Auxin-responsive protein IAA20 OS=Oryza sativa subsp. japonica GN=IAA20 PE=2 SV=1 Back     alignment and function description
>sp|P33077|IAA4_ARATH Auxin-responsive protein IAA4 OS=Arabidopsis thaliana GN=IAA4 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query83
224092498 229 predicted protein [Populus trichocarpa] 0.903 0.327 0.706 5e-24
359476140 889 PREDICTED: probable LRR receptor-like se 0.951 0.088 0.683 5e-24
296082047 227 unnamed protein product [Vitis vinifera] 0.939 0.343 0.692 8e-24
255548896 895 ATP binding protein, putative [Ricinus c 0.987 0.091 0.619 3e-22
365818557 227 IAA29 [Solanum lycopersicum] 0.903 0.330 0.56 4e-20
225445577 224 PREDICTED: auxin-responsive protein IAA2 0.903 0.334 0.589 1e-19
297738985 184 unnamed protein product [Vitis vinifera] 0.903 0.407 0.589 1e-19
365818563 196 IAA35 [Solanum lycopersicum] 0.867 0.367 0.613 3e-19
365818565 242 IAA36 [Solanum lycopersicum] 0.891 0.305 0.573 3e-19
449520179 234 PREDICTED: auxin-responsive protein IAA8 0.903 0.320 0.584 4e-19
>gi|224092498|ref|XP_002309635.1| predicted protein [Populus trichocarpa] gi|222855611|gb|EEE93158.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 53/75 (70%), Positives = 62/75 (82%)

Query: 1   MEGVGIARKINLSLYNSFETLANSLIHMFATYQKSEKRGVRYTLTYQDKEGDWLIAGDVP 60
           MEGV I RKI+L LYNS++TL  SLI MFA  +  EK   RY+LTYQDK+GDWLIAGDVP
Sbjct: 152 MEGVAITRKIDLRLYNSYQTLTKSLISMFAKCKNLEKDAARYSLTYQDKDGDWLIAGDVP 211

Query: 61  WQTFIESVQRLEILR 75
           WQTF+ESVQRL+I+R
Sbjct: 212 WQTFMESVQRLKIVR 226




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359476140|ref|XP_002282711.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g56130-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082047|emb|CBI21052.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255548896|ref|XP_002515504.1| ATP binding protein, putative [Ricinus communis] gi|223545448|gb|EEF46953.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|365818557|gb|AEX00367.1| IAA29 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|225445577|ref|XP_002285354.1| PREDICTED: auxin-responsive protein IAA29-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297738985|emb|CBI28230.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|365818563|gb|AEX00370.1| IAA35 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|365818565|gb|AEX00371.1| IAA36 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|449520179|ref|XP_004167111.1| PREDICTED: auxin-responsive protein IAA8-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query83
TAIR|locus:2116505251 IAA29 "indole-3-acetic acid in 0.903 0.298 0.533 2.5e-19
TAIR|locus:2090527158 IAA31 "indole-3-acetic acid in 0.903 0.474 0.460 4.2e-15
TAIR|locus:2180557175 IAA28 "AT5G25890" [Arabidopsis 0.891 0.422 0.44 4.9e-14
TAIR|locus:2197838239 IAA12 "indole-3-acetic acid in 0.891 0.309 0.435 6.2e-14
TAIR|locus:2084933236 IAA16 "indoleacetic acid-induc 0.445 0.156 0.486 7.2e-14
TAIR|locus:2094598243 IAA7 "indole-3-acetic acid 7" 0.409 0.139 0.529 3e-13
TAIR|locus:2195820267 IAA18 "indole-3-acetic acid in 0.481 0.149 0.525 3.4e-13
TAIR|locus:2139890302 IAA11 "indole-3-acetic acid in 0.385 0.105 0.656 3.5e-13
UNIPROTKB|Q5VRR0183 IAA20 "Auxin-responsive protei 0.891 0.404 0.461 4.4e-13
TAIR|locus:2088324269 PAP1 "phytochrome-associated p 0.481 0.148 0.5 4.9e-13
TAIR|locus:2116505 IAA29 "indole-3-acetic acid inducible 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 231 (86.4 bits), Expect = 2.5e-19, P = 2.5e-19
 Identities = 40/75 (53%), Positives = 55/75 (73%)

Query:     1 MEGVGIARKINLSLYNSFETLANSLIHMFATYQKSEKRGVRYTLTYQDKEGDWLIAGDVP 60
             M+GV IARK+++ L+NS+E+L NSLI MF  Y+  ++    YT T+Q KEGDWL+ GDV 
Sbjct:   166 MDGVAIARKVDIKLFNSYESLTNSLITMFTEYEDCDREDTNYTFTFQGKEGDWLLRGDVT 225

