Citrus Sinensis ID: 042267
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 107 | ||||||
| 342161927 | 364 | RecName: Full=Anthranilate N-methyltrans | 0.943 | 0.277 | 0.544 | 6e-30 | |
| 284437809 | 377 | O-methyltransferase-like protein [Prunus | 0.934 | 0.265 | 0.49 | 3e-27 | |
| 388512375 | 377 | unknown [Lotus japonicus] | 0.934 | 0.265 | 0.5 | 2e-26 | |
| 224068181 | 336 | catechol o-methyltransferase [Populus tr | 0.934 | 0.297 | 0.524 | 6e-25 | |
| 225453644 | 367 | PREDICTED: caffeic acid 3-O-methyltransf | 0.934 | 0.272 | 0.51 | 1e-24 | |
| 147804685 | 395 | hypothetical protein VITISV_001577 [Viti | 0.934 | 0.253 | 0.51 | 1e-24 | |
| 224158666 | 129 | predicted protein [Populus trichocarpa] | 0.934 | 0.775 | 0.514 | 2e-24 | |
| 296089020 | 184 | unnamed protein product [Vitis vinifera] | 0.934 | 0.543 | 0.51 | 2e-24 | |
| 224068173 | 359 | catechol o-methyltransferase [Populus tr | 0.934 | 0.278 | 0.514 | 2e-24 | |
| 268528131 | 356 | caffeic acid O-methyltransferase 3 [Goss | 0.934 | 0.280 | 0.46 | 2e-24 |
| >gi|342161927|sp|A9X7L0.1|ANMT_RUTGR RecName: Full=Anthranilate N-methyltransferase; Short=RgANMT gi|115315700|gb|ABI93949.1| anthranilate N-methyltransferase [Ruta graveolens] | Back alignment and taxonomy information |
|---|
Score = 134 bits (338), Expect = 6e-30, Method: Compositional matrix adjust.
Identities = 55/101 (54%), Positives = 81/101 (80%)
Query: 7 ILQWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLI 66
+++W+LH +DDE C++IL+NCYKA P +GKV+V+NS +PE P+ + ++R++ +LD + +
Sbjct: 264 LMKWILHCWDDEQCLRILKNCYKATPENGKVIVMNSVVPETPEVSSSARETSLLDVLLMT 323
Query: 67 QIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 107
+ GRERT+KEFT LAI AGFKGINF C VCN ++MEF+K
Sbjct: 324 RDGGGRERTQKEFTELAIGAGFKGINFACCVCNLHIMEFFK 364
|
Source: Ruta graveolens Species: Ruta graveolens Genus: Ruta Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|284437809|gb|ADB85561.1| O-methyltransferase-like protein [Prunus mume] | Back alignment and taxonomy information |
|---|
| >gi|388512375|gb|AFK44249.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|224068181|ref|XP_002302677.1| catechol o-methyltransferase [Populus trichocarpa] gi|222844403|gb|EEE81950.1| catechol o-methyltransferase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225453644|ref|XP_002267952.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147804685|emb|CAN69189.1| hypothetical protein VITISV_001577 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224158666|ref|XP_002337998.1| predicted protein [Populus trichocarpa] gi|222870203|gb|EEF07334.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|296089020|emb|CBI38723.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224068173|ref|XP_002302676.1| catechol o-methyltransferase [Populus trichocarpa] gi|222844402|gb|EEE81949.1| catechol o-methyltransferase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|268528131|gb|ACZ06242.1| caffeic acid O-methyltransferase 3 [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 107 | ||||||
| TAIR|locus:2153423 | 363 | OMT1 "AT5G54160" [Arabidopsis | 0.934 | 0.275 | 0.44 | 4.9e-21 | |
| TAIR|locus:2038026 | 352 | AT1G33030 [Arabidopsis thalian | 0.925 | 0.281 | 0.445 | 2.7e-20 | |
| UNIPROTKB|Q84N28 | 360 | OMT1 "Flavone O-methyltransfer | 0.943 | 0.280 | 0.425 | 1.7e-18 | |
| UNIPROTKB|Q6ZD89 | 368 | ROMT-9 "Flavone 3'-O-methyltra | 0.943 | 0.274 | 0.415 | 2e-18 | |
| UNIPROTKB|A8QW52 | 376 | EOMT "Eugenol O-methyltransfer | 0.943 | 0.268 | 0.446 | 4e-17 | |
| TAIR|locus:2030081 | 367 | IGMT5 "indole glucosinolate O- | 0.943 | 0.275 | 0.392 | 6e-17 | |
| UNIPROTKB|P93324 | 372 | P93324 "Isoliquiritigenin 2'-O | 0.934 | 0.268 | 0.431 | 1.4e-16 | |
| TAIR|locus:2199597 | 373 | IGMT3 "indole glucosinolate O- | 0.943 | 0.270 | 0.382 | 1.4e-16 | |
| TAIR|locus:2199607 | 373 | IGMT1 "indole glucosinolate O- | 0.943 | 0.270 | 0.382 | 1.8e-16 | |
| TAIR|locus:2199582 | 373 | IGMT4 "indole glucosinolate O- | 0.943 | 0.270 | 0.382 | 2.4e-16 |
| TAIR|locus:2153423 OMT1 "AT5G54160" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 247 (92.0 bits), Expect = 4.9e-21, P = 4.9e-21
Identities = 44/100 (44%), Positives = 67/100 (67%)
Query: 8 LQWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQ 67
++W+ H++ DE+C+K L+NCY++LP DGKV++ LPE PDS+ +++ +D I L
Sbjct: 262 MKWICHDWSDEHCVKFLKNCYESLPEDGKVILAECILPETPDSSLSTKQVVHVDCIMLAH 321
Query: 68 IPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 107
P G+ERT+KEF ALA +GFKGI C+ ++E K
Sbjct: 322 NPGGKERTEKEFEALAKASGFKGIKVVCDAFGVNLIELLK 361
|
|
| TAIR|locus:2038026 AT1G33030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q84N28 OMT1 "Flavone O-methyltransferase 1" [Triticum aestivum (taxid:4565)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6ZD89 ROMT-9 "Flavone 3'-O-methyltransferase 1" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8QW52 EOMT "Eugenol O-methyltransferase" [Sorghum bicolor (taxid:4558)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2030081 IGMT5 "indole glucosinolate O-methyltransferase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P93324 P93324 "Isoliquiritigenin 2'-O-methyltransferase" [Medicago sativa (taxid:3879)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199597 IGMT3 "indole glucosinolate O-methyltransferase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199607 IGMT1 "indole glucosinolate O-methyltransferase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199582 IGMT4 "indole glucosinolate O-methyltransferase 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 107 | |||
| pfam00891 | 239 | pfam00891, Methyltransf_2, O-methyltransferase | 1e-27 |
| >gnl|CDD|216177 pfam00891, Methyltransf_2, O-methyltransferase | Back alignment and domain information |
|---|
Score = 100 bits (251), Expect = 1e-27
Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 2/77 (2%)
Query: 7 ILQWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLI 66
+L+W+LH++ DE+C+KIL+ CY+ALP GKV+V+ LPE PD + +LD L+
Sbjct: 164 LLKWVLHDWSDEDCVKILKRCYEALPPGGKVIVVEMVLPEDPDDDLETEV-LLLDLNMLV 222
Query: 67 QIPHGRERTKKEFTALA 83
G+ERT+KE+ L
Sbjct: 223 LNG-GKERTEKEWRKLL 238
|
This family includes a range of O-methyltransferases. These enzymes utilise S-adenosyl methionine. Length = 239 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| KOG3178 | 342 | consensus Hydroxyindole-O-methyltransferase and re | 99.91 | |
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 99.85 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 99.61 | |
| PF05891 | 218 | Methyltransf_PK: AdoMet dependent proline di-methy | 99.4 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 99.23 | |
