Citrus Sinensis ID: 042083
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 494 | 2.2.26 [Sep-21-2011] | |||||||
| Q940Q4 | 472 | RING-H2 finger protein AT | yes | no | 0.882 | 0.923 | 0.525 | 1e-102 | |
| Q9ZV53 | 423 | Putative RING-H2 finger p | no | no | 0.746 | 0.872 | 0.466 | 8e-87 | |
| Q9FL07 | 376 | RING-H2 finger protein AT | no | no | 0.631 | 0.829 | 0.389 | 7e-57 | |
| Q8GW38 | 369 | RING-H2 finger protein AT | no | no | 0.279 | 0.373 | 0.582 | 1e-47 | |
| Q9FHG8 | 210 | Putative RING-H2 finger p | no | no | 0.329 | 0.776 | 0.562 | 2e-44 | |
| Q7X843 | 349 | RING-H2 finger protein AT | no | no | 0.396 | 0.561 | 0.349 | 4e-33 | |
| Q5EAE9 | 407 | RING-H2 finger protein AT | no | no | 0.155 | 0.189 | 0.584 | 1e-23 | |
| Q84W40 | 404 | RING-H2 finger protein AT | no | no | 0.257 | 0.314 | 0.404 | 3e-23 | |
| Q9SL78 | 390 | Putative RING-H2 finger p | no | no | 0.348 | 0.441 | 0.352 | 1e-22 | |
| Q8W571 | 323 | RING-H2 finger protein AT | no | no | 0.309 | 0.473 | 0.331 | 5e-22 |
| >sp|Q940Q4|ATL13_ARATH RING-H2 finger protein ATL13 OS=Arabidopsis thaliana GN=ATL13 PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 371 bits (952), Expect = e-102, Method: Compositional matrix adjust.
Identities = 275/523 (52%), Positives = 338/523 (64%), Gaps = 87/523 (16%)
Query: 1 MAWFFLEMKES-TIVSPSSQPNFLPQPPPSPQNVNDGFNLNNKVSPSILLIIIILAIIFF 59
M W F E+K + +SPSS LPQ PP + F+LN+K+SPSILLIIIIL+IIFF
Sbjct: 8 MKWVFPEIKTTQNFLSPSS----LPQEPPLSLRSSANFDLNSKISPSILLIIIILSIIFF 63
Query: 60 VSGLLHLLVRFLLRPTNRDPED-LDNVTALQGQLQQLFHLHDAGVDQSFIDTLPVFYYKA 118
+SGLLHLLVRFLL P++RD ED DNVTALQGQLQQLFHLHD+GVDQSFIDTLPVF+YK+
Sbjct: 64 ISGLLHLLVRFLLTPSSRDREDYFDNVTALQGQLQQLFHLHDSGVDQSFIDTLPVFHYKS 123
Query: 119 IIGLKN-PFDCAVCLCEFEPEDKLRLLPKCSHAFHMECIDTWLLSHSTCPLCRASLLPDF 177
IIGLKN PFDCAVCLCEFE EDKLRLLPKCSHAFHM+CIDTWLLSHSTCPLCR+SLL D
Sbjct: 124 IIGLKNYPFDCAVCLCEFETEDKLRLLPKCSHAFHMDCIDTWLLSHSTCPLCRSSLLSDL 183
Query: 178 SS-SNSCSPVVLVLESGSE-SSREIAGDRDN---LGRTNSVLRTSTHLGCRGSSEFGSSH 232
SS + S +LVLES S+ SSREI GDRD+ + + + +S HLG G+++ GS+
Sbjct: 184 SSHQDPRSSFLLVLESASDHSSREIGGDRDSAACVAANDDIDVSSAHLGLVGNNDLGSTR 243
Query: 233 IDYTHKSCEILPKEDVVTSPTAVLDSGEKVVP--VKLGKYRTVDGGESS-------SNNN 283
ID H + L E + S KVVP VKLGK+R +D GE + ++++
Sbjct: 244 IDSGHGD-QYLDGE--------LGGSVGKVVPFSVKLGKFRNIDIGEGTSSNNNIGNSSS 294
Query: 284 IDARRCFSMGSFEYVMEENSLLQVTIRTPVKKQSSKKPSLPLTPGHRLAMSEC--DCESR 341
+D RRCFSMGS+EY+M+E + L+V + T KKQSSK L PGHR AMSEC D R
Sbjct: 295 LDERRCFSMGSYEYIMDEETTLKVHVST--KKQSSKNRGL---PGHRTAMSECGFDPTGR 349
Query: 342 REFNGFDTIKGIGSSFGANISAGKGNDIGRSKTDSFSISKIWLQGKKEKHNL---PEDPS 398
+F+G +++ + + N+ + +SFS+SKIWL+GKKEKH+ ED S
Sbjct: 350 LKFSGSGSMRIVEEAAEKNV----------VERESFSVSKIWLRGKKEKHSKVQGKEDSS 399
Query: 399 R------RAFSFRFPVNRNAAAVGDDRDLKSKNGNVGTRRTISEIGISRWEYGRSELGCD 452
RAFSFR RN E GC+
Sbjct: 400 LVSSSSGRAFSFRLSNQRNHPDA------------------------------MIESGCE 429
Query: 453 EENQSCSRSD-LQMKTPSFARRTLHWLMGRQNKVVHSSFTPNV 494
E+NQ C S+ L+ KTPSFARRT+ WL GRQNKVVHSS + NV
Sbjct: 430 EDNQKCENSESLETKTPSFARRTMLWLAGRQNKVVHSSSSTNV 472
|
Arabidopsis thaliana (taxid: 3702) |
| >sp|Q9ZV53|ATL49_ARATH Putative RING-H2 finger protein ATL49 OS=Arabidopsis thaliana GN=ATL49 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FL07|ATL46_ARATH RING-H2 finger protein ATL46 OS=Arabidopsis thaliana GN=ATL46 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8GW38|ATL47_ARATH RING-H2 finger protein ATL47 OS=Arabidopsis thaliana GN=ATL47 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FHG8|ATL50_ARATH Putative RING-H2 finger protein ATL50 OS=Arabidopsis thaliana GN=ATL50 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q7X843|ATL48_ARATH RING-H2 finger protein ATL48 OS=Arabidopsis thaliana GN=ATL48 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q5EAE9|ATL43_ARATH RING-H2 finger protein ATL43 OS=Arabidopsis thaliana GN=ATL43 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q84W40|ATL11_ARATH RING-H2 finger protein ATL11 OS=Arabidopsis thaliana GN=ATL11 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9SL78|ATL12_ARATH Putative RING-H2 finger protein ATL12 OS=Arabidopsis thaliana GN=ATL12 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q8W571|ATL32_ARATH RING-H2 finger protein ATL32 OS=Arabidopsis thaliana GN=ATL32 PE=2 SV=3 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 494 | ||||||
| 224142307 | 468 | predicted protein [Populus trichocarpa] | 0.937 | 0.989 | 0.694 | 0.0 | |