Query:    61 WQTFIESVQRLEILR 75
             W+ F ESV R+ I+R
Sbjct:   226 WKIFAESVHRISIIR 240




GO:0005634 "nucleus" evidence=ISM;IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009733 "response to auxin stimulus" evidence=RCA;TAS
GO:0010114 "response to red light" evidence=IEP
GO:0010218 "response to far red light" evidence=IEP
GO:0010583 "response to cyclopentenone" evidence=RCA
TAIR|locus:2090527 IAA31 "indole-3-acetic acid inducible 31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180557 IAA28 "AT5G25890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197838 IAA12 "indole-3-acetic acid inducible 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084933 IAA16 "indoleacetic acid-induced protein 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094598 IAA7 "indole-3-acetic acid 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195820 IAA18 "indole-3-acetic acid inducible 18" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139890 IAA11 "indole-3-acetic acid inducible 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VRR0 IAA20 "Auxin-responsive protein IAA20" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2088324 PAP1 "phytochrome-associated protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query83
pfam02309188 pfam02309, AUX_IAA, AUX/IAA family 8e-25
>gnl|CDD|216968 pfam02309, AUX_IAA, AUX/IAA family Back     alignment and domain information
 Score = 90.8 bits (226), Expect = 8e-25
 Identities = 32/81 (39%), Positives = 52/81 (64%), Gaps = 6/81 (7%)

Query: 1   MEGVGIARKINLSLYNSFETLANSLIHMFATYQKSEKR------GVRYTLTYQDKEGDWL 54
           M+G    RK++L +Y S++ L+++L  MF+ +   E        G  Y  TY+DK+GDW+
Sbjct: 97  MDGAPYLRKVDLKMYKSYDELSSALEKMFSCFTIGESGLLDLLNGSEYVPTYEDKDGDWM 156

Query: 55  IAGDVPWQTFIESVQRLEILR 75
           + GDVPW+ F+ES +RL I++
Sbjct: 157 LVGDVPWEMFVESCKRLRIMK 177


Transcription of the AUX/IAA family of genes is rapidly induced by the plant hormone auxin. Some members of this family are longer and contain an N terminal DNA binding domain. The function of this region is uncertain. Length = 188

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 83
PF02309215 AUX_IAA: AUX/IAA family; InterPro: IPR003311 The A 100.0
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 97.75
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 97.56
cd0599281 PB1 The PB1 domain is a modular domain mediating s 97.52
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 97.22
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 97.21
cd0640181 PB1_TFG The PB1 domain found in TFG protein, an on 97.14
cd0639891 PB1_Joka2 The PB1 domain is present in the Nicotia 96.82
cd0640380 PB1_Par6 The PB1 domain is an essential part of Pa 96.79
cd0639681 PB1_NBR1 The PB1 domain is an essential part of NB 96.79
cd0639782 PB1_UP1 Uncharacterized protein 1. The PB1 domain 96.08
cd0640287 PB1_p62 The PB1 domain is an essential part of p62 96.03
cd0640483 PB1_aPKC PB1 domain is an essential modular domain 95.78
cd0640886 PB1_NoxR The PB1 domain is present in the Epichloe 92.46
cd0639992 PB1_P40 The PB1 domain is essential part of the p4 91.24
>PF02309 AUX_IAA: AUX/IAA family; InterPro: IPR003311 The Aux/IAA family of genes are key regulators of auxin-modified gene expression [] Back     alignment and domain information
Probab=100.00  E-value=9.3e-41  Score=240.68  Aligned_cols=80  Identities=45%  Similarity=0.909  Sum_probs=0.0

Q ss_pred             CCCcceeeeeccCCCCCHHHHHHHHHHHH---hhh----------hhcc-cCCCceEEEEEcCCCCeEEecCCChhHHhh
Q 042047            1 MEGVGIARKINLSLYNSFETLANSLIHMF---ATY----------QKSE-KRGVRYTLTYQDKEGDWLIAGDVPWQTFIE   66 (83)
Q Consensus         1 MeG~~igRkiDL~~~~sY~~L~~~L~~MF---~~~----------~~~~-~~~~~~~l~Y~D~eGD~mlvGD~PW~~F~~   66 (83)
                      |||+||||||||++|+||++|+.+|++||   .+.          +..+ .++++|+|||+|+||||||||||||++||+
T Consensus       116 mdG~~igRkVDL~~~~sY~~L~~~L~~MF~~~~i~~~~~~~~~~~~~~~~~~~~~~~l~Y~D~egd~mlvGD~PW~~F~~  195 (215)
T PF02309_consen  116 MDGVPIGRKVDLSAYSSYEELSSALEKMFSCFSIEQCGSHGLNESGLLDLLNGSEYVLVYEDKEGDWMLVGDVPWEEFVK  195 (215)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ecCcccceecCHHHhhCHHHHHHHHHHhcCCCCccccccccccchhhccccCCcceeEEEECCCCCEEEecCCCHHHHHH
Confidence            89999999999999999999999999999   544          1111 256799999999999999999999999999