| PLN02232 | 160 | ubiquinone biosynthesis methyltransferase | 99.22 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 99.21 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 99.16 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 99.13 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 99.12 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 99.1 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 99.09 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 99.07 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 99.05 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 99.03 | |
| PF06080 | 204 | DUF938: Protein of unknown function (DUF938); Inte | 99.02 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 99.01 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 98.98 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 98.97 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 98.91 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 98.9 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 98.88 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 98.78 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 98.72 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 98.7 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 98.66 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 98.64 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 98.61 | |
| KOG1540 | 296 | consensus Ubiquinone biosynthesis methyltransferas | 98.6 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 98.59 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 98.58 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 98.51 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 98.48 | |
| PF08003 | 315 | Methyltransf_9: Protein of unknown function (DUF16 | 98.43 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 98.42 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 98.4 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 98.33 | |
| PRK04266 | 226 | fibrillarin; Provisional | 98.32 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 98.31 | |
| KOG4300 | 252 | consensus Predicted methyltransferase [General fun | 98.31 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 98.24 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 98.22 | |
| KOG2361 | 264 | consensus Predicted methyltransferase [General fun | 98.19 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 98.17 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 98.15 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 98.14 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 98.12 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 98.09 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 98.09 | |
| PF04672 | 267 | Methyltransf_19: S-adenosyl methyltransferase; Int | 98.08 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 98.06 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 98.06 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 98.04 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 98.02 | |
| PRK10611 | 287 | chemotaxis methyltransferase CheR; Provisional | 98.02 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 97.99 | |
| PF12147 | 311 | Methyltransf_20: Putative methyltransferase; Inter | 97.98 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 97.96 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 97.92 | |
| PF05219 | 265 | DREV: DREV methyltransferase; InterPro: IPR007884 | 97.91 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 97.91 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 97.91 | |
| PF01739 | 196 | CheR: CheR methyltransferase, SAM binding domain; | 97.89 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 97.87 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 97.84 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 97.72 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 97.72 | |
| PF11968 | 219 | DUF3321: Putative methyltransferase (DUF3321); Int | 97.71 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 97.63 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 97.52 | |
| PF06859 | 110 | Bin3: Bicoid-interacting protein 3 (Bin3); InterPr | 97.5 | |
| KOG1270 | 282 | consensus Methyltransferases [Coenzyme transport a | 97.48 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 97.43 | |
| COG1352 | 268 | CheR Methylase of chemotaxis methyl-accepting prot | 97.4 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 97.39 | |
| PF05148 | 219 | Methyltransf_8: Hypothetical methyltransferase; In | 97.34 | |
| KOG3045 | 325 | consensus Predicted RNA methylase involved in rRNA | 97.31 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 97.29 | |
| PF01234 | 256 | NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I | 97.12 | |
| PF07942 | 270 | N2227: N2227-like protein; InterPro: IPR012901 Thi | 97.12 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 97.09 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 97.09 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 97.09 | |
| COG4627 | 185 | Uncharacterized protein conserved in bacteria [Fun | 97.05 | |
| COG4798 | 238 | Predicted methyltransferase [General function pred | 97.03 | |
| PF05724 | 218 | TPMT: Thiopurine S-methyltransferase (TPMT); Inter | 97.01 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 96.99 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 96.94 | |
| PRK13256 | 226 | thiopurine S-methyltransferase; Reviewed | 96.88 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 96.78 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 96.71 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 96.69 | |
| PF03291 | 331 | Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 | 96.66 | |
| KOG2899 | 288 | consensus Predicted methyltransferase [General fun | 96.6 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 96.38 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 96.09 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 96.02 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 95.9 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 95.9 | |
| TIGR03439 | 319 | methyl_EasF probable methyltransferase domain, Eas | 95.73 | |
| KOG1975 | 389 | consensus mRNA cap methyltransferase [RNA processi | 95.68 | |
| KOG2798 | 369 | consensus Putative trehalase [Carbohydrate transpo | 95.61 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 95.48 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 95.46 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 94.95 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 94.73 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 94.52 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 94.4 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 94.36 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 94.31 | |
