Citrus Sinensis ID: 042263


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
LRSCKNGSITSTISDQDLFDCPIWYQALKVPVSQSINGHIICSSCLAKVNNKCPACRSCVMLRSRVMDIALEKTMSFGENKDHERNCQCAPCACPLLDCNFLGSASQLYLYFSWKNGKTFVSFTYKKRVKVTLNVNDSVFLFRQQKNGHLFSLKNVVAG
ccccccccEEEEcccccccccccccccccccccccccccEEccccccccccccccccccccHHHHHHccccccEEcccccccccccccccccccccccccEEEcHHHHHHHHHHccccccEEEEEccEEEEEEEccccEEEEEEccccEEEEEEcEEcc
cccccccccccccccHHHcccccccccccccEEEcccccEEEcccHHHHcccccccccccccccHHHHcccccEEcccccHHHHHHccccccccccccccccccHHHHHHHHHHHccccEEEEEEcEEEEEEEEccccEEEEEEccccEEEEEEEcccc
lrsckngsitstisdqdlfdcpiwyqalkvpvsqsinghiICSSCLakvnnkcpacrscVMLRSRVMDIALEKTmsfgenkdherncqcapcacplldcnflgsaSQLYLYFSwkngktfvsfTYKKRVKVTLNVNDSVFLFRqqknghlfslknvvag
lrsckngsitstisdqdlfDCPIWYQALKVPVSQSINGHIICSSCLAKVNNKCPACRSCVMLRSRVMDIALEKTMSFGENKDHERNCQCAPCACPLLDCNFLGSASQLYLYFSWKNGKTFVSFTYKKRVKVTLNVNDSVFLfrqqknghlfslknvvag
LRSCKNGSITSTISDQDLFDCPIWYQALKVPVSQSINGHIICSSCLAKVNNKCPACRSCVMLRSRVMDIALEKTMSFGENKDHERNCQCAPCACPLLDCNFLGSASQLYLYFSWKNGKTFVSFTYKKRVKVTLNVNDSVFLFRQQKNGHLFSLKNVVAG
************ISDQDLFDCPIWYQALKVPVSQSINGHIICSSCLAKVNNKCPACRSCVMLRSRVMDIALEKTMSFGENKDHERNCQCAPCACPLLDCNFLGSASQLYLYFSWKNGKTFVSFTYKKRVKVTLNVNDSVFLFRQQKNGHLFSLK*****
****************DLFDCPIWYQALKVPVSQSINGHIICSSCLAKVNNKCPACRSCVMLRSRVMDIALEKTMSFGENKDHERNCQCAPCACPLLDCNFLGSASQLYLYFSWKNGKTFVSFTYKKRVKVTLNVNDSVFLFRQQKNGHLFSLKNVVA*
********ITSTISDQDLFDCPIWYQALKVPVSQSINGHIICSSCLAKVNNKCPACRSCVMLRSRVMDIALEKTMSFGENKDHERNCQCAPCACPLLDCNFLGSASQLYLYFSWKNGKTFVSFTYKKRVKVTLNVNDSVFLFRQQKNGHLFSLKNVVAG
************ISDQDLFDCPIWYQALKVPVSQSINGHIICSSCLAKVNNKCPACRSCVMLRSRVMDIALEKTMSFGENKDHERNCQCAPCACPLLDCNFLGSASQLYLYFSWKNGKTFVSFTYKKRVKVTLNVNDSVFLFRQQKNGHLFSLKNVVA*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LRSCKNGSITSTISDQDLFDCPIWYQALKVPVSQSINGHIICSSCLAKVNNKCPACRSCVMLRSRVMDIALEKTMSFGENKDHERNCQCAPCACPLLDCNFLGSASQLYLYFSWKNGKTFVSFTYKKRVKVTLNVNDSVFLFRQQKNGHLFSLKNVVAG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query159 2.2.26 [Sep-21-2011]
Q9FKD9281 Putative E3 ubiquitin-pro yes no 0.911 0.516 0.358 3e-23
Q9FKD7286 E3 ubiquitin-protein liga no no 0.911 0.506 0.333 2e-21
Q84K34349 E3 ubiquitin-protein liga no no 0.899 0.409 0.297 8e-21
Q9C6H3 313 E3 ubiquitin-protein liga no no 0.905 0.460 0.318 2e-16
Q9FM14 314 E3 ubiquitin-protein liga no no 0.937 0.474 0.286 3e-15
Q9FKD5276 Putative E3 ubiquitin-pro no no 0.867 0.5 0.304 2e-14
Q9FKD6263 E3 ubiquitin-protein liga no no 0.911 0.551 0.298 2e-14
Q9C9M0329 E3 ubiquitin-protein liga no no 0.993 0.480 0.256 4e-13
Q9C6H2303 E3 ubiquitin-protein liga no no 0.647 0.339 0.341 9e-13
Q7XA77328 E3 ubiquitin-protein liga no no 0.893 0.432 0.263 1e-11
>sp|Q9FKD9|SINL6_ARATH Putative E3 ubiquitin-protein ligase SINA-like 6 OS=Arabidopsis thaliana GN=At5g37870 PE=3 SV=1 Back     alignment and function desciption
 Score =  107 bits (267), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 87/162 (53%), Gaps = 17/162 (10%)