Q ss_pred             ccceeEEeeCCccc
Q 042047           67 SVQRLEILRCGAVE   80 (83)
Q Consensus        67 ~vkrl~I~~~~~~~   80 (83)
                      +||||+|++.+|+.
T Consensus       196 ~vkRl~I~~~~e~~  209 (215)
T PF02309_consen  196 SVKRLRIMKSSEAK  209 (215)
T ss_dssp             --------------
T ss_pred             HhhccEEecHHHhc
Confidence            99999999999875



The plant hormone auxin (indole-3-acetic acid, IAA) regulates diverse cellular and developmental responses in plants, including cell division, expansion, differentiation and patterning of embryo responses []. Auxin can regulate the gene expression of several families, including GH3 and SAUR, as well as Aux/IAA itself. The Aux/IAA proteins act as repressors of auxin-induced gene expression, possibly through modulating the activity of DNA-binding auxin response factors (ARFs) (IPR010525 from INTERPRO). Aux/IAA and ARF are thought to interact through C-terminal protein-protein interaction domains found in both Aux/IAA and ARF. Recent evidence suggests that Aux/IAA proteins can also mediate light responses []. Some members of the AUX/IAA family are longer and contain an N-terminal DNA binding domain [] and may have an early function in the establishment of vascular and body patterns in embryonic and post-embryonic development in some plants.; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 2P1N_F 2P1Q_C 2P1O_C.

>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>cd06401 PB1_TFG The PB1 domain found in TFG protein, an oncogenic gene product and fusion partner to nerve growth factor tyrosine kinase receptor TrkA and to the tyrosine kinase ALK Back     alignment and domain information
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein Back     alignment and domain information
>cd06403 PB1_Par6 The PB1 domain is an essential part of Par6 protein which in complex with Par3 and aPKC proteins is crucial for establishment of apical-basal polarity of animal cells Back     alignment and domain information
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62 Back     alignment and domain information
>cd06397 PB1_UP1 Uncharacterized protein 1 Back     alignment and domain information
>cd06402 PB1_p62 The PB1 domain is an essential part of p62 scaffold protein (alias sequestosome 1,SQSTM) involved in cell signaling, receptor internalization, and protein turnover Back     alignment and domain information
>cd06404 PB1_aPKC PB1 domain is an essential modular domain of the atypical protein kinase C (aPKC) which in complex with Par6 and Par3 proteins is crucial for establishment of apical-basal polarity of animal cells Back     alignment and domain information
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA Back     alignment and domain information
>cd06399 PB1_P40 The PB1 domain is essential part of the p40 adaptor protein which plays an important role in activating phagocyte NADPH oxidase during phagocytosis Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query83
1wmh_B86 Partitioning defective-6 homolog alpha; kinase, PB 96.79
1vd2_A89 Protein kinase C, IOTA type; PB1 domain, OPCA moti 96.0
1q1o_A98 Cell division control protein 24; PB1 domain, PCCR 95.56
2kkc_A102 Sequestosome-1; P62, PB1, autophagy, ubiquitin-pro 95.47
2ktr_A117 Sequestosome-1; autophagy, NF-KB signaling, HOMO-o 95.16
1pqs_A77 Cell division control protein 24; alpha and beta p 94.41
1oey_J107 P40-PHOX, neutrophil cytosol factor 4; immune syst 92.97
2bkf_A87 Zinc-finger protein NBR1 (NEXT to breast cancer 1; 91.43
1wj6_A101 KIAA0049 protein, RSGI RUH-024; PB1 domain, protei 89.72
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 81.25
>1wmh_B Partitioning defective-6 homolog alpha; kinase, PB1 domain, OPCA motif, APKC, cell polarity, transferase/cell cycle complex; 1.50A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
Probab=96.79  E-value=0.0024  Score=40.37  Aligned_cols=54  Identities=19%  Similarity=0.245  Sum_probs=40.5