| PF11899 | 380 | DUF3419: Protein of unknown function (DUF3419); In | 94.3 | |
| TIGR00027 | 260 | mthyl_TIGR00027 methyltransferase, putative, TIGR0 | 94.23 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 94.23 | |
| KOG1331 | 293 | consensus Predicted methyltransferase [General fun | 94.16 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 94.15 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 94.05 | |
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 93.86 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 93.78 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 93.73 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 93.67 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 93.46 | |
| KOG3987 | 288 | consensus Uncharacterized conserved protein DREV/C | 92.95 | |
| PF10294 | 173 | Methyltransf_16: Putative methyltransferase; Inter | 92.9 | |
| cd01842 | 183 | SGNH_hydrolase_like_5 SGNH_hydrolase subfamily. SG | 92.88 | |
| COG3315 | 297 | O-Methyltransferase involved in polyketide biosynt | 92.87 | |
| KOG3010 | 261 | consensus Methyltransferase [General function pred | 92.72 | |
| PLN02366 | 308 | spermidine synthase | 92.41 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 92.29 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 92.29 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 92.27 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 92.05 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 91.74 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 91.54 | |
| COG3963 | 194 | Phospholipid N-methyltransferase [Lipid metabolism | 91.37 | |
| COG0500 | 257 | SmtA SAM-dependent methyltransferases [Secondary m | 91.11 | |
| PF09243 | 274 | Rsm22: Mitochondrial small ribosomal subunit Rsm22 | 91.1 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 90.58 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 90.58 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 90.54 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 90.39 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 90.29 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 90.18 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 89.93 | |
| COG4301 | 321 | Uncharacterized conserved protein [Function unknow | 89.62 | |
| KOG2539 | 491 | consensus Mitochondrial/chloroplast ribosome small | 89.59 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 89.54 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 89.35 | |
| PF03059 | 276 | NAS: Nicotianamine synthase protein; InterPro: IPR | 88.88 | |
| TIGR00006 | 305 | S-adenosyl-methyltransferase MraW. Genetics paper | 88.43 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 88.42 | |
| PF08123 | 205 | DOT1: Histone methylation protein DOT1 ; InterPro: | 88.1 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 88.0 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 87.73 | |
| PF03269 | 177 | DUF268: Caenorhabditis protein of unknown function | 87.68 | |
| COG0275 | 314 | Predicted S-adenosylmethionine-dependent methyltra | 87.59 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 87.43 | |
| COG5459 | 484 | Predicted rRNA methylase [Translation, ribosomal s | 87.1 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 86.95 | |
| PRK00050 | 296 | 16S rRNA m(4)C1402 methyltranserfase; Provisional | 86.91 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 86.9 | |
| PRK00536 | 262 | speE spermidine synthase; Provisional | 85.74 | |
| PF10354 | 166 | DUF2431: Domain of unknown function (DUF2431); Int | 85.68 | |
| PF08845 | 57 | SymE_toxin: Toxin SymE, type I toxin-antitoxin sys | 84.67 | |
| PF10017 | 127 | Methyltransf_33: Histidine-specific methyltransfer | 84.31 | |
| KOG1269 | 364 | consensus SAM-dependent methyltransferases [Lipid | 83.91 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 83.47 | |
| COG2521 | 287 | Predicted archaeal methyltransferase [General func | 83.19 | |
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 83.05 | |
| PF01795 | 310 | Methyltransf_5: MraW methylase family; InterPro: I | 82.71 | |
| KOG2940 | 325 | consensus Predicted methyltransferase [General fun | 82.45 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 81.76 | |
| PF08468 | 155 | MTS_N: Methyltransferase small domain N-terminal; | 81.54 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 81.52 | |
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 80.54 | |
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 80.51 |
| >KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.91 E-value=6e-24 Score=146.39 Aligned_cols=106 Identities=37% Similarity=0.606 Sum_probs=92.6
Q ss_pred ceeEEEecccccCCChHHHHHHHHHHHhhCCCCCEEEEEeeeCCCCCCCch-hhhhhhhhcHHHHhhCCCceecCHHHHH
Q 042267 2 QVYLSILQWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTE-ASRDSFILDAIFLIQIPHGRERTKKEFT 80 (107)
Q Consensus 2 ~~D~v~~~~vlh~~~d~~~~~iL~~~~~aL~pgg~l~i~e~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~g~~rt~~e~~ 80 (107)
..|+||++||||||+|++|+++|+||+++|+|||+|+++|.+.|+....+. ........|+.|+..+++|++|+.+||+
T Consensus 236 ~~daI~mkWiLhdwtDedcvkiLknC~~sL~~~GkIiv~E~V~p~e~~~dd~~s~v~~~~d~lm~~~~~~Gkert~~e~q 315 (342)
T KOG3178|consen 236 KGDAIWMKWILHDWTDEDCVKILKNCKKSLPPGGKIIVVENVTPEEDKFDDIDSSVTRDMDLLMLTQTSGGKERTLKEFQ 315 (342)
T ss_pred CcCeEEEEeecccCChHHHHHHHHHHHHhCCCCCEEEEEeccCCCCCCccccccceeehhHHHHHHHhccceeccHHHHH
Confidence 468999999999999999999999999999999999999998886332211 2233456889998888789999999999
Q ss_pred HHHHHcCCCceEEEEcCCceeEEEEEC
Q 042267 81 ALAIEAGFKGINFECNVCNSYVMEFYK 107 (107)
Q Consensus 81 ~ll~~aGf~~~~~~~~~~~~~vi~~~~ 107 (107)
.++.++||.+.++...+...++||++|
T Consensus 316 ~l~~~~gF~~~~~~~~~~~~~~Ie~~k 342 (342)
T KOG3178|consen 316 ALLPEEGFPVCMVALTAYSYSVIEFHK 342 (342)
T ss_pred hcchhhcCceeEEEeccCccchheeCC
Confidence 999999999999999999999999987
|
|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >PLN02232 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >KOG4300 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG2361 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >PRK10611 chemotaxis methyltransferase CheR; Provisional | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) | Back alignment and domain information |
|---|
| >KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases | Back alignment and domain information |
|---|
| >KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4627 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG4798 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PRK13256 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes | Back alignment and domain information |
|---|
| >KOG2899 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >TIGR03439 methyl_EasF probable methyltransferase domain, EasF family | Back alignment and domain information |