| 255586733 | 495 | ring finger protein, putative [Ricinus c | 0.981 | 0.979 | 0.724 | 0.0 | |
| 147838744 | 543 | hypothetical protein VITISV_042464 [Viti | 0.989 | 0.900 | 0.711 | 1e-177 | |
| 225445706 | 543 | PREDICTED: RING-H2 finger protein ATL13 | 0.989 | 0.900 | 0.709 | 1e-177 | |
| 224091879 | 464 | predicted protein [Populus trichocarpa] | 0.935 | 0.995 | 0.681 | 1e-174 | |
| 357479895 | 511 | RING finger protein [Medicago truncatula | 0.939 | 0.908 | 0.608 | 1e-146 | |
| 356547796 | 524 | PREDICTED: LOW QUALITY PROTEIN: RING-H2 | 0.910 | 0.858 | 0.634 | 1e-143 | |
| 356562503 | 522 | PREDICTED: RING-H2 finger protein ATL13- | 0.912 | 0.863 | 0.627 | 1e-139 | |
| 449464358 | 466 | PREDICTED: RING-H2 finger protein ATL13- | 0.848 | 0.899 | 0.576 | 1e-131 | |
| 449520227 | 466 | PREDICTED: RING-H2 finger protein ATL13- | 0.848 | 0.899 | 0.576 | 1e-130 |
| >gi|224142307|ref|XP_002324500.1| predicted protein [Populus trichocarpa] gi|222865934|gb|EEF03065.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 670 bits (1728), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 345/497 (69%), Positives = 399/497 (80%), Gaps = 34/497 (6%)
Query: 1 MAWFFLEMKESTIVSPSSQPNFLPQPPPSPQNVNDGFNLNNKVSPSILLIIIILAIIFFV 60
M W L++KES +SP+ QP FL QPPP P+ DGFNL+ +VSPSILLIIIILAIIFFV
Sbjct: 3 MNWVLLQIKESPFISPTQQPYFLSQPPPQPKLDTDGFNLSTRVSPSILLIIIILAIIFFV 62
Query: 61 SGLLHLLVRFLLRPTNRDPEDLDNVTALQGQLQQLFHLHDAGVDQSFIDTLPVFYYKAII 120
SGLLHLLVRFL RP NR+ +DL++VTALQGQLQQLFHLHDAGVDQ+FID LPVF+YKAII
Sbjct: 63 SGLLHLLVRFLSRPPNRETDDLESVTALQGQLQQLFHLHDAGVDQTFIDALPVFHYKAII 122
Query: 121 GLKNPFDCAVCLCEFEPEDKLRLLPKCSHAFHMECIDTWLLSHSTCPLCRASLLPDFSSS 180
GLKNPFDCAVCLCEFEPEDKLRLLPKCSHAFHMECIDTWLLSHSTCPLCRA LL DFS +
Sbjct: 123 GLKNPFDCAVCLCEFEPEDKLRLLPKCSHAFHMECIDTWLLSHSTCPLCRACLLSDFSPN 182
Query: 181 NSCSPVVLVLESGSESSREIAGDRD-NLGRTNSVLRTSTHLGCRGSSEFGSSHIDYTHKS 239
NSCSP+VLVLESG ESSREI DR+ ++GRT SVL T++HL C G +E GSS +D +HKS
Sbjct: 183 NSCSPIVLVLESGGESSREIVNDREADIGRTTSVLTTNSHLSCHGDNELGSSRLDISHKS 242
Query: 240 CEILPKEDVV--TSPTAVLDSGEKVVPVKLGKYRTVDGGESSSNNNIDARRCFSMGSFEY 297
EIL K+D V ++PT V+DS +KVVPVKLGK+R VD GE SS N+D+RRC+SMGSFEY
Sbjct: 243 SEILTKDDSVPDSAPTIVVDSWDKVVPVKLGKFRNVDNGEGSSTINVDSRRCYSMGSFEY 302
Query: 298 VMEENSLLQVTIRTPVKKQSSKKPSLPLTPGHRLAMSECDCESRREFNGFDTIKGIGSSF 357
V++ENS LQV +RTP+KKQSSKKP+LPLTPGHR AMSECDCESRREF+GF+++K + +
Sbjct: 303 VLDENSSLQVPVRTPMKKQSSKKPTLPLTPGHRPAMSECDCESRREFDGFESLKSVEVNG 362
Query: 358 GANISAGKGNDIGRSKTDSFSISKIWLQGKKEKHNLPEDPSRRAFSFRFPVNRNAAAVGD 417
A+I + GN IGRSK +SFSISKIWL+GKK K N PED SRRAFSFRFPVN+N A G
Sbjct: 363 TASIVSSSGNGIGRSKRESFSISKIWLRGKKVKQNSPEDSSRRAFSFRFPVNKNVVADG- 421
Query: 418 DRDLKSKNGNVGTRRTISEIGISRWEYGRSELGCDEENQSCSRSDLQMKTPSFARRTLHW 477
+W GCDE+NQSC+ +LQ+KTPSFARRTL W
Sbjct: 422 -----------------------QW-------GCDEQNQSCNSLELQVKTPSFARRTLLW 451
Query: 478 LMGRQNKVVHSSFTPNV 494
L+GRQNKVVHSSFTPNV
Sbjct: 452 LVGRQNKVVHSSFTPNV 468
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255586733|ref|XP_002533989.1| ring finger protein, putative [Ricinus communis] gi|223526024|gb|EEF28396.1| ring finger protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147838744|emb|CAN71824.1| hypothetical protein VITISV_042464 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225445706|ref|XP_002269611.1| PREDICTED: RING-H2 finger protein ATL13 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224091879|ref|XP_002309383.1| predicted protein [Populus trichocarpa] gi|222855359|gb|EEE92906.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357479895|ref|XP_003610233.1| RING finger protein [Medicago truncatula] gi|355511288|gb|AES92430.1| RING finger protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356547796|ref|XP_003542294.1| PREDICTED: LOW QUALITY PROTEIN: RING-H2 finger protein ATL13-like, partial [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356562503|ref|XP_003549510.1| PREDICTED: RING-H2 finger protein ATL13-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449464358|ref|XP_004149896.1| PREDICTED: RING-H2 finger protein ATL13-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449520227|ref|XP_004167135.1| PREDICTED: RING-H2 finger protein ATL13-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 494 | ||||||
| TAIR|locus:2118666 | 472 | AT4G30400 [Arabidopsis thalian | 0.710 | 0.743 | 0.457 | 2.1e-88 | |
| TAIR|locus:2054049 | 423 | MEE16 "maternal effect embryo | 0.568 | 0.664 | 0.398 | 3.8e-60 | |
| TAIR|locus:2199902 | 369 | AT1G23980 [Arabidopsis thalian | 0.198 | 0.265 | 0.606 | 1.1e-44 | |