Query: 10  TSTISDQDLFDCPIWYQALKVPVSQSINGHIICSSCLAKVNNKCPACRSCV-MLRSRVMD 68
           ++ ++D D+ DCPI YQALK+PV Q  NGH+ CSSC  K+ NKCPAC   V  +R R M+
Sbjct: 34  SAMLTDLDILDCPICYQALKIPVFQCGNGHLACSSCCPKLRNKCPACALPVGHIRCRAME 93

Query: 69  IALE--------------KTMSFGENKDHERNCQCAPCACPLLDCNFLGSASQLYLYF-- 112
             LE              KT+ +G    HE+ C  +PC+CP+  CN+ GS   LY ++  
Sbjct: 94  RVLESVLVPCRYADLGCTKTIYYGRESTHEKICNFSPCSCPVQGCNYTGSYKDLYEHYDL 153

Query: 113 SWKNGKTFVSFTYKKRVKVTLNVNDSVFLFRQQKNGHLFSLK 154
           +   G T  SF     +   + ++D + + R  +   LF ++
Sbjct: 154 THSTGSTAYSFNGVSYIAAMMFISDKILIERVYEKKLLFVVQ 195




E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. It probably triggers the ubiquitin-mediated degradation of different substrates.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9FKD7|SINL7_ARATH E3 ubiquitin-protein ligase SINA-like 7 OS=Arabidopsis thaliana GN=At5g37890 PE=2 SV=1 Back     alignment and function description
>sp|Q84K34|SIL10_ARATH E3 ubiquitin-protein ligase SINA-like 10 OS=Arabidopsis thaliana GN=At5g37930 PE=2 SV=1 Back     alignment and function description
>sp|Q9C6H3|SINL2_ARATH E3 ubiquitin-protein ligase SINA-like 2 OS=Arabidopsis thaliana GN=At1g66620 PE=2 SV=1 Back     alignment and function description
>sp|Q9FM14|SIL11_ARATH E3 ubiquitin-protein ligase SINA-like 11 OS=Arabidopsis thaliana GN=At5g62800 PE=2 SV=2 Back     alignment and function description
>sp|Q9FKD5|SINL9_ARATH Putative E3 ubiquitin-protein ligase SINA-like 9 OS=Arabidopsis thaliana GN=At5g37910 PE=3 SV=1 Back     alignment and function description
>sp|Q9FKD6|SINL8_ARATH E3 ubiquitin-protein ligase SINA-like 8 OS=Arabidopsis thaliana GN=At5g37900 PE=1 SV=2 Back     alignment and function description
>sp|Q9C9M0|SINL4_ARATH E3 ubiquitin-protein ligase SINA-like 4 OS=Arabidopsis thaliana GN=At1g66650 PE=2 SV=1 Back     alignment and function description