|---|
| >KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >TIGR00027 mthyl_TIGR00027 methyltransferase, putative, TIGR00027 family | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >KOG1331 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] | Back alignment and domain information |
|---|
| >PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases | Back alignment and domain information |
|---|
| >cd01842 SGNH_hydrolase_like_5 SGNH_hydrolase subfamily | Back alignment and domain information |
|---|
| >COG3315 O-Methyltransferase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG3010 consensus Methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >COG3963 Phospholipid N-methyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >COG4301 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2539 consensus Mitochondrial/chloroplast ribosome small subunit component [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 | Back alignment and domain information |
|---|
| >TIGR00006 S-adenosyl-methyltransferase MraW | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species | Back alignment and domain information |
|---|
| >COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PRK00536 speE spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known | Back alignment and domain information |
|---|
| >PF08845 SymE_toxin: Toxin SymE, type I toxin-antitoxin system; InterPro: IPR014944 This entry represents a SOS-induced gene whose product shows homology to the antitoxin MazE (SymE), the coding region contains a cis-encoded antisense RNA | Back alignment and domain information |
|---|
| >PF10017 Methyltransf_33: Histidine-specific methyltransferase, SAM-dependent; InterPro: IPR019257 This domain is found in methyltransferases and various hypothetical proteins | Back alignment and domain information |
|---|
| >KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2521 Predicted archaeal methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria | Back alignment and domain information |
|---|
| >KOG2940 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF08468 MTS_N: Methyltransferase small domain N-terminal; InterPro: IPR013675 This domain is found to the N terminus of the methyltransferase small domain (IPR007848 from INTERPRO) in bacterial proteins [] | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 107 | ||||
| 1kyw_A | 365 | Crystal Structure Analysis Of Caffeic Acid5-Hydroxy | 9e-26 | ||
| 3reo_A | 368 | Monolignol O-Methyltransferase (Momt) Length = 368 | 2e-23 | ||
| 3p9c_A | 364 | Crystal Structure Of Perennial Ryegrass Lpomt1 Boun | 2e-20 | ||
| 1fp1_D | 372 | Crystal Structure Analysis Of Chalcone O-Methyltran | 1e-17 | ||
| 1fpq_A | 372 | Crystal Structure Analysis Of Selenomethionine Subs | 1e-16 | ||
| 1zgj_A | 354 | Crystal Structure Of Isoflavanone 4'-O-Methyltransf | 9e-10 | ||
| 1zga_A | 357 | Crystal Structure Of Isoflavanone 4'-o-methyltransf | 9e-10 | ||
| 1zg3_A | 358 | Crystal Structure Of The Isoflavanone 4'-O-Methyltr | 9e-10 | ||
| 2qyo_A | 357 | Crystal Structure Of Isoflavone O-Methyltransferase | 2e-09 | ||
| 1fp2_A | 352 | Crystal Structure Analysis Of Isoflavone O-Methyltr | 2e-09 | ||
| 3lst_A | 348 | Crystal Structure Of Calo1, Methyltransferase In Ca | 4e-09 | ||
| 1fpx_A | 352 | Crystal Structure Analysis Of Selenomethionine Subs | 6e-09 | ||
| 3gwz_A | 369 | Structure Of The Mitomycin 7-O-Methyltransferase Mm | 1e-04 | ||
| 2ip2_A | 334 | Structure Of The Pyocyanin Biosynthetic Protein Phz | 2e-04 | ||
| 1qzz_A | 374 | Crystal Structure Of Aclacinomycin-10-Hydroxylase ( | 3e-04 | ||
| 1xds_A | 374 | Crystal Structure Of Aclacinomycin-10-Hydroxylase ( | 5e-04 |
| >pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde Length = 365 | Back alignment and structure |
|
| >pdb|3REO|A Chain A, Monolignol O-Methyltransferase (Momt) Length = 368 | Back alignment and structure |
| >pdb|3P9C|A Chain A, Crystal Structure Of Perennial Ryegrass Lpomt1 Bound To Sah Length = 364 | Back alignment and structure |
| >pdb|1FP1|D Chain D, Crystal Structure Analysis Of Chalcone O-Methyltransferase Length = 372 | Back alignment and structure |
| >pdb|1FPQ|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Chalcone O- Methyltransferase Length = 372 | Back alignment and structure |
| >pdb|1ZGJ|A Chain A, Crystal Structure Of Isoflavanone 4'-O-Methyltransferase Complexed With (+)-Pisatin Length = 354 | Back alignment and structure |
| >pdb|1ZGA|A Chain A, Crystal Structure Of Isoflavanone 4'-o-methyltransferase Complexed With (+)-6a-hydroxymaackiain Length = 357 | Back alignment and structure |
| >pdb|1ZG3|A Chain A, Crystal Structure Of The Isoflavanone 4'-O-Methyltransferase Complexed With Sah And 2,7,4'-Trihydroxyisoflavanone Length = 358 | Back alignment and structure |
| >pdb|2QYO|A Chain A, Crystal Structure Of Isoflavone O-Methyltransferase Homolog In Complex With Biochanin A And Sah Length = 357 | Back alignment and structure |
| >pdb|1FP2|A Chain A, Crystal Structure Analysis Of Isoflavone O-Methyltransferase Length = 352 | Back alignment and structure |
| >pdb|3LST|A Chain A, Crystal Structure Of Calo1, Methyltransferase In Calicheamicin Biosynthesis, Sah Bound Form Length = 348 | Back alignment and structure |
| >pdb|1FPX|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Isoflavone O-Methyltransferase Length = 352 | Back alignment and structure |
| >pdb|3GWZ|A Chain A, Structure Of The Mitomycin 7-O-Methyltransferase Mmcr Length = 369 | Back alignment and structure |
| >pdb|2IP2|A Chain A, Structure Of The Pyocyanin Biosynthetic Protein Phzm Length = 334 | Back alignment and structure |
| >pdb|1QZZ|A Chain A, Crystal Structure Of Aclacinomycin-10-Hydroxylase (Rdmb) In Complex With S-Adensyl-L-Methionine (Sam) Length = 374 | Back alignment and structure |
| >pdb|1XDS|A Chain A, Crystal Structure Of Aclacinomycin-10-Hydroxylase (Rdmb) In Complex With S-Adenosyl-L-Methionine (Sam) And 11-Deoxy- Beta-Rhodomycin (Dbra) Length = 374 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 107 | |||
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 6e-39 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 2e-38 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 4e-37 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 3e-32 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 2e-31 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 3e-31 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 2e-30 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 5e-30 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 2e-29 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 2e-27 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 2e-27 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 3e-27 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 1e-26 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 2e-25 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 1e-22 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 1e-04 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 3e-04 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 5e-04 |