| TAIR|locus:2173772 | 376 | AT5G40250 [Arabidopsis thalian | 0.214 | 0.281 | 0.533 | 1.7e-44 | |
| TAIR|locus:2172550 | 210 | AT5G57750 [Arabidopsis thalian | 0.279 | 0.657 | 0.468 | 3.1e-28 | |
| TAIR|locus:2097890 | 349 | AT3G48030 "AT3G48030" [Arabido | 0.161 | 0.229 | 0.670 | 5.2e-26 | |
| TAIR|locus:2081907 | 334 | ATL4 "TOXICOS EN LEVADURA 4" [ | 0.137 | 0.203 | 0.563 | 1.1e-20 | |
| TAIR|locus:2062008 | 227 | AT2G47560 [Arabidopsis thalian | 0.149 | 0.325 | 0.523 | 2.5e-19 | |
| TAIR|locus:2142449 | 301 | RING1 [Arabidopsis thaliana (t | 0.147 | 0.242 | 0.561 | 9e-19 | |
| TAIR|locus:2096444 | 356 | AT3G03550 [Arabidopsis thalian | 0.147 | 0.205 | 0.547 | 2.8e-18 |
| TAIR|locus:2118666 AT4G30400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 735 (263.8 bits), Expect = 2.1e-88, Sum P(2) = 2.1e-88
Identities = 184/402 (45%), Positives = 227/402 (56%)
Query: 37 FNLNNKVSPSXXXXXXXXXXXFFVSGXXXXXXXXXXRPTNRDPED-LDNVTAXXXXXXXX 95
F+LN+K+SPS FF+SG P++RD ED DNVTA
Sbjct: 41 FDLNSKISPSILLIIIILSIIFFISGLLHLLVRFLLTPSSRDREDYFDNVTALQGQLQQL 100
Query: 96 XXXXDAGVDQSFIDTLPVFYYKAIIGLKN-PFDCAVCLCEFEPEDKLRLLPKCSHAFHME 154
D+GVDQSFIDTLPVF+YK+IIGLKN PFDCAVCLCEFE EDKLRLLPKCSHAFHM+
Sbjct: 101 FHLHDSGVDQSFIDTLPVFHYKSIIGLKNYPFDCAVCLCEFETEDKLRLLPKCSHAFHMD 160
Query: 155 CIDTWLLSHSTCPLCRASLLPDFSSSNS--CXXXXXXXXXXXXXXXXIAGDRDN---LGR 209
CIDTWLLSHSTCPLCR+SLL D SS I GDRD+ +
Sbjct: 161 CIDTWLLSHSTCPLCRSSLLSDLSSHQDPRSSFLLVLESASDHSSREIGGDRDSAACVAA 220
Query: 210 TNSVLRTSTHLGCRGSSEFGSSHIDYTHKSCEILPKEDVVTSPTAVLDSGEKVVP--VKL 267
+ + +S HLG G+++ GS+ ID H + L E + S KVVP VKL
Sbjct: 221 NDDIDVSSAHLGLVGNNDLGSTRIDSGHGD-QYLDGE--------LGGSVGKVVPFSVKL 271
Query: 268 GKYRTVDGGE-SSSNNNI------DARRCFSMGSFEYVMEENSLLQVTIRXXXXXXXXXX 320
GK+R +D GE +SSNNNI D RRCFSMGS+EY+M+E + L+V +
Sbjct: 272 GKFRNIDIGEGTSSNNNIGNSSSLDERRCFSMGSYEYIMDEETTLKVHV-----STKKQS 326
Query: 321 XXXXXXXGHRLAMSEC--DCESRREFNGFDTIKGIGSSFGANISAGKGNDIGRSKTDSFS 378
GHR AMSEC D R +F+G +++ + A + N + R +SFS
Sbjct: 327 SKNRGLPGHRTAMSECGFDPTGRLKFSGSGSMRIVEE-------AAEKNVVER---ESFS 376
Query: 379 ISKIWLQGKKEKHN---------LPEDPSRRAFSFRFPVNRN 411
+SKIWL+GKKEKH+ L S RAFSFR RN
Sbjct: 377 VSKIWLRGKKEKHSKVQGKEDSSLVSSSSGRAFSFRLSNQRN 418
|
|
| TAIR|locus:2054049 MEE16 "maternal effect embryo arrest 16" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199902 AT1G23980 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173772 AT5G40250 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2172550 AT5G57750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2097890 AT3G48030 "AT3G48030" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2081907 ATL4 "TOXICOS EN LEVADURA 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2062008 AT2G47560 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2142449 RING1 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2096444 AT3G03550 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q940Q4 | ATL13_ARATH | No assigned EC number | 0.5258 | 0.8825 | 0.9237 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 6.3.2 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | gw1.XVIII.3004.1 | hypothetical protein (468 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 494 | |||
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 2e-17 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 5e-12 | |
| pfam12678 | 73 | pfam12678, zf-rbx1, RING-H2 zinc finger | 1e-11 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 2e-09 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 1e-07 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 2e-07 | |
| PHA02929 | 238 | PHA02929, PHA02929, N1R/p28-like protein; Provisio | 1e-06 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 2e-06 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 3e-06 | |
| pfam12861 | 85 | pfam12861, zf-Apc11, Anaphase-promoting complex su | 4e-06 | |
| COG5194 | 88 | COG5194, APC11, Component of SCF ubiquitin ligase | 1e-05 | |
| pfam11793 | 70 | pfam11793, FANCL_C, FANCL C-terminal domain | 0.003 | |
| COG5432 | 391 | COG5432, RAD18, RING-finger-containing E3 ubiquiti | 0.003 |
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
Score = 75.5 bits (186), Expect = 2e-17
Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
Query: 126 FDCAVCLCEFEPEDKLRLLPKCSHAFHMECIDTWLLSHSTCPLCRAS 172
+C +CL EFEP +++ +LP C H FH EC+D WL S +TCPLCRA
Sbjct: 1 DECPICLDEFEPGEEVVVLP-CGHVFHKECLDKWLRSSNTCPLCRAP 46
|
