Citrus Sinensis ID: 042263
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 159 | ||||||
| 255583779 | 374 | ubiquitin-protein ligase, putative [Rici | 0.974 | 0.414 | 0.352 | 1e-23 | |
| 255647862 | 320 | unknown [Glycine max] | 0.962 | 0.478 | 0.333 | 6e-22 | |
| 356524904 | 320 | PREDICTED: E3 ubiquitin-protein ligase S | 0.962 | 0.478 | 0.333 | 6e-22 | |
| 388496832 | 281 | unknown [Lotus japonicus] | 0.949 | 0.537 | 0.349 | 2e-21 | |
| 15240373 | 281 | putative E3 ubiquitin-protein ligase SIN | 0.911 | 0.516 | 0.358 | 2e-21 | |
| 356512131 | 320 | PREDICTED: E3 ubiquitin-protein ligase S | 0.962 | 0.478 | 0.333 | 2e-21 | |
| 357491727 | 405 | Ubiquitin [Medicago truncatula] gi|35551 | 0.974 | 0.382 | 0.358 | 4e-21 | |
| 357449681 | 343 | Ubiquitin [Medicago truncatula] gi|35548 | 0.949 | 0.440 | 0.343 | 6e-21 | |
| 297801882 | 408 | hypothetical protein ARALYDRAFT_356210 [ | 0.867 | 0.338 | 0.371 | 8e-21 | |
| 449526479 | 269 | PREDICTED: E3 ubiquitin-protein ligase S | 0.955 | 0.565 | 0.347 | 3e-20 |
| >gi|255583779|ref|XP_002532642.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223527633|gb|EEF29745.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 114 bits (286), Expect = 1e-23, Method: Compositional matrix adjust.
Identities = 60/170 (35%), Positives = 94/170 (55%), Gaps = 15/170 (8%)
Query: 3 SCKNGSITSTISDQDLFDCPIWYQALKVPVSQSINGHIICSSCLAKVNNKCPACRSCVML 62
+ +N +I T++D ++ DCPI Y+ L +PV Q NGH CSSC K+ +KCP+C +
Sbjct: 104 TARNAAICVTLTDPEVLDCPICYECLSIPVFQCENGHTACSSCCRKLAHKCPSCSLPIGY 163
Query: 63 -RSRVMDIALE--------------KTMSFGENKDHERNCQCAPCACPLLDCNFLGSASQ 107
R R ++ LE + +S+ + DH++ C APC+CPL C+F+GS+ Q
Sbjct: 164 NRCRAIEKVLESVKLPCHNLKYGCKEMVSYSKKLDHDKICNNAPCSCPLSGCSFVGSSRQ 223
Query: 108 LYLYFSWKNGKTFVSFTYKKRVKVTLNVNDSVFLFRQQKNGHLFSLKNVV 157
LY +FS K+ + F Y V +ND + +++K G +F LKN
Sbjct: 224 LYQHFSIKHKGSAAPFRYNITFPVFFTLNDKSLILQEEKEGVVFFLKNTA 273
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255647862|gb|ACU24390.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356524904|ref|XP_003531068.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388496832|gb|AFK36482.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|15240373|ref|NP_198603.1| putative E3 ubiquitin-protein ligase SINA-like 6 [Arabidopsis thaliana] gi|75171231|sp|Q9FKD9.1|SINL6_ARATH RecName: Full=Putative E3 ubiquitin-protein ligase SINA-like 6; AltName: Full=Seven in absentia-like protein 6 gi|9758487|dbj|BAB09033.1| unnamed protein product [Arabidopsis thaliana] gi|332006860|gb|AED94243.1| putative E3 ubiquitin-protein ligase SINA-like 6 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356512131|ref|XP_003524774.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357491727|ref|XP_003616151.1| Ubiquitin [Medicago truncatula] gi|355517486|gb|AES99109.1| Ubiquitin [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357449681|ref|XP_003595117.1| Ubiquitin [Medicago truncatula] gi|355484165|gb|AES65368.1| Ubiquitin [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297801882|ref|XP_002868825.1| hypothetical protein ARALYDRAFT_356210 [Arabidopsis lyrata subsp. lyrata] gi|297314661|gb|EFH45084.1| hypothetical protein ARALYDRAFT_356210 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449526479|ref|XP_004170241.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 159 | ||||||
| TAIR|locus:2153784 | 349 | AT5G37930 [Arabidopsis thalian | 0.930 | 0.424 | 0.300 | 3.4e-22 | |
| TAIR|locus:2153804 | 281 | AT5G37870 [Arabidopsis thalian | 0.729 | 0.412 | 0.381 | 1.9e-21 | |
| TAIR|locus:2153754 | 286 | AT5G37890 [Arabidopsis thalian | 0.647 | 0.360 | 0.406 | 1.3e-20 | |
| TAIR|locus:2195175 | 313 | AT1G66620 [Arabidopsis thalian | 0.647 | 0.329 | 0.389 | 1.6e-17 | |
| TAIR|locus:2153774 | 276 | AT5G37910 [Arabidopsis thalian | 0.698 | 0.402 | 0.373 | 2.9e-16 | |
| TAIR|locus:2033354 | 348 | AT1G66660 [Arabidopsis thalian | 0.603 | 0.275 | 0.333 | 3.2e-13 | |
| TAIR|locus:2033369 | 329 | AT1G66650 [Arabidopsis thalian | 0.704 | 0.340 | 0.280 | 2.1e-12 | |
