Citrus Sinensis ID: 042413
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 350 | ||||||
| 147766035 | 902 | hypothetical protein VITISV_038742 [Viti | 0.9 | 0.349 | 0.264 | 3e-25 | |
| 356577907 | 921 | PREDICTED: disease resistance protein RP | 0.905 | 0.344 | 0.277 | 4e-25 | |
| 359489156 | 899 | PREDICTED: probable disease resistance p | 0.897 | 0.349 | 0.303 | 1e-24 | |
| 359489148 | 897 | PREDICTED: probable disease resistance R | 0.942 | 0.367 | 0.294 | 1e-24 | |
| 297744337 | 591 | unnamed protein product [Vitis vinifera] | 0.874 | 0.517 | 0.274 | 1e-24 | |
| 359496848 | 856 | PREDICTED: disease resistance RPP8-like | 0.657 | 0.268 | 0.296 | 2e-23 | |
| 359491404 | 922 | PREDICTED: probable disease resistance R | 0.885 | 0.336 | 0.272 | 2e-23 | |
| 351727228 | 920 | disease resistance protein [Glycine max] | 0.905 | 0.344 | 0.267 | 3e-23 | |
| 222640579 | 854 | hypothetical protein OsJ_27368 [Oryza sa | 0.902 | 0.370 | 0.254 | 8e-23 | |
| 115476476 | 907 | Os08g0424700 [Oryza sativa Japonica Grou | 0.902 | 0.348 | 0.254 | 9e-23 |
| >gi|147766035|emb|CAN70214.1| hypothetical protein VITISV_038742 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 122 bits (305), Expect = 3e-25, Method: Compositional matrix adjust.
Identities = 98/371 (26%), Positives = 165/371 (44%), Gaps = 56/371 (15%)
Query: 6 WDNLEQVLPDNQNGSRVLITV--------TDPELLL------------SLEMENGEKIRP 45
WD+L+ + PD N SRVL T DP L ++ +
Sbjct: 291 WDDLKTLFPDVMNASRVLFTTRIRDVAIHADPRSATHELHFLNQAQSWELFLKKAFPMEG 350
Query: 46 DSVLNGGPMIRLKHESWQFFILHYGSMPLENYFLG------EAFLTVW------------ 87
DSV + RL + + G +PL +G E +VW
Sbjct: 351 DSVTCPPELERLGTQ----IVAKCGGLPLAIVIIGGLLSRKEKXPSVWLRVLQSISWQLN 406
Query: 88 ---RQIYTVM-----ELPFHLKVCCIYLCVFPPSIEISTRQLYQLWVAEGFIPYNGEET- 138
RQ+ ++ +LP++LK C +Y +FP +EI +L LW+AEGF+ GEE+
Sbjct: 407 NDSRQLMEILALSYNDLPYYLKPCFLYFGLFPEDLEIPVGKLVLLWIAEGFVQQRGEESM 466
Query: 139 ---AEHYLKELIHRGFIKVSKRRARDTIKSCYVPSFIYTSLALVAEKTGFVWMPDME--E 193
AE +L+EL+ R I+V+++R IK C + + A++ F+ + D +
Sbjct: 467 EDVAEDFLEELVDRSMIQVAEKRYNGKIKMCRIHDLLRDLAMSEAKECKFLEILDSTNID 526
Query: 194 ESLANVKRCFILKDLIDFFSSLKHSDMYLQSFLNHSSKNNHLNSKDYENFFKRFKYLRVL 253
S+ R + ++ + L+H + + +S L+ S L + +++ F+ K LRVL
Sbjct: 527 TSVTTRARRISVHSSLEEYMKLRHPNPHFRSMLHFSRCEESLRREQWKSLFESLKLLRVL 586
Query: 254 NLGSAVLDQYPSGLENLYLLKYLKLNIPSLKCLHSLLCTLLNLETLEMPSSYIDQSPHDI 313
+L P + L L+YL L L+ L S + NL+TL++ ++ + + P +
Sbjct: 587 DLERVQTHALPKEIRELVHLRYLGLRRTGLQRLPSSVQNFCNLQTLDIRATKVSRLPIQL 646
Query: 314 WMMQKLMHLYF 324
W M L HLY
Sbjct: 647 WNMPGLRHLYL 657
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356577907|ref|XP_003557063.1| PREDICTED: disease resistance protein RPM1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359489156|ref|XP_003633889.1| PREDICTED: probable disease resistance protein RDL6/RF9-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359489148|ref|XP_003633887.1| PREDICTED: probable disease resistance RPP8-like protein 4-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297744337|emb|CBI37307.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359496848|ref|XP_002269653.2| PREDICTED: disease resistance RPP8-like protein 3-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359491404|ref|XP_002274414.2| PREDICTED: probable disease resistance RPP8-like protein 2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|351727228|ref|NP_001235618.1| disease resistance protein [Glycine max] gi|223452576|gb|ACM89615.1| disease resistance protein [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|222640579|gb|EEE68711.1| hypothetical protein OsJ_27368 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|115476476|ref|NP_001061834.1| Os08g0424700 [Oryza sativa Japonica Group] gi|27817976|dbj|BAC55740.1| putative disease resistance gene homolog [Oryza sativa Japonica Group] gi|37806292|dbj|BAC99807.1| putative disease resistance gene homolog [Oryza sativa Japonica Group] gi|113623803|dbj|BAF23748.1| Os08g0424700 [Oryza sativa Japonica Group] gi|161376418|gb|ABX71479.1| putative disease resistance-like protein [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 350 | ||||||