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 | Back alignment and structure |
|---|
Score = 132 bits (333), Expect = 6e-39
Identities = 41/101 (40%), Positives = 65/101 (64%)
Query: 7 ILQWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLI 66
+++W+LH++ D++C +L+NCY ALP GKV+++ LP P++ +S+ F +D I L
Sbjct: 264 LMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLA 323
Query: 67 QIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 107
P GRER ++EF ALA AGF G+ N++ +EF K
Sbjct: 324 HNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK 364
|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 1kyz_A* 1kyw_A* Length = 368 | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Length = 369 | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Length = 352 | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Length = 358 | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Length = 374 | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Length = 334 | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Length = 348 | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Length = 360 | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Length = 335 | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Length = 332 | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Length = 352 | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Length = 363 | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 99.95 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 99.9 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 99.89 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 99.86 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 99.85 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 99.85 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 99.84 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 99.84 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 99.82 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 99.82 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 99.8 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 99.8 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 99.77 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 99.76 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 99.74 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 99.72 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 99.42 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 99.39 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 99.29 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 99.21 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 99.19 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 99.19 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 99.19 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 99.18 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 99.18 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 99.16 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 99.15 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 99.14 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 99.14 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 99.14 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 99.11 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 99.1 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 99.1 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 99.09 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 99.09 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 99.09 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 99.08 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 99.08 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 99.07 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 99.06 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 99.05 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 99.05 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 99.04 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 99.01 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 99.0 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 99.0 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 98.98 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 98.98 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 98.97 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 98.96 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 98.95 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 98.95 | |
| 2ld4_A | 176 | Anamorsin; methyltransferase-like fold, alpha/beta | 98.94 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 98.92 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 98.89 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 98.89 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 98.87 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 98.87 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 98.86 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 98.85 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 98.84 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 98.83 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 98.83 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 98.81 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 98.8 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 98.8 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 98.78 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 98.77 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 98.77 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 98.76 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 98.75 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 98.75 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 98.72 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 98.71 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 98.7 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 98.7 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 98.7 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 98.67 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 98.65 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 98.64 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 98.57 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 98.52 | |