| TAIR|locus:2195180 | 303 | AT1G66630 [Arabidopsis thalian | 0.396 | 0.207 | 0.453 | 2.2e-12 | |
| UNIPROTKB|G3X7V0 | 281 | G3X7V0 "Uncharacterized protei | 0.811 | 0.459 | 0.265 | 1.7e-10 | |
| TAIR|locus:2195170 | 366 | AT1G66610 [Arabidopsis thalian | 0.396 | 0.172 | 0.453 | 2.1e-10 |
| TAIR|locus:2153784 AT5G37930 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 258 (95.9 bits), Expect = 3.4e-22, P = 3.4e-22
Identities = 49/163 (30%), Positives = 89/163 (54%)
Query: 3 SCKNGSITSTISDQDLFDCPIWYQALKVPVSQSINGHIICSSCLAKVNNKCPACRSCV-M 61
S K+ ++ T+ D D+ DCPI + LK+P+ Q NGH+ C+ C KV N+CP+C +
Sbjct: 95 SSKDSPLSVTLLDPDVLDCPICCEPLKIPIFQCDNGHLACTLCCTKVRNRCPSCTLPIGY 154
Query: 62 LRSRVMDIALE--------------KTMSFGENKDHERNCQCAPCACPLLDCNFLGSASQ 107
+R R M+ +E ++ S+G HE+ C PC+CP+LDC++ G
Sbjct: 155 VRCRAMEKVIEASRVSCLNAKYGCKESTSYGNRFSHEQVCVFTPCSCPILDCHYTGYYKD 214
Query: 108 LYLYFSWKNGKTFVSFTYKKRVKVTLNVNDSVFLFRQQKNGHL 150
L + ++ +SF + R+ ++L++N + +++ +GH+
Sbjct: 215 LNNHVRAEHKDDLISFVWNTRLTISLDLNKKTTILQEENDGHV 257
|
|
| TAIR|locus:2153804 AT5G37870 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153754 AT5G37890 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2195175 AT1G66620 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153774 AT5G37910 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2033354 AT1G66660 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2033369 AT1G66650 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2195180 AT1G66630 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3X7V0 G3X7V0 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2195170 AT1G66610 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 99.96 | |
| PF03145 | 198 | Sina: Seven in absentia protein family; InterPro: | 99.62 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 98.85 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.82 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.78 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.64 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.61 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.6 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.57 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.53 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.52 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.34 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.33 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.25 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.25 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.23 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.23 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.17 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.16 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.14 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.86 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 97.81 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 97.77 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.73 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 97.71 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.65 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 97.65 | |
| PF02176 | 60 | zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A | 97.62 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 97.58 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 97.5 | |
| PF02176 | 60 | zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A | 97.46 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.34 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.09 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 97.01 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 96.95 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.82 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 96.56 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.51 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 96.05 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 95.96 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.75 