Length = 46 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|204746 pfam11793, FANCL_C, FANCL C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 494 | |||
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.71 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.39 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 99.33 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 99.2 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 99.16 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 99.14 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.81 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 98.75 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.73 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 98.71 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.7 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.68 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.67 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.65 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.63 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.54 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 98.49 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.49 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.45 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.43 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.42 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.37 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.27 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.2 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 98.17 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 98.16 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 98.07 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.06 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 98.05 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 98.02 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.94 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 97.8 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 97.79 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 97.77 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 97.75 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.72 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 97.68 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.67 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.63 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 97.57 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.46 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.35 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.18 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.14 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 97.14 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 97.13 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.63 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 96.53 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.5 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.47 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.43 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.37 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 96.23 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 96.17 | |
| KOG0801 | 205 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.12 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.0 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 95.97 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 95.59 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 95.49 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 95.32 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.16 | |
| PHA03096 | 284 | p28-like protein; Provisional | 95.1 | |
| PHA02862 | 156 | 5L protein; Provisional | 94.88 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 94.63 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 94.6 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 94.46 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 94.06 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 94.03 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.67 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.6 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 93.26 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 93.16 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 93.05 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.02 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.97 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 92.85 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 91.91 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 91.86 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 91.82 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 91.48 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 91.16 | |
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.98 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 90.57 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 90.48 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.0 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.96 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 88.37 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 87.83 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 87.14 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 86.94 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 86.84 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 86.71 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 86.17 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.88 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 84.98 | |
| KOG1609 | 323 | consensus Protein involved in mRNA turnover and st | 84.42 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 84.1 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 82.49 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 81.43 | |
| KOG3899 | 381 | consensus Uncharacterized conserved protein [Funct | 81.41 |
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.71 E-value=2.3e-17 Score=169.75 Aligned_cols=76 Identities=37% Similarity=0.802 Sum_probs=66.8
Q ss_pred CCCCCHHHHhcCCceeeeeecCCCCCCCCcccccccCCCCceeecCCCCCcccHHHHHHHHhcCC-CCCcccCCCCCC
Q 042083 100 DAGVDQSFIDTLPVFYYKAIIGLKNPFDCAVCLCEFEPEDKLRLLPKCSHAFHMECIDTWLLSHS-TCPLCRASLLPD 176 (494)
Q Consensus 100 ~~Gl~~~~I~~LP~~~y~~~~~~~~~~~CaICLeef~~~d~vr~LP~C~H~FH~~CI~~WL~~~~-tCPlCR~~l~~~ 176 (494)
..++.+..++++|+..|+...+....+.|+||||+|..||++|+|| |+|.||..||+.||.++. .||+|++++...
T Consensus 204 ~~r~~k~~l~~~p~~~f~~~~~~~~~~~CaIClEdY~~GdklRiLP-C~H~FH~~CIDpWL~~~r~~CPvCK~di~~~ 280 (348)
T KOG4628|consen 204 RNRLIKRLLKKLPVRTFTKGDDEDATDTCAICLEDYEKGDKLRILP-CSHKFHVNCIDPWLTQTRTFCPVCKRDIRTD 280 (348)
T ss_pred hhhhHHHHHhhCCcEEeccccccCCCceEEEeecccccCCeeeEec-CCCchhhccchhhHhhcCccCCCCCCcCCCC
Confidence 4566788999999999998766554579999999999999999999 999999999999999875 599999977665
|
|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3899 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 494 | ||||
| 1iym_A | 55 | Ring-H2 Finger Domain Of El5 Length = 55 | 1e-13 | ||
| 1x4j_A | 75 | Solution Structure Of Ring Finger In Ring Finger Pr | 2e-09 | ||
| 2kiz_A | 69 | Solution Structure Of Arkadia Ring-H2 Finger Domain | 8e-07 | ||
| 2ep4_A | 74 | Solution Structure Of Ring Finger From Human Ring F | 3e-06 | ||
| 2ect_A | 78 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 1e-05 | ||
| 2l0b_A | 91 | Solution Nmr Structure Of Zinc Finger Domain Of E3 | 5e-05 |
| >pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 | Back alignment and structure |
|
| >pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 | Back alignment and structure |
| >pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 | Back alignment and structure |
| >pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 | Back alignment and structure |
| >pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 | Back alignment and structure |
| >pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
Score = 123 bits (310), Expect = 2e-34
Identities = 27/72 (37%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
Query: 105 QSFIDTLPVFYYKAIIGLKNPFDCAVCLCEFEPEDKLRLLPKCSHAFHMECIDTWLLSHS 164
LP + + C VC+C+FE LR+LP C+H FH +C+D WL ++
Sbjct: 3 SGSSGQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLP-CNHEFHAKCVDKWLKANR 61
Query: 165 TCPLCRASLLPD 176
TCP+CRA P
Sbjct: 62 TCPICRADSGPS 73
|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 494 | |||