Q ss_pred             eccCCCCCHHHHHHHHHHHHhhhhhcccCCCceEEEEEcCCCCeEEecCC-ChhHHhhccc
Q 042047           10 INLSLYNSFETLANSLIHMFATYQKSEKRGVRYTLTYQDKEGDWLIAGDV-PWQTFIESVQ   69 (83)
Q Consensus        10 iDL~~~~sY~~L~~~L~~MF~~~~~~~~~~~~~~l~Y~D~eGD~mlvGD~-PW~~F~~~vk   69 (83)
                      +|-+...+|++|+..++++|.+      ....+.+.|.|.+||++-+-.. =..+=+.++|
T Consensus        22 ~d~~~~~~fe~f~~lv~~lh~L------~~~~f~i~Y~D~dGDLlpInnDdnl~~Al~~a~   76 (86)
T 1wmh_B           22 LPRASVSGFQEFSRLLRAVHQI------PGLDVLLGYTDAHGDLLPLTNDDSLHRALASGP   76 (86)
T ss_dssp             EEGGGCCCHHHHHHHHHHHTTC------TTCCCEEEEECTTSCEEECCSHHHHHHHTTSSS
T ss_pred             ccCCCCCCHHHHHHHHHHHcCC------CCCCEEEEEECCCCCEeeecCHHHHHHHHHhCC
Confidence            4555678999999999999985      2368999999999999987543 3333334444



>1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A Back     alignment and structure
>1q1o_A Cell division control protein 24; PB1 domain, PCCR, PC motif, OPCA motif, yeast, cell polarity, protein-protein interaction; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 2kfj_A 2kfk_B Back     alignment and structure
>2kkc_A Sequestosome-1; P62, PB1, autophagy, ubiquitin-proteasome system, NF-KB signaling, alternative splicing, apoptosis, cytoplasm, differentiation; NMR {Rattus norvegicus} PDB: 2ktr_B Back     alignment and structure
>2ktr_A Sequestosome-1; autophagy, NF-KB signaling, HOMO-oligomer, PB1 dimer, signaling protein, transport protein; NMR {Rattus norvegicus} Back     alignment and structure
>1pqs_A Cell division control protein 24; alpha and beta protein, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 1tz1_A Back     alignment and structure
>1oey_J P40-PHOX, neutrophil cytosol factor 4; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>2bkf_A Zinc-finger protein NBR1 (NEXT to breast cancer 1; PB1 domain, interaction domain, Z finger; 1.56A {Homo sapiens} SCOP: d.15.2.2 PDB: 2g4s_A Back     alignment and structure
>1wj6_A KIAA0049 protein, RSGI RUH-024; PB1 domain, protein binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query83
d2bkfa185 Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Hum 96.77
d1ip9a_85 Bud emergence mediator Bemp1 {Baker's yeast (Sacch 95.99
d1wmhb_82 Partitioning defective-6 homolog alpha, PAR-6 alph 94.19
d1pqsa_77 Cell division control protein 24, CDC24, C-termina 91.63
d1oeyj_105 Neutrophil cytosol factor 4 (p40phox component of 91.18
d1e8qa_46 Cellulose docking domain, dockering {Piromyces equ 80.78
>d2bkfa1 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: CAD & PB1 domains
family: PB1 domain
domain: Next to BRCA1 gene 1 protein, NBR1 (KIAA0049)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=96.77  E-value=0.0014  Score=39.88  Aligned_cols=50  Identities=8%  Similarity=0.147  Sum_probs=38.3

Q ss_pred             eeccCCCCCHHHHHHHHHHHHhhhhhcccCCCceEEEEEcCCCCeEEec-CCChhHHhh
Q 042047            9 KINLSLYNSFETLANSLIHMFATYQKSEKRGVRYTLTYQDKEGDWLIAG-DVPWQTFIE   66 (83)
Q Consensus         9 kiDL~~~~sY~~L~~~L~~MF~~~~~~~~~~~~~~l~Y~D~eGD~mlvG-D~PW~~F~~   66 (83)
                      +|-.+.-.+|.+|...++..|+++        .+.|.|.|.||||.++. |.=-++...
T Consensus        19 ~ls~~~~~~~~~L~~~i~~rf~l~--------~~~lkY~Ddd~e~v~l~~d~dl~E~~~   69 (85)
T d2bkfa1          19 LVSDPENTTWADIEAMVKVSFDLN--------TIQIKYLDEENEEVSINSQGEYEEALK   69 (85)
T ss_dssp             EESCGGGCCHHHHHHHHHHHHTCS--------SEEEEEECTTSCEEEECSHHHHHHHHH
T ss_pred             EecCCCCCcHHHHHHHHHHhcCcc--------cceEEEEcCCCCEEEEecHHHHHHHHH
Confidence            344556688999999999999872        47999999999998775 344454444



>d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wmhb_ d.15.2.2 (B:) Partitioning defective-6 homolog alpha, PAR-6 alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pqsa_ d.15.2.2 (A:) Cell division control protein 24, CDC24, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oeyj_ d.15.2.2 (J:) Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8qa_ g.55.1.1 (A:) Cellulose docking domain, dockering {Piromyces equi [TaxId: 99929]} Back     information, alignment and structure