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 95.74 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.64 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 95.63 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.58 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 95.55 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.42 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 95.32 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 95.26 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 95.1 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 94.77 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.25 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 93.99 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 93.85 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.66 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 93.19 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 93.18 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 93.12 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 92.81 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 92.13 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 91.88 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.82 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 91.07 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.72 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.04 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 89.99 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 89.14 | |
| PF07975 | 51 | C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al | 89.03 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.41 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 88.33 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 88.05 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 88.03 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.84 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 87.29 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.06 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 86.96 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 85.72 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 83.01 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 82.68 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.66 | |
| PF10083 | 158 | DUF2321: Uncharacterized protein conserved in bact | 82.53 | |
| PF01363 | 69 | FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f | 81.89 | |
| PRK04023 | 1121 | DNA polymerase II large subunit; Validated | 81.88 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 81.03 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 80.15 | |
| PRK14714 | 1337 | DNA polymerase II large subunit; Provisional | 80.14 |
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.96 E-value=2e-30 Score=216.26 Aligned_cols=148 Identities=33% Similarity=0.682 Sum_probs=134.8
Q ss_pred EEeeCCCeeecccccccCCCceeeccCCceeccccccccCCCCCCCccCc-chhhHHHHHHHH--------------hhc
Q 042263 11 STISDQDLFDCPIWYQALKVPVSQSINGHIICSSCLAKVNNKCPACRSCV-MLRSRVMDIALE--------------KTM 75 (159)
Q Consensus 11 ~~~~~~~~l~C~iC~~~l~~Pv~qC~~GH~~C~~C~~~~~~~CP~Cr~~~-~~rn~~le~~~~--------------~~~ 75 (159)
++..+.+.|+||||.+++.+||+||.+||..|++|..++.++||.||.++ ++|++++|++++ +++
T Consensus 41 ~~~~~~~lleCPvC~~~l~~Pi~QC~nGHlaCssC~~~~~~~CP~Cr~~~g~~R~~amEkV~e~~~vpC~~~~~GC~~~~ 120 (299)
T KOG3002|consen 41 VTLLDLDLLDCPVCFNPLSPPIFQCDNGHLACSSCRTKVSNKCPTCRLPIGNIRCRAMEKVAEAVLVPCKNAKLGCTKSF 120 (299)
T ss_pred ccccchhhccCchhhccCcccceecCCCcEehhhhhhhhcccCCccccccccHHHHHHHHHHHhceecccccccCCceee
Confidence 67889999999999999999999999999999999988888999999999 999999999999 688
Q ss_pred cCCCchhhhccCCCCCCCCCCC--CCcceeChhHHHhHhhhhcCCceE-----EEEeCcEEEEEEeCC---CcEEEEEEc
Q 042263 76 SFGENKDHERNCQCAPCACPLL--DCNFLGSASQLYLYFSWKNGKTFV-----SFTYKKRVKVTLNVN---DSVFLFRQQ 145 (159)
Q Consensus 76 ~~~~~~~He~~C~~~p~~Cp~~--gC~~~g~~~~l~~H~~~~H~~~~~-----~~~~~~~~~~~~~~~---~~~~~l~~~ 145 (159)
+|++..+||+.|.|+|+.||.+ .|+|+|.+++|+.|+...|+..++ .|.|..+.+..+... ..+.++.+.