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.61 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.6 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.45 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.44 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.41 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.41 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.33 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.31 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.31 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.26 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.26 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.25 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.23 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.2 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 99.19 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.16 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.14 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.14 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 99.12 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.11 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.05 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.04 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.03 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 99.03 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.03 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.02 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.99 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.99 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.98 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.98 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.95 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.93 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.93 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.92 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.91 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.91 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.9 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.88 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.86 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.85 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.85 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.82 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.76 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.76 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.7 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.68 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.68 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.66 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.65 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.62 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.62 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.61 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.57 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 98.53 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.52 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.5 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.48 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.47 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.43 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.43 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.41 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.4 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.31 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.25 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.23 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.15 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.09 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.06 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 97.95 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 97.93 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 97.55 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.53 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 91.9 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 90.47 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 90.42 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 84.44 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 83.13 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 81.11 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 80.32 |
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.61 E-value=3e-16 Score=130.82 Aligned_cols=77 Identities=31% Similarity=0.713 Sum_probs=67.9
Q ss_pred ccCCCCCHHHHhcCCceeeeeecC-CCCCCCCcccccccCCCCceeecCCCCCcccHHHHHHHHhcCCCCCcccCCCCC
Q 042083 98 LHDAGVDQSFIDTLPVFYYKAIIG-LKNPFDCAVCLCEFEPEDKLRLLPKCSHAFHMECIDTWLLSHSTCPLCRASLLP 175 (494)
Q Consensus 98 l~~~Gl~~~~I~~LP~~~y~~~~~-~~~~~~CaICLeef~~~d~vr~LP~C~H~FH~~CI~~WL~~~~tCPlCR~~l~~ 175 (494)
....|++++.|+.||.+.+..... ......|+||+++|..++.++.+| |+|.||..||..||+.+.+||+||..+..
T Consensus 12 ~~~~~~s~~~i~~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~-C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~ 89 (91)
T 2l0b_A 12 VANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELP-CHHYFHKPCVSIWLQKSGTCPVCRCMFPP 89 (91)
T ss_dssp SCCCCCCHHHHHTSCEEECCTTCSSSSSCSEETTTTEECCTTCEEEEET-TTEEEEHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred cCCCCCCHHHHHhCCCeeecccccccCCCCCCcccChhhcCCCcEEecC-CCChHHHHHHHHHHHcCCcCcCcCccCCC
Confidence 456889999999999999876543 345678999999999999999999 99999999999999999999999998865
|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 494 | ||||
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 4e-21 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 3e-13 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 2e-11 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 5e-11 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 2e-10 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 2e-10 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 4e-09 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 1e-08 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 1e-07 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 3e-07 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 3e-06 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 7e-06 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 3e-05 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 9e-04 | |
| d2vv5a3 | 86 | f.34.1.1 (A:27-112) Mechanosensitive channel prote | 0.002 |
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: EL5 RING-H2 domain species: Rice (Oryza sativa) [TaxId: 4530]
Score = 84.2 bits (208), Expect = 4e-21
Identities = 28/54 (51%), Positives = 38/54 (70%)
Query: 121 GLKNPFDCAVCLCEFEPEDKLRLLPKCSHAFHMECIDTWLLSHSTCPLCRASLL 174
+ + +CAVCL E E ++ R LP+C H FH EC+D WL SHSTCPLCR +++
Sbjct: 1 AMDDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54
|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d2vv5a3 f.34.1.1 (A:27-112) Mechanosensitive channel protein MscS (YggB), transmembrane region {Escherichia coli [TaxId: 562]} Length = 86 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 494 | |||
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.59 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.32 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.3 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.3 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.29 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.19 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.14 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.06 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.9 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.87 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.87 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.84 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.73 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.63 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.62 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.54 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.28 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 89.16 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 84.58 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 81.56 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 81.15 |
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: EL5 RING-H2 domain species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.59 E-value=3.1e-16 Score=119.09 Aligned_cols=51 Identities=55% Similarity=1.247 Sum_probs=47.0
Q ss_pred CCCCCcccccccCCCCceeecCCCCCcccHHHHHHHHhcCCCCCcccCCCC
Q 042083 124 NPFDCAVCLCEFEPEDKLRLLPKCSHAFHMECIDTWLLSHSTCPLCRASLL 174 (494)
Q Consensus 124 ~~~~CaICLeef~~~d~vr~LP~C~H~FH~~CI~~WL~~~~tCPlCR~~l~ 174 (494)
+..+|+|||++|..++.+..++.|+|.||..||.+||+.+.+||+||++|.
T Consensus 4 d~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~ 54 (55)
T d1iyma_ 4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54 (55)
T ss_dssp CSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred CCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence 556899999999999999888779999999999999999999999999874
|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|