>sp|Q9C6H2|SINL3_ARATH E3 ubiquitin-protein ligase SINA-like 3 OS=Arabidopsis thaliana GN=At1g66630 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA77|SINL5_ARATH E3 ubiquitin-protein ligase SINA-like 5 OS=Arabidopsis thaliana GN=At1g66660 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
255583779 374 ubiquitin-protein ligase, putative [Rici 0.974 0.414 0.352 1e-23
255647862 320 unknown [Glycine max] 0.962 0.478 0.333 6e-22
356524904 320 PREDICTED: E3 ubiquitin-protein ligase S 0.962 0.478 0.333 6e-22
388496832 281 unknown [Lotus japonicus] 0.949 0.537 0.349 2e-21
15240373 281 putative E3 ubiquitin-protein ligase SIN 0.911 0.516 0.358 2e-21
356512131 320 PREDICTED: E3 ubiquitin-protein ligase S 0.962 0.478 0.333 2e-21
357491727 405 Ubiquitin [Medicago truncatula] gi|35551 0.974 0.382 0.358 4e-21
357449681 343 Ubiquitin [Medicago truncatula] gi|35548 0.949 0.440 0.343 6e-21
297801882 408 hypothetical protein ARALYDRAFT_356210 [ 0.867 0.338 0.371 8e-21
449526479 269 PREDICTED: E3 ubiquitin-protein ligase S 0.955 0.565 0.347 3e-20
>gi|255583779|ref|XP_002532642.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223527633|gb|EEF29745.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 94/170 (55%), Gaps = 15/170 (8%)

Query: 3   SCKNGSITSTISDQDLFDCPIWYQALKVPVSQSINGHIICSSCLAKVNNKCPACRSCVML 62
           + +N +I  T++D ++ DCPI Y+ L +PV Q  NGH  CSSC  K+ +KCP+C   +  
Sbjct: 104 TARNAAICVTLTDPEVLDCPICYECLSIPVFQCENGHTACSSCCRKLAHKCPSCSLPIGY 163

Query: 63  -RSRVMDIALE--------------KTMSFGENKDHERNCQCAPCACPLLDCNFLGSASQ 107
            R R ++  LE              + +S+ +  DH++ C  APC+CPL  C+F+GS+ Q
Sbjct: 164 NRCRAIEKVLESVKLPCHNLKYGCKEMVSYSKKLDHDKICNNAPCSCPLSGCSFVGSSRQ 223

Query: 108 LYLYFSWKNGKTFVSFTYKKRVKVTLNVNDSVFLFRQQKNGHLFSLKNVV 157
           LY +FS K+  +   F Y     V   +ND   + +++K G +F LKN  
Sbjct: 224 LYQHFSIKHKGSAAPFRYNITFPVFFTLNDKSLILQEEKEGVVFFLKNTA 273