T Consensus 121 ~Y~~~~~HE~~C~f~~~~CP~p~~~C~~~G~~~~l~~H~~~~hk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 200 (299)
T KOG3002|consen 121 PYGEKSKHEKVCEFRPCSCPVPGAECKYTGSYKDLYAHLNDTHKSDIITLTGFDFVFVATDENLLGAATWTLKTSVCFGR 200 (299)
T ss_pred ccccccccccccccCCcCCCCCcccCCccCcHHHHHHHHHhhChhhhhhccccceecccCCccccccchhheeeeecCcE
Confidence 8999999999999999999998 999999999999999999999876 667766666666655 478888888
Q ss_pred CCCcEEEEEceec
Q 042263 146 KNGHLFSLKNVVA 158 (159)
Q Consensus 146 ~d~~lF~l~~~~~ 158 (159)
+++.+|+++++.+
T Consensus 201 ~~~~~~~~q~~~~ 213 (299)
T KOG3002|consen 201 EFGLLFEVQCFRE 213 (299)
T ss_pred EEeeeeeehhhcC
Confidence 9999999998765
|
|
| >PF03145 Sina: Seven in absentia protein family; InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454 | Back alignment and domain information |
|---|
| >PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PRK04023 DNA polymerase II large subunit; Validated | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14714 DNA polymerase II large subunit; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 159 | |||
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 3e-05 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 1e-04 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 1e-04 | |
| 2a25_A | 193 | Ubiquitin ligase SIAH1; protein-peptide complex, l | 1e-04 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 2e-04 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 3e-04 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 4e-04 |
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
Score = 40.5 bits (94), Expect = 3e-05
Identities = 20/97 (20%), Positives = 31/97 (31%), Gaps = 8/97 (8%)
Query: 17 DLFDCPIWYQALKVPVSQSINGHIICSSCLAK----VNNKCPACRSCVMLRSRVMDIALE 72
+ C L+ P Q+ GH CS CLA C AC + + +
Sbjct: 30 AKYLCSACRNVLRRPF-QAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESS 88
Query: 73 KTMSFGENKDHERNCQCAPCACPLLDCNFLGSASQLY 109
+ R + P CP C + G+ +
Sbjct: 89 SAF---PDNAARREVESLPAVCPSDGCTWKGTLKEYE 122
|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2a25_A Ubiquitin ligase SIAH1; protein-peptide complex, ligase; 2.20A {Homo sapiens} PDB: 2an6_A 1k2f_A Length = 193 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 99.79 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.57 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.51 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.49 | |
| 2a25_A | 193 | Ubiquitin ligase SIAH1; protein-peptide complex, l | 99.38 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.11 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.09 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.07 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.06 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.04 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.01 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 99.01 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.01 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.0 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.98 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.97 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.97 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.95 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.94 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.94 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.93 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.92 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.91 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 98.91 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.89 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.87 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.87 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.85 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.83 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.81 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.81 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.81 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.81 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.77 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.77 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.76 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.76 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.75 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.72 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.71 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.68 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.67 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.67 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.63 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.63 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.62 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.62 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.6 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.57 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.56 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.56 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.54 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.53 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.52 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.48 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.41 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.41 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.35 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.34 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.32 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.27 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.16 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.15 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.1 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 97.95 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 97.73 | |
| 2yuc_A | 76 | TNF receptor-associated factor 4; ZF-TRAF, cystein | 97.67 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 97.61 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.32 | |
| 2yre_A | 100 | F-box only protein 30; zinc binding, E3 ubiquitin | 96.85 | |
| 2yuc_A | 76 | TNF receptor-associated factor 4; ZF-TRAF, cystein | 96.76 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 96.7 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 96.29 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 95.92 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 95.84 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 94.59 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 94.28 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 92.14 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 90.87 | |
| 2jne_A | 101 | Hypothetical protein YFGJ; zinc fingers, two zinc, | 89.61 | |
| 1wg2_A | 64 | Zinc finger (AN1-like) family protein; riken struc | 88.23 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 87.04 | |
| 1wfh_A | 64 | Zinc finger (AN1-like) family protein; ZF-AN1 doma | 86.3 | |
| 2ct7_A | 86 | Ring finger protein 31; IBR, structural genomics, | 86.28 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 84.05 | |
| 2jrp_A | 81 | Putative cytoplasmic protein; two-zinc binding pro | 83.81 | |
| 1z2q_A | 84 | LM5-1; membrane protein, FYVE domain, zinc-finger; | 83.75 | |
| 2yw8_A | 82 | RUN and FYVE domain-containing protein 1; structur | 83.65 | |
| 1z60_A | 59 | TFIIH basal transcription factor complex P44 subun | 83.59 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 82.68 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 82.46 | |
| 1joc_A | 125 | EEA1, early endosomal autoantigen 1; FYVE domain, | 82.46 | |
| 2jmo_A | 80 | Parkin; IBR, E3 ligase, zinc binding domain, RBR; | 82.45 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 82.16 | |
| 1x4u_A | 84 | Zinc finger, FYVE domain containing 27 isoform B; | 81.1 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 80.09 |
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.79 E-value=5.1e-20 Score=140.24 Aligned_cols=105 Identities=22% Similarity=0.448 Sum_probs=90.6
Q ss_pred eCCCeeecccccccCCCceeeccCCceeccccccccC----CCCCCCccCc----chhhHHHHHHHH------------h
Q 042263 14 SDQDLFDCPIWYQALKVPVSQSINGHIICSSCLAKVN----NKCPACRSCV----MLRSRVMDIALE------------K 73 (159)
Q Consensus 14 ~~~~~l~C~iC~~~l~~Pv~qC~~GH~~C~~C~~~~~----~~CP~Cr~~~----~~rn~~le~~~~------------~ 73 (159)
.-.+.|.||||+++|.+|+. ++|||+||..|+.++. .+||.||.++ ..++.++++++. .