| TAIR|locus:2075170 | 835 | RPP13 "RECOGNITION OF PERONOSP | 0.445 | 0.186 | 0.272 | 3.9e-08 | |
| TAIR|locus:2102857 | 847 | AT3G46710 [Arabidopsis thalian | 0.451 | 0.186 | 0.271 | 1.4e-06 | |
| TAIR|locus:504956483 | 847 | AT3G46730 [Arabidopsis thalian | 0.345 | 0.142 | 0.308 | 1.4e-06 | |
| TAIR|locus:2078012 | 852 | ZAR1 "HOPZ-ACTIVATED RESISTANC | 0.454 | 0.186 | 0.257 | 5.4e-06 | |
| TAIR|locus:2176486 | 908 | RPP8 "RECOGNITION OF PERONOSPO | 0.411 | 0.158 | 0.299 | 6e-06 | |
| TAIR|locus:2169523 | 901 | AT5G35450 [Arabidopsis thalian | 0.322 | 0.125 | 0.319 | 1.3e-05 | |
| TAIR|locus:2077572 | 926 | RPM1 "RESISTANCE TO P. SYRINGA | 0.171 | 0.064 | 0.359 | 3.1e-05 | |
| TAIR|locus:504956184 | 1017 | AT1G58807 "AT1G58807" [Arabido | 0.454 | 0.156 | 0.254 | 4.4e-05 | |
| TAIR|locus:2827038 | 1017 | AT1G59124 "AT1G59124" [Arabido | 0.454 | 0.156 | 0.254 | 4.4e-05 | |
| TAIR|locus:504956186 | 1138 | AT1G58602 [Arabidopsis thalian | 0.468 | 0.144 | 0.258 | 4.6e-05 |
| TAIR|locus:2075170 RPP13 "RECOGNITION OF PERONOSPORA PARASITICA 13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 132 (51.5 bits), Expect = 3.9e-08, Sum P(2) = 3.9e-08
Identities = 46/169 (27%), Positives = 76/169 (44%)
Query: 95 ELPFHLKVCCIYLCVFPPSIEISTRQLYQLWVAEGFIPYNGE----ETAEHYLKELIHRG 150
EL K+C +YL +FP EI +L L VAEGFI + E + A +Y++ELI R
Sbjct: 412 ELRHESKLCFLYLSIFPEDYEIDLEKLIHLLVAEGFIQGDEEMMMEDVARYYIEELIDRS 471
Query: 151 FIKVSKRRARDTIKSCYVPSFIYTSLALVAEKTGFV--WMPDMEEESLANVKRCFILKDL 208
++ + RR R + SC + + +++ FV + + + S +R ++
Sbjct: 472 LLE-AVRRERGKVMSCRIHDLLRDVAIKKSKELNFVNVYNDHVAQHSSTTCRR-EVVHHQ 529
Query: 209 IDFFSSLKHSDMYLQXXXXXXXXXXXXXXXDYENFFKRFKYLRVLNLGS 257
+SS K + ++ D+E K LRVL+ GS
Sbjct: 530 FKRYSSEKRKNKRMRSFLYFGEFDHLVGL-DFETL----KLLRVLDFGS 573
|
|
| TAIR|locus:2102857 AT3G46710 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00033834001 | SubName- Full=Chromosome undetermined scaffold_70, whole genome shotgun sequence; (897 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 350 | |||
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 4e-07 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
Score = 50.4 bits (121), Expect = 4e-07
Identities = 39/176 (22%), Positives = 58/176 (32%), Gaps = 58/176 (32%)
Query: 6 WDNLEQVLPDNQNGSRVLITVTDPELLLSLEMENGEKIRPDSVLNGGPMIRLKHESWQFF 65
WD + PD +NGSRV++T + + + +S+ ESW+ F
Sbjct: 115 WDKIGVPFPDGENGSRVIVTTRSESVAGRM-GGTSKPHEVESLE--------PEESWELF 165
Query: 66 ILHYG----------------------SMPLENYFLGEA-----FLTVWRQIYTVM---- 94
+PL LG + W + +
Sbjct: 166 SNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNEL 225
Query: 95 ------------------ELPFHLKVCCIYLCVFPPSIEISTRQLYQLWVAEGFIP 132
LP HLK C +YL +FP I QL +LW+AEGF+
Sbjct: 226 AGRDGLNEVLSILSLSYDNLPMHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVI 281
|
Length = 285 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 350 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 99.87 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.35 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.34 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.31 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.3 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.22 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.17 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.03 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.98 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.9 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 98.88 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.82 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.81 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.76 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.74 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.73 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.69 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.68 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.66 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.63 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.6 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.57 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.56 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.54 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.46 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.46 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.42 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.41 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.4 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.37 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.34 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.32 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.31 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.31 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.21 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.2 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.14 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.12 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 98.05 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.87 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 97.87 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.84 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.8 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.68 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.62 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.61 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 97.54 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.42 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.34 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.26 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 97.17 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.04 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.79 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.69 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 96.64 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.58 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.57 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 96.55 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.44 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 96.41 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 96.4 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.38 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 96.15 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 95.65 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 95.38 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 95.1 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 94.97 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 93.64 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 93.46 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 93.46 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 93.15 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 93.15 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 92.15 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 90.93 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 90.63 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 90.44 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 84.88 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 84.21 | |
| PF05729 | 166 | NACHT: NACHT domain | 84.1 | |
| smart00364 | 26 | LRR_BAC Leucine-rich repeats, bacterial type. | 83.51 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-56 Score=453.49 Aligned_cols=332 Identities=24% Similarity=0.382 Sum_probs=286.5
Q ss_pred CChhhHHHHHhhcCCCCCCcEEEEEeCChHHHhh-cccccCCCCCCCceEEcCCCCCChhhhhhccc---ccc-------
Q 042413 1 MTFQQWDNLEQVLPDNQNGSRVLITVTDPELLLS-LEMENGEKIRPDSVLNGGPMIRLKHESWQFFI---LHY------- 69 (350)
Q Consensus 1 ~~~~~w~~l~~~l~~~~~GSrIivTTR~~~v~~~-~~~~~~~~~~~~~~~~l~~L~~~~~~s~~Lf~---f~~------- 69 (350)
|+..+|+.+..++|...+||||++|||++.||.. |++. ..+++++|. ++|||+||+ |..
T Consensus 271 W~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~--------~~~~v~~L~--~~eaW~LF~~~v~~~~~~~~~~ 340 (889)
T KOG4658|consen 271 WEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVD--------YPIEVECLT--PEEAWDLFQKKVGPNTLGSHPD 340 (889)
T ss_pred cccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCC--------ccccccccC--ccccHHHHHHhhcccccccccc
Confidence 8899999999999999999999999999999998 7765 999999999 999999999 433
Q ss_pred ------------CCchhHHHHHHHHHH-----HHHHhhhc------------------------cCCCChhhHHHHhhhh
Q 042413 70 ------------GSMPLENYFLGEAFL-----TVWRQIYT------------------------VMELPFHLKVCCIYLC 108 (350)
Q Consensus 70 ------------~GlPLai~~lg~~L~-----~~W~~~l~------------------------y~~L~~~lk~cfl~~a 108 (350)
+|+|||+++||++|+ ++|+++.+ ||+||+++|.||+|||
T Consensus 341 i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLyca 420 (889)
T KOG4658|consen 341 IEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCA 420 (889)
T ss_pred HHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhc
Confidence 999999999999999 88999887 9999999999999999
Q ss_pred cCCCCceeeHHHHHHHHHHcCCCCCC--C---hhHHHHHHHHHHHcCcceeeecCCCCCeeEEEeCHHHHHHHHHHhh--
Q 042413 109 VFPPSIEISTRQLYQLWVAEGFIPYN--G---EETAEHYLKELIHRGFIKVSKRRARDTIKSCYVPSFIYTSLALVAE-- 181 (350)
Q Consensus 109 ~Fp~~~~i~~~~li~~w~a~g~i~~~--~---e~~~~~~~~~Lv~r~li~~~~~~~~g~~~~~~mhdli~dl~~~i~~-- 181 (350)
+|||||.|++++||.+|+||||+.+. + ++.|+.|+++|+++++++..... ++..+|+|||+|||+|..+++
T Consensus 421 lFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~--~~~~~~kmHDvvRe~al~ias~~ 498 (889)
T KOG4658|consen 421 LFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDE--GRKETVKMHDVVREMALWIASDF 498 (889)
T ss_pred cCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccc--cceeEEEeeHHHHHHHHHHhccc
Confidence 99999999999999999999999885 3 99999999999999999987754 677899999999999999999
Q ss_pred ---hcCcEEecC-CCC----C-CCCCeeEEEEecCcc-chhhccCCCCCCeeEEEEecCCCCCCCccchHHHhcCCceee
Q 042413 182 ---KTGFVWMPD-MEE----E-SLANVKRCFILKDLI-DFFSSLKHSDMYLQSFLNHSSKNNHLNSKDYENFFKRFKYLR 251 (350)
Q Consensus 182 ---~~~~~~~~~-~~~----~-~~~~~r~L~l~~~~~-~~~~~~~~~~~~Lr~L~~~~~~~~~~~~~~~~~~~~~l~~L~ 251 (350)
+++.+...+ ... . ....+|++++.++.. ..+.....+ +++||.+.++... .......+|..++.|+
T Consensus 499 ~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~--~L~tLll~~n~~~--l~~is~~ff~~m~~Lr 574 (889)
T KOG4658|consen 499 GKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENP--KLRTLLLQRNSDW--LLEISGEFFRSLPLLR 574 (889)
T ss_pred cccccceEEECCcCccccccccchhheeEEEEeccchhhccCCCCCC--ccceEEEeecchh--hhhcCHHHHhhCcceE
Confidence 666444432 111 1 457899999999998 677777888 9999999998620 2456677899999999
Q ss_pred EEEccCCC-CCcCccccCCCCCCCeeeeeCCCCcccchhhhcCcCCCEEEccCC-cCcccchhccccccCcEEEeeccCC
Q 042413 252 VLNLGSAV-LDQYPSGLENLYLLKYLKLNIPSLKCLHSLLCTLLNLETLEMPSS-YIDQSPHDIWMMQKLMHLYFYCISP 329 (350)
Q Consensus 252 ~L~L~~~~-l~~lp~~i~~l~~L~~L~l~~~~l~~lP~~i~~l~~L~~L~l~~~-~l~~lP~~i~~L~~L~~L~l~~~~~ 329 (350)
+|||++|. +.++|.+|+.|.|||||+++++.++.+|.++++|..|++||+..+ .+..+|..+..|++|++|.+.....
T Consensus 575 VLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~~ 654 (889)
T KOG4658|consen 575 VLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSAL 654 (889)
T ss_pred EEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheeccccccccccccchhhhcccccEEEeecccc
Confidence 99999887 889999999999999999999999999999999999999999999 6677777777799999999976542
Q ss_pred CCCCCCccccccccccccc
Q 042413 330 CTSKNYSSSLKNLIFISAL 348 (350)
Q Consensus 330 ~~~~~~~~~l~~L~~L~~L 348 (350)
.........+.+|++|+.+
T Consensus 655 ~~~~~~l~el~~Le~L~~l 673 (889)
T KOG4658|consen 655 SNDKLLLKELENLEHLENL 673 (889)
T ss_pred ccchhhHHhhhcccchhhh
Confidence 2222244455555555544
|
|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >smart00364 LRR_BAC Leucine-rich repeats, bacterial type | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 350 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-19 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-05 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 2e-11 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 3e-11 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 88.0 bits (217), Expect = 4e-19
Identities = 65/389 (16%), Positives = 121/389 (31%), Gaps = 111/389 (28%)
Query: 6 WDNLEQVLPDNQNGSRVLIT-----VTDP------------ELLLSLEMENGEKI----- 43
+ + ++L+T VTD ++L + + +
Sbjct: 254 QN--AKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYL 311
Query: 44 ------RPDSVLNGGP--------MIRLKHESWQFFILHYGSMPLENYFLGEAFLTV--- 86
P VL P IR +W + H L E+ L V
Sbjct: 312 DCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNW-KHVNCDKLTTII--ESSLNVLEP 368
Query: 87 --WRQIYTVMELPFHLKVCCIYLCVFPPSIEISTRQLYQLWVAEGFIPYNGEETAEHYLK 144
+R+++ L VFPPS I T L +W + +
Sbjct: 369 AEYRKMFD-------------RLSVFPPSAHIPTILLSLIWFDV------IKSDVMVVVN 409
Query: 145 ELIHRGFIKVSKRRARDTIKSCYVPSFIYTSLALVAEKTGFVWMPDMEEESLA--NVKRC 202
+L ++ K+ TI +PS IY L + E + + N+ +
Sbjct: 410 KLHKYSLVE--KQPKESTI---SIPS-IYLELKVKLEN-----EYALHRSIVDHYNIPKT 458
Query: 203 FILKDLIDFFSSLKHSDMYLQSFLNHSSKNNHLNSKDYENFFKRFKYLRVLNLGSAVLDQ 262
F DL + D Y S + H HL + ++ F+ + L+
Sbjct: 459 FDSDDL-----IPPYLDQYFYSHIGH-----HLKNIEHPERMTLFRMV-FLDFR------ 501
Query: 263 YPSGLENLYLLKYLKLNIPSLKCLHSLLCTLLNLETLEMPSSYI-DQSPHDIWMMQKLMH 321
+L + ++ + + S+L TL L+ + YI D P ++ ++
Sbjct: 502 --------FLEQKIRHDSTAWNASGSILNTLQQLKFYK---PYICDNDPKYERLVNAILD 550
Query: 322 LYFYCISPCTSKNYSSSLKNLIFISALHP 350
F + S +L+ I+ +