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255647862|gb|ACU24390.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356524904|ref|XP_003531068.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Glycine max] Back     alignment and taxonomy information
>gi|388496832|gb|AFK36482.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|15240373|ref|NP_198603.1| putative E3 ubiquitin-protein ligase SINA-like 6 [Arabidopsis thaliana] gi|75171231|sp|Q9FKD9.1|SINL6_ARATH RecName: Full=Putative E3 ubiquitin-protein ligase SINA-like 6; AltName: Full=Seven in absentia-like protein 6 gi|9758487|dbj|BAB09033.1| unnamed protein product [Arabidopsis thaliana] gi|332006860|gb|AED94243.1| putative E3 ubiquitin-protein ligase SINA-like 6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356512131|ref|XP_003524774.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Glycine max] Back     alignment and taxonomy information
>gi|357491727|ref|XP_003616151.1| Ubiquitin [Medicago truncatula] gi|355517486|gb|AES99109.1| Ubiquitin [Medicago truncatula] Back     alignment and taxonomy information
>gi|357449681|ref|XP_003595117.1| Ubiquitin [Medicago truncatula] gi|355484165|gb|AES65368.1| Ubiquitin [Medicago truncatula] Back     alignment and taxonomy information
>gi|297801882|ref|XP_002868825.1| hypothetical protein ARALYDRAFT_356210 [Arabidopsis lyrata subsp. lyrata] gi|297314661|gb|EFH45084.1| hypothetical protein ARALYDRAFT_356210 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449526479|ref|XP_004170241.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
TAIR|locus:2153784349 AT5G37930 [Arabidopsis thalian 0.930 0.424 0.300 3.4e-22
TAIR|locus:2153804281 AT5G37870 [Arabidopsis thalian 0.729 0.412 0.381 1.9e-21
TAIR|locus:2153754286 AT5G37890 [Arabidopsis thalian 0.647 0.360 0.406 1.3e-20
TAIR|locus:2195175 313 AT1G66620 [Arabidopsis thalian 0.647 0.329 0.389 1.6e-17
TAIR|locus:2153774276 AT5G37910 [Arabidopsis thalian 0.698 0.402 0.373 2.9e-16
TAIR|locus:2033354348 AT1G66660 [Arabidopsis thalian 0.603 0.275 0.333 3.2e-13
TAIR|locus:2033369329 AT1G66650 [Arabidopsis thalian 0.704 0.340 0.280 2.1e-12
TAIR|locus:2195180 303 AT1G66630 [Arabidopsis thalian 0.396 0.207 0.453 2.2e-12
UNIPROTKB|G3X7V0281 G3X7V0 "Uncharacterized protei 0.811 0.459 0.265 1.7e-10
TAIR|locus:2195170 366 AT1G66610 [Arabidopsis thalian 0.396 0.172 0.453 2.1e-10
TAIR|locus:2153784 AT5G37930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 258 (95.9 bits), Expect = 3.4e-22, P = 3.4e-22
 Identities = 49/163 (30%), Positives = 89/163 (54%)

Query:     3 SCKNGSITSTISDQDLFDCPIWYQALKVPVSQSINGHIICSSCLAKVNNKCPACRSCV-M 61
             S K+  ++ T+ D D+ DCPI  + LK+P+ Q  NGH+ C+ C  KV N+CP+C   +  
Sbjct:    95 SSKDSPLSVTLLDPDVLDCPICCEPLKIPIFQCDNGHLACTLCCTKVRNRCPSCTLPIGY 154

Query:    62 LRSRVMDIALE--------------KTMSFGENKDHERNCQCAPCACPLLDCNFLGSASQ 107
             +R R M+  +E              ++ S+G    HE+ C   PC+CP+LDC++ G    
Sbjct:   155 VRCRAMEKVIEASRVSCLNAKYGCKESTSYGNRFSHEQVCVFTPCSCPILDCHYTGYYKD 214

Query:   108 LYLYFSWKNGKTFVSFTYKKRVKVTLNVNDSVFLFRQQKNGHL 150
             L  +   ++    +SF +  R+ ++L++N    + +++ +GH+
Sbjct:   215 LNNHVRAEHKDDLISFVWNTRLTISLDLNKKTTILQEENDGHV 257




GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA;ISS
GO:0007275 "multicellular organismal development" evidence=IEA;ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016567 "protein ubiquitination" evidence=IEA
TAIR|locus:2153804 AT5G37870 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153754 AT5G37890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195175 AT1G66620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153774 AT5G37910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033354 AT1G66660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033369 AT1G66650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195180 AT1G66630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G3X7V0 G3X7V0 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2195170 AT1G66610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 159
KOG3002299 consensus Zn finger protein [General function pred 99.96
PF03145198 Sina: Seven in absentia protein family; InterPro: 99.62
KOG0297 391 consensus TNF receptor-associated factor [Signal t 98.85
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.82
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.78
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.64
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.61
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.6
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.57
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.53
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.52
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.34
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.33
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.25
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.25
PF1463444 zf-RING_5: zinc-RING finger domain 98.23
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.23
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.17
PHA02929238 N1R/p28-like protein; Provisional 98.16
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.14
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.86
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.81
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 97.77
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.73
PHA02926242 zinc finger-like protein; Provisional 97.71
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.65
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.65
PF0217660 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 97.62
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.58
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.5
PF0217660 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 97.46
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.34
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.09
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.01
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.95
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.82
COG5152259 Uncharacterized conserved protein, contains RING a 96.56
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.51
PLN03086567 PRLI-interacting factor K; Provisional 96.05
KOG4739233 consensus Uncharacterized protein involved in syna 95.96
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 95.75
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 95.74
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 95.64
KOG2660 331 consensus Locus-specific chromosome binding protei 95.63
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 95.58
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 95.55
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.42
COG5222427 Uncharacterized conserved protein, contains RING Z 95.32
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 95.26
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 95.1
COG5175 480 MOT2 Transcriptional repressor [Transcription] 94.77
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 94.25
PLN03086567 PRLI-interacting factor K; Provisional 93.99
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 93.85
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 93.66
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 93.19
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 93.18
KOG4367 699 consensus Predicted Zn-finger protein [Function un 93.12
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 92.81
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 92.13
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 91.88
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 91.82
COG5236 493 Uncharacterized conserved protein, contains RING Z 91.07
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 90.72
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 90.04
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 89.99
KOG1002 791 consensus Nucleotide excision repair protein RAD16 89.14
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 89.03
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 88.41
KOG0825 1134 consensus PHD Zn-finger protein [General function 88.33
PRK11088 272 rrmA 23S rRNA methyltransferase A; Provisional 88.05
PF04641260 Rtf2: Rtf2 RING-finger 88.03
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 87.84
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 87.29
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 87.06
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 86.96
COG52191525 Uncharacterized conserved protein, contains RING Z 85.72
KOG1001674 consensus Helicase-like transcription factor HLTF/ 83.01
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 82.68
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 82.66
PF10083158 DUF2321: Uncharacterized protein conserved in bact 82.53
PF0136369 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f 81.89
PRK04023 1121 DNA polymerase II large subunit; Validated 81.88
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 81.03
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 80.15
PRK14714 1337 DNA polymerase II large subunit; Provisional 80.14
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
Probab=99.96  E-value=2e-30  Score=216.26  Aligned_cols=148  Identities=33%  Similarity=0.682  Sum_probs=134.8

Q ss_pred             EEeeCCCeeecccccccCCCceeeccCCceeccccccccCCCCCCCccCc-chhhHHHHHHHH--------------hhc
Q 042263           11 STISDQDLFDCPIWYQALKVPVSQSINGHIICSSCLAKVNNKCPACRSCV-MLRSRVMDIALE--------------KTM   75 (159)
Q Consensus        11 ~~~~~~~~l~C~iC~~~l~~Pv~qC~~GH~~C~~C~~~~~~~CP~Cr~~~-~~rn~~le~~~~--------------~~~   75 (159)
                      ++..+.+.|+||||.+++.+||+||.+||..|++|..++.++||.||.++ ++|++++|++++              +++
T Consensus        41 ~~~~~~~lleCPvC~~~l~~Pi~QC~nGHlaCssC~~~~~~~CP~Cr~~~g~~R~~amEkV~e~~~vpC~~~~~GC~~~~  120 (299)
T KOG3002|consen   41 VTLLDLDLLDCPVCFNPLSPPIFQCDNGHLACSSCRTKVSNKCPTCRLPIGNIRCRAMEKVAEAVLVPCKNAKLGCTKSF  120 (299)
T ss_pred             ccccchhhccCchhhccCcccceecCCCcEehhhhhhhhcccCCccccccccHHHHHHHHHHHhceecccccccCCceee
Confidence            67889999999999999999999999999999999988888999999999 999999999999              688