T Consensus 14 ~~~~~~~C~IC~~~~~~pv~-~~CgH~fC~~Ci~~~~~~~~~~CP~Cr~~~~~~~~~~~~~~~~~i~~l~v~C~n~GC~~ 92 (170)
T 3hcs_A 14 PLESKYECPICLMALREAVQ-TPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLH 92 (170)
T ss_dssp CCCGGGBCTTTCSBCSSEEE-CTTSCEEEHHHHHHHHHHHCSBCTTTCCBCCGGGCEECHHHHHHHHTSEEECCSTTCCC
T ss_pred CCCCCCCCCCCChhhcCcEE-CCCCCHHHHHHHHHHHHhCCCCCCCCccCcchhhhhhhHHHHHHHhhcccCCCCCCCCc
Confidence 34568999999999999965 7999999999999874 4899999998 246778888777 4
Q ss_pred hccCCCchhhhccCCCCCCCCCCCCCcceeChhHHHhHhhhhcCCceE
Q 042263 74 TMSFGENKDHERNCQCAPCACPLLDCNFLGSASQLYLYFSWKNGKTFV 121 (159)
Q Consensus 74 ~~~~~~~~~He~~C~~~p~~Cp~~gC~~~g~~~~l~~H~~~~H~~~~~ 121 (159)
++++.++++|+++|+|+++.|| +|+|.+.+.+|..|+....+.+.+
T Consensus 93 ~~~~~~l~~H~~~C~~~~v~C~--~C~~~~~r~~l~~H~~~~C~~r~~ 138 (170)
T 3hcs_A 93 KMELRHLEDHQAHCEFALMDCP--QCQRPFQKFHINIHILKDCPRRQV 138 (170)
T ss_dssp EEEGGGHHHHHTTCTTSEEECT--TTCCEEEGGGHHHHHHHTCTTCEE
T ss_pred eecHhHHHHHHhcCCceeeECC--CCChHHHHHHHHHHhhhhCCCCCe
Confidence 6778899999999999999998 799999999999999877776654
|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2a25_A Ubiquitin ligase SIAH1; protein-peptide complex, ligase; 2.20A {Homo sapiens} PDB: 2an6_A 1k2f_A | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2yre_A F-box only protein 30; zinc binding, E3 ubiquitin ligase, SCF, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 | Back alignment and structure |
|---|
| >1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} | Back alignment and structure |
|---|
| >2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A | Back alignment and structure |
|---|
| >1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A | Back alignment and structure |
|---|
| >2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 159 | ||||
| d1k2fa_ | 190 | b.8.1.2 (A:) SIAH, seven in absentia homolog {Mous | 1e-06 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 0.001 |
| >d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]} Length = 190 | Back information, alignment and structure |
|---|
class: All beta proteins fold: TRAF domain-like superfamily: TRAF domain-like family: SIAH, seven in absentia homolog domain: SIAH, seven in absentia homolog species: Mouse (Mus musculus) [TaxId: 10090]
Score = 43.9 bits (103), Expect = 1e-06
Identities = 19/86 (22%), Positives = 28/86 (32%), Gaps = 4/86 (4%)
Query: 72 EKTMSFGENKDHERNCQCAP--CACPLLDCNFLGSASQLYLYFSW--KNGKTFVSFTYKK 127
E T+ E +HE C+ P C CP C + GS + + K+ T
Sbjct: 14 EITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVF 73
Query: 128 RVKVTLNVNDSVFLFRQQKNGHLFSL 153
++ Q G F L
Sbjct: 74 LATDINLPGAVDWVMMQSCFGFHFML 99
|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| d1k2fa_ | 190 | SIAH, seven in absentia homolog {Mouse (Mus muscul | 99.46 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.28 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.13 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.12 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.05 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.02 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.99 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.81 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.8 