| 3giw_A | 277 | Protein of unknown function DUF574; rossmann-fold | 98.52 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 98.46 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 98.46 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 98.45 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 98.44 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 98.3 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 98.27 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 98.25 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 98.07 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 98.06 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 98.05 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 98.03 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 97.91 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 97.85 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 97.82 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 97.82 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 97.81 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 97.81 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 97.79 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 97.78 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 97.78 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 97.78 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 97.77 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 97.74 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 97.65 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 97.58 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 97.58 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 97.57 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 97.51 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 97.51 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 97.48 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 97.47 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 97.38 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 97.37 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 97.33 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 97.33 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 97.27 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 97.25 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 97.25 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 97.18 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 97.16 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 97.09 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 97.07 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 97.05 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 97.05 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 97.03 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 97.02 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 97.01 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 96.96 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 96.96 | |
| 3b5i_A | 374 | S-adenosyl-L-methionine:salicylic acid carboxyl me | 96.93 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 96.89 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 96.79 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 96.75 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 96.72 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 96.68 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 96.63 | |
| 3sso_A | 419 | Methyltransferase; macrolide, natural product, ros | 96.6 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 96.59 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 96.57 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 96.57 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 96.48 | |
| 1rjd_A | 334 | PPM1P, carboxy methyl transferase for protein phos | 96.47 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 96.42 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 96.39 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 96.39 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 96.34 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 96.29 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 96.28 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 96.23 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 96.21 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 96.18 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 96.16 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 96.16 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 96.13 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 96.09 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 96.08 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 96.06 | |
| 2xyq_A | 290 | Putative 2'-O-methyl transferase; transferase-vira | 95.97 | |
| 1m6e_X | 359 | S-adenosyl-L-methionnine:salicylic acid carboxyl m | 95.93 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 95.91 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 95.78 | |
| 2efj_A | 384 | 3,7-dimethylxanthine methyltransferase; SAM-depend | 95.73 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 95.63 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 95.59 | |
| 3iei_A | 334 | Leucine carboxyl methyltransferase 1; LCMT-1, S-ad | 95.59 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 95.57 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 95.49 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 95.36 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 95.3 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 95.22 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 95.18 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 95.17 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 95.15 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 95.14 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 95.07 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 95.05 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 95.04 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 95.01 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 94.98 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 94.97 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 94.96 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 94.96 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 94.93 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 94.89 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 94.81 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 94.81 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 94.8 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 94.79 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 94.76 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 94.74 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 94.7 | |