Q ss_pred             cCCCchhhhccCCCCCCCCCCC--CCcceeChhHHHhHhhhhcCCceE-----EEEeCcEEEEEEeCC---CcEEEEEEc
Q 042263           76 SFGENKDHERNCQCAPCACPLL--DCNFLGSASQLYLYFSWKNGKTFV-----SFTYKKRVKVTLNVN---DSVFLFRQQ  145 (159)
Q Consensus        76 ~~~~~~~He~~C~~~p~~Cp~~--gC~~~g~~~~l~~H~~~~H~~~~~-----~~~~~~~~~~~~~~~---~~~~~l~~~  145 (159)
                      +|++..+||+.|.|+|+.||.+  .|+|+|.+++|+.|+...|+..++     .|.|..+.+..+...   ..+.++.+.
T Consensus       121 ~Y~~~~~HE~~C~f~~~~CP~p~~~C~~~G~~~~l~~H~~~~hk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  200 (299)
T KOG3002|consen  121 PYGEKSKHEKVCEFRPCSCPVPGAECKYTGSYKDLYAHLNDTHKSDIITLTGFDFVFVATDENLLGAATWTLKTSVCFGR  200 (299)
T ss_pred             ccccccccccccccCCcCCCCCcccCCccCcHHHHHHHHHhhChhhhhhccccceecccCCccccccchhheeeeecCcE
Confidence            8999999999999999999998  999999999999999999999876     667766666666655   478888888


Q ss_pred             CCCcEEEEEceec
Q 042263          146 KNGHLFSLKNVVA  158 (159)
Q Consensus       146 ~d~~lF~l~~~~~  158 (159)
                      +++.+|+++++.+
T Consensus       201 ~~~~~~~~q~~~~  213 (299)
T KOG3002|consen  201 EFGLLFEVQCFRE  213 (299)
T ss_pred             EEeeeeeehhhcC
Confidence            9999999998765



>PF03145 Sina: Seven in absentia protein family; InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454 Back     alignment and domain information
>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 3e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 1e-04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 1e-04
2a25_A193 Ubiquitin ligase SIAH1; protein-peptide complex, l 1e-04
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-04
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 3e-04
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 4e-04
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
 Score = 40.5 bits (94), Expect = 3e-05
 Identities = 20/97 (20%), Positives = 31/97 (31%), Gaps = 8/97 (8%)

Query: 17  DLFDCPIWYQALKVPVSQSINGHIICSSCLAK----VNNKCPACRSCVMLRSRVMDIALE 72
             + C      L+ P  Q+  GH  CS CLA         C AC    +    +  +   
Sbjct: 30  AKYLCSACRNVLRRPF-QAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESS 88

Query: 73  KTMSFGENKDHERNCQCAPCACPLLDCNFLGSASQLY 109
                  +    R  +  P  CP   C + G+  +  
Sbjct: 89  SAF---PDNAARREVESLPAVCPSDGCTWKGTLKEYE 122


>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2a25_A Ubiquitin ligase SIAH1; protein-peptide complex, ligase; 2.20A {Homo sapiens} PDB: 2an6_A 1k2f_A Length = 193 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.79
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.57
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.51
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.49
2a25_A193 Ubiquitin ligase SIAH1; protein-peptide complex, l 99.38
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.11
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.09
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.07
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.06
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.01
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.01
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.01
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.0
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.98
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.97
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.97
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.95
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.94
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.94
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.93
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.92
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.91
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.91
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.89
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.87
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.87
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.85
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.83
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.81
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.81
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.81
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.81
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.77
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.77
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.76
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.76
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.75
2ea5_A68 Cell growth regulator with ring finger domain prot 98.72
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.71
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.68
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.67
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.67
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.63
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.63
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.62
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.62
2ect_A78 Ring finger protein 126; metal binding protein, st 98.6
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.57
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.56
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.56
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.54
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.53
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.52
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.48
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.41
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.41
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.35
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.34
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.32
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.27
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.16
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.15
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.1
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.95
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.73
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 97.67
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.61
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.32
2yre_A100 F-box only protein 30; zinc binding, E3 ubiquitin 96.85
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 96.76
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 96.7
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 96.29
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 95.92
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.84
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 94.59
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 94.28
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 92.14
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 90.87
2jne_A101 Hypothetical protein YFGJ; zinc fingers, two zinc, 89.61
1wg2_A64 Zinc finger (AN1-like) family protein; riken struc 88.23
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 87.04
1wfh_A64 Zinc finger (AN1-like) family protein; ZF-AN1 doma 86.3
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 86.28
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 84.05
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 83.81
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 83.75
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 83.65
1z60_A59 TFIIH basal transcription factor complex P44 subun 83.59
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 82.68
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 82.46
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 82.46
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 82.45
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 82.16
1x4u_A84 Zinc finger, FYVE domain containing 27 isoform B; 81.1
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 80.09
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
Probab=99.79  E-value=5.1e-20  Score=140.24  Aligned_cols=105  Identities=22%  Similarity=0.448  Sum_probs=90.6