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.79 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.79 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.77 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.63 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.61 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.13 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 97.98 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 97.8 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 96.82 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 94.0 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 93.48 | |
| d2jnea1 | 71 | Hypothetical protein YfgJ {Escherichia coli [TaxId | 93.32 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 92.04 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 91.77 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 91.11 | |
| d1z60a1 | 59 | TFIIH p44 subunit cysteine-rich domain {Human (Hom | 91.04 | |
| d1wfpa_ | 74 | Zinc finger A20 and AN1 domains containing protein | 90.95 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 90.45 | |
| d1wfha_ | 64 | Zinc finger A20 and AN1 domains containing protein | 85.4 | |
| d1joca1 | 64 | Eea1 {Human (Homo sapiens) [TaxId: 9606]} | 85.13 | |
| d1zbdb_ | 124 | Effector domain of rabphilin-3a {Rat (Rattus norve | 83.7 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 83.6 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 83.41 | |
| d1wfla_ | 74 | Zinc finger A20 domain containing protein 2 {Mouse | 82.61 | |
| d1wffa_ | 85 | ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus | 82.52 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 81.58 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 80.83 |
| >d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: TRAF domain-like superfamily: TRAF domain-like family: SIAH, seven in absentia homolog domain: SIAH, seven in absentia homolog species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.46 E-value=4.1e-14 Score=108.39 Aligned_cols=85 Identities=19% Similarity=0.214 Sum_probs=69.2
Q ss_pred hhccCCCchhhhccCCCCCCCCCCC--CCcceeChhHHHhHhhhhcCCceEEEEeCcEEEEEE--eCCCcEEEEEEcCCC
Q 042263 73 KTMSFGENKDHERNCQCAPCACPLL--DCNFLGSASQLYLYFSWKNGKTFVSFTYKKRVKVTL--NVNDSVFLFRQQKNG 148 (159)
Q Consensus 73 ~~~~~~~~~~He~~C~~~p~~Cp~~--gC~~~g~~~~l~~H~~~~H~~~~~~~~~~~~~~~~~--~~~~~~~~l~~~~d~ 148 (159)
++++|.++.+||++|.|+|+.||.+ +|+|+|..++|..|+..+|++..+.+.++..+.... .++....++++..+|
T Consensus 15 ~~~~~~~~~~HE~~C~~~p~~C~~~~~~C~~~G~~~~l~~Hl~~~H~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~g 94 (190)
T d1k2fa_ 15 ITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFG 94 (190)
T ss_dssp CCCCGGGHHHHHHTCTTSCEECCSSSTTCCCEECHHHHHHHHHHSSCCCEEEESSEEEEEECCTTCTTCCEEEEEEEETT
T ss_pred EeccccchhhHHhcCCCcccCCCCCCCCCccCCCHhHHHHHHHhcCCcccccCccceEEeeeccccccceeEEEEEecCC
Confidence 5688999999999999999777665 699999999999999999998777666666555433 233557788888999
Q ss_pred cEEEEEcee
Q 042263 149 HLFSLKNVV 157 (159)
Q Consensus 149 ~lF~l~~~~ 157 (159)
.+|+|...+
T Consensus 95 ~~F~l~~~~ 103 (190)
T d1k2fa_ 95 FHFMLVLEK 103 (190)
T ss_dssp EEEEEEEEE
T ss_pred CEEEEEEEE
Confidence 999998654
|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|