| 2zwa_A | 695 | Leucine carboxyl methyltransferase 2; HET: SAH CIT | 94.62 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 94.6 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 94.59 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 94.58 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 94.57 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 94.51 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 94.48 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 94.45 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 94.4 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 94.39 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 94.36 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 94.26 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 94.24 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 94.15 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 94.12 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 94.07 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 93.99 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 93.98 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 93.89 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 93.79 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 93.76 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 93.71 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 93.68 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 93.55 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 93.53 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 93.45 | |
| 2qy6_A | 257 | UPF0209 protein YFCK; structural genomics, unknown | 93.35 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 93.25 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 93.2 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 93.16 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 93.04 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 92.96 | |
| 2uyo_A | 310 | Hypothetical protein ML2640; putative methyltransf | 92.78 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 92.71 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 92.39 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 92.01 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 91.89 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 91.5 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 91.48 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 91.41 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 90.76 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 90.34 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 89.74 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 89.16 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 88.93 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 88.82 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 88.78 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 88.61 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 88.44 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 88.22 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 87.92 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 86.56 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 86.21 | |
| 2km1_A | 136 | Protein DRE2; yeast, antiapoptotic, protein bindin | 84.57 | |
| 1wg8_A | 285 | Predicted S-adenosylmethionine-dependent methyltra | 84.52 | |
| 3tka_A | 347 | Ribosomal RNA small subunit methyltransferase H; H | 84.29 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 84.17 | |
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 83.35 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 83.3 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 82.82 | |
| 3evf_A | 277 | RNA-directed RNA polymerase NS5; NS5 methyltransfe | 80.37 |
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
Probab=99.95 E-value=1.6e-27 Score=165.85 Aligned_cols=102 Identities=27% Similarity=0.389 Sum_probs=92.6
Q ss_pred ceeEEEecccccCCChHHHHHHHHHHHhhCCCCCEEEEEeeeCCCCCCCchhhhhhhhhcHHHHhhCCCceecCHHHHHH
Q 042267 2 QVYLSILQWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTA 81 (107)
Q Consensus 2 ~~D~v~~~~vlh~~~d~~~~~iL~~~~~aL~pgg~l~i~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~rt~~e~~~ 81 (107)
++|+|+++++||+|+|+++.++|++++++|+|||+++|+|.+.++++..+. ....+|+.|++.. +|++||.+||++
T Consensus 244 ~~D~~~~~~vlh~~~d~~~~~iL~~~~~al~pgg~lli~e~~~~~~~~~~~---~~~~~dl~ml~~~-~g~ert~~e~~~ 319 (353)
T 4a6d_A 244 EADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPL---LTQLYSLNMLVQT-EGQERTPTHYHM 319 (353)
T ss_dssp CCSEEEEESSGGGSCHHHHHHHHHHHHHHCCTTCEEEEEECCCCTTSCCCH---HHHHHHHHHHHSS-SCCCCCHHHHHH
T ss_pred CceEEEeeeecccCCHHHHHHHHHHHHhhCCCCCEEEEEEeeeCCCCCCCH---HHHHHHHHHHHhC-CCcCCCHHHHHH
Confidence 589999999999999999999999999999999999999999987655432 3356899998865 999999999999
Q ss_pred HHHHcCCCceEEEEcCCceeEEEEEC
Q 042267 82 LAIEAGFKGINFECNVCNSYVMEFYK 107 (107)
Q Consensus 82 ll~~aGf~~~~~~~~~~~~~vi~~~~ 107 (107)
||++|||+.+++.++++..++|+++|
T Consensus 320 ll~~AGf~~v~v~~~~~~~~~i~ArK 345 (353)
T 4a6d_A 320 LLSSAGFRDFQFKKTGAIYDAILARK 345 (353)
T ss_dssp HHHHHTCEEEEEECCSSSCEEEEEEC
T ss_pred HHHHCCCceEEEEEcCCceEEEEEEe
Confidence 99999999999999999999999998
|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* | Back alignment and structure |
|---|
| >1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3iei_A Leucine carboxyl methyltransferase 1; LCMT-1, S-adenosyl-L-methionine; HET: SAH MES; 1.90A {Homo sapiens} PDB: 3p71_T* 3mnt_A* 3o7w_A* | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2km1_A Protein DRE2; yeast, antiapoptotic, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 | Back alignment and structure |
|---|
| >3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 107 | ||||
| d1fp1d2 | 244 | c.66.1.12 (D:129-372) Chalcone O-methyltransferase | 2e-25 | |
| d1kyza2 | 243 | c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferuli | 8e-23 | |
| d1fp2a2 | 244 | c.66.1.12 (A:109-352) Isoflavone O-methyltransfera | 7e-19 | |
| d1qzza2 | 256 | c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase | 3e-10 | |
| d1tw3a2 | 253 | c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransf | 6e-09 | |
| d1xxla_ | 234 | c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus | 2e-05 | |
| d1vl5a_ | 231 | c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill | 0.001 |
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Plant O-methyltransferase, C-terminal domain domain: Chalcone O-methyltransferase species: Alfalfa (Medicago sativa) [TaxId: 3879]
Score = 93.3 bits (231), Expect = 2e-25
Identities = 43/102 (42%), Positives = 62/102 (60%), Gaps = 2/102 (1%)
Query: 7 ILQWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLI 66
IL+ + HN+ DE CI+ L NC+KAL +GKV+++ LPE P+++E S+ LD +
Sbjct: 144 ILKAVCHNWSDEKCIEFLSNCHKALSPNGKVIIVEFILPEEPNTSEESKLVSTLD-NLMF 202
Query: 67 QIPHGRERTKKEFTALAIEAGFKGINFECNVCNSY-VMEFYK 107
GRERT+K++ L+ +GF C NS VMEFYK
Sbjct: 203 ITVGGRERTEKQYEKLSKLSGFSKFQVACRAFNSLGVMEFYK 244
|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 243 | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 256 | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Length = 253 | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| d1fp1d2 | 244 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 99.96 | |
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 99.95 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 99.93 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 99.9 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 99.87 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 99.41 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 99.39 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 99.32 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 99.22 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 99.16 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 99.07 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 99.04 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 98.92 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 98.86 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 98.84 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 98.83 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 98.77 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 98.65 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 98.64 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 98.63 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 98.6 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 98.58 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 98.45 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 98.44 | |
| d1af7a2 | 193 | Chemotaxis receptor methyltransferase CheR, C-term | 98.39 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 98.28 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 98.14 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 97.82 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 97.8 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 97.73 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 97.72 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 97.43 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 97.35 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 97.34 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 97.21 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 96.96 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 96.92 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 96.63 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 96.45 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 96.13 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 96.09 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 95.24 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 95.11 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 94.47 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 94.3 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 94.2 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 94.18 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 94.11 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 92.85 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 92.06 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 92.02 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 91.41 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 90.17 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 89.7 | |
| d2uyoa1 | 297 | Putative methyltransferase ML2640 {Mycobacterium l | 89.66 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 89.45 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 87.15 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 86.91 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 86.75 | |
| d1rjda_ | 328 | Leucine carboxy methyltransferase Ppm1 {Baker's ye | 85.24 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 84.99 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 83.15 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 82.99 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 82.73 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 82.08 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 81.72 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 81.33 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 81.32 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 81.22 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 80.66 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 80.41 |
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Plant O-methyltransferase, C-terminal domain domain: Chalcone O-methyltransferase species: Alfalfa (Medicago sativa) [TaxId: 3879]
Probab=99.96 E-value=4.2e-29 Score=165.00 Aligned_cols=105 Identities=41% Similarity=0.692 Sum_probs=92.4
Q ss_pred ceeEEEecccccCCChHHHHHHHHHHHhhCCCCCEEEEEeeeCCCCCCCchhhhhhhhhcHHHHhhCCCceecCHHHHHH
Q 042267 2 QVYLSILQWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTA 81 (107)
Q Consensus 2 ~~D~v~~~~vlh~~~d~~~~~iL~~~~~aL~pgg~l~i~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~rt~~e~~~ 81 (107)
++|+|+++++||+|+|++|.++|++++++|+|||+++|+|.+.|+.+..+...+....+|+.|++.. +|++||.+||++
T Consensus 139 ~~D~~~l~~vLh~~~de~~~~iL~~~~~aL~pgg~llI~e~v~~~~~~~~~~~~~~~~~d~~m~~~~-~g~ert~~e~~~ 217 (244)
T d1fp1d2 139 QGDAMILKAVCHNWSDEKCIEFLSNCHKALSPNGKVIIVEFILPEEPNTSEESKLVSTLDNLMFITV-GGRERTEKQYEK 217 (244)
T ss_dssp CEEEEEEESSGGGSCHHHHHHHHHHHHHHEEEEEEEEEEEEEECSSCCSSHHHHHHHHHHHHHHHHH-SCCCEEHHHHHH
T ss_pred cceEEEEehhhhhCCHHHHHHHHHHHHHHcCCCcEEEEEEEEecCCCCCchHHHHHHHHHHHHHhhC-CCcCCCHHHHHH
Confidence 5799999999999999999999999999999999999999999877655443344556788888765 899999999999
Q ss_pred HHHHcCCCceEEEEc-CCceeEEEEEC
Q 042267 82 LAIEAGFKGINFECN-VCNSYVMEFYK 107 (107)
Q Consensus 82 ll~~aGf~~~~~~~~-~~~~~vi~~~~ 107 (107)
||++|||+.+++.+. .+..+|||++|
T Consensus 218 ll~~AGF~~v~v~~~~~~~~~viE~~K 244 (244)
T d1fp1d2 218 LSKLSGFSKFQVACRAFNSLGVMEFYK 244 (244)
T ss_dssp HHHHTTCSEEEEEEEETTTEEEEEEEC
T ss_pred HHHHcCCCceEEEecCCCCEEEEEEeC
Confidence 999999999998755 57889999998
|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1rjda_ c.66.1.37 (A:) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|