Q ss_pred             eCCCeeecccccccCCCceeeccCCceeccccccccC----CCCCCCccCc----chhhHHHHHHHH------------h
Q 042263           14 SDQDLFDCPIWYQALKVPVSQSINGHIICSSCLAKVN----NKCPACRSCV----MLRSRVMDIALE------------K   73 (159)
Q Consensus        14 ~~~~~l~C~iC~~~l~~Pv~qC~~GH~~C~~C~~~~~----~~CP~Cr~~~----~~rn~~le~~~~------------~   73 (159)
                      .-.+.|.||||+++|.+|+. ++|||+||..|+.++.    .+||.||.++    ..++.++++++.            .
T Consensus        14 ~~~~~~~C~IC~~~~~~pv~-~~CgH~fC~~Ci~~~~~~~~~~CP~Cr~~~~~~~~~~~~~~~~~i~~l~v~C~n~GC~~   92 (170)
T 3hcs_A           14 PLESKYECPICLMALREAVQ-TPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLH   92 (170)
T ss_dssp             CCCGGGBCTTTCSBCSSEEE-CTTSCEEEHHHHHHHHHHHCSBCTTTCCBCCGGGCEECHHHHHHHHTSEEECCSTTCCC
T ss_pred             CCCCCCCCCCCChhhcCcEE-CCCCCHHHHHHHHHHHHhCCCCCCCCccCcchhhhhhhHHHHHHHhhcccCCCCCCCCc
Confidence            34568999999999999965 7999999999999874    4899999998    246778888777            4


Q ss_pred             hccCCCchhhhccCCCCCCCCCCCCCcceeChhHHHhHhhhhcCCceE
Q 042263           74 TMSFGENKDHERNCQCAPCACPLLDCNFLGSASQLYLYFSWKNGKTFV  121 (159)
Q Consensus        74 ~~~~~~~~~He~~C~~~p~~Cp~~gC~~~g~~~~l~~H~~~~H~~~~~  121 (159)
                      ++++.++++|+++|+|+++.||  +|+|.+.+.+|..|+....+.+.+
T Consensus        93 ~~~~~~l~~H~~~C~~~~v~C~--~C~~~~~r~~l~~H~~~~C~~r~~  138 (170)
T 3hcs_A           93 KMELRHLEDHQAHCEFALMDCP--QCQRPFQKFHINIHILKDCPRRQV  138 (170)
T ss_dssp             EEEGGGHHHHHTTCTTSEEECT--TTCCEEEGGGHHHHHHHTCTTCEE
T ss_pred             eecHhHHHHHHhcCCceeeECC--CCChHHHHHHHHHHhhhhCCCCCe
Confidence            6778899999999999999998  799999999999999877776654



>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2a25_A Ubiquitin ligase SIAH1; protein-peptide complex, ligase; 2.20A {Homo sapiens} PDB: 2an6_A 1k2f_A Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2yre_A F-box only protein 30; zinc binding, E3 ubiquitin ligase, SCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 Back     alignment and structure
>1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Back     alignment and structure
>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 159
d1k2fa_190 b.8.1.2 (A:) SIAH, seven in absentia homolog {Mous 1e-06
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 0.001
>d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]} Length = 190 Back     information, alignment and structure

class: All beta proteins
fold: TRAF domain-like
superfamily: TRAF domain-like
family: SIAH, seven in absentia homolog
domain: SIAH, seven in absentia homolog
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 43.9 bits (103), Expect = 1e-06
 Identities = 19/86 (22%), Positives = 28/86 (32%), Gaps = 4/86 (4%)

Query: 72  EKTMSFGENKDHERNCQCAP--CACPLLDCNFLGSASQLYLYFSW--KNGKTFVSFTYKK 127
           E T+   E  +HE  C+  P  C CP   C + GS   +  +     K+  T        
Sbjct: 14  EITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVF 73

Query: 128 RVKVTLNVNDSVFLFRQQKNGHLFSL 153
                       ++  Q   G  F L
Sbjct: 74  LATDINLPGAVDWVMMQSCFGFHFML 99


>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
d1k2fa_190 SIAH, seven in absentia homolog {Mouse (Mus muscul 99.46
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.28
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.13
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.12
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.05
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.02
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.99
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.81
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.8
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.79
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.79
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.77
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.63
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.61
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.13
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.98
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.8
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 96.82
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 94.0
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.48
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 93.32
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 92.04
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 91.77
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 91.11
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 91.04
d1wfpa_74 Zinc finger A20 and AN1 domains containing protein 90.95
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 90.45
d1wfha_64 Zinc finger A20 and AN1 domains containing protein 85.4
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 85.13
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 83.7
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 83.6
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 83.41
d1wfla_74 Zinc finger A20 domain containing protein 2 {Mouse 82.61
d1wffa_85 ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus 82.52
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 81.58
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 80.83
>d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: TRAF domain-like
superfamily: TRAF domain-like
family: SIAH, seven in absentia homolog
domain: SIAH, seven in absentia homolog
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.46  E-value=4.1e-14  Score=108.39  Aligned_cols=85  Identities=19%  Similarity=0.214  Sum_probs=69.2

Q ss_pred             hhccCCCchhhhccCCCCCCCCCCC--CCcceeChhHHHhHhhhhcCCceEEEEeCcEEEEEE--eCCCcEEEEEEcCCC
Q 042263           73 KTMSFGENKDHERNCQCAPCACPLL--DCNFLGSASQLYLYFSWKNGKTFVSFTYKKRVKVTL--NVNDSVFLFRQQKNG  148 (159)
Q Consensus        73 ~~~~~~~~~~He~~C~~~p~~Cp~~--gC~~~g~~~~l~~H~~~~H~~~~~~~~~~~~~~~~~--~~~~~~~~l~~~~d~  148 (159)
                      ++++|.++.+||++|.|+|+.||.+  +|+|+|..++|..|+..+|++..+.+.++..+....  .++....++++..+|
T Consensus        15 ~~~~~~~~~~HE~~C~~~p~~C~~~~~~C~~~G~~~~l~~Hl~~~H~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~g   94 (190)
T d1k2fa_          15 ITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFG   94 (190)
T ss_dssp             CCCCGGGHHHHHHTCTTSCEECCSSSTTCCCEECHHHHHHHHHHSSCCCEEEESSEEEEEECCTTCTTCCEEEEEEEETT
T ss_pred             EeccccchhhHHhcCCCcccCCCCCCCCCccCCCHhHHHHHHHhcCCcccccCccceEEeeeccccccceeEEEEEecCC
Confidence            5688999999999999999777665  699999999999999999998777666666555433  233557788888999


Q ss_pred             cEEEEEcee
Q 042263          149 HLFSLKNVV  157 (159)
Q Consensus       149 ~lF~l~~~~  157 (159)
                      .+|+|...+
T Consensus        95 ~~F~l~~~~  103 (190)
T d1k2fa_          95 FHFMLVLEK  103 (190)
T ss_dssp             EEEEEEEEE
T ss_pred             CEEEEEEEE
Confidence            999998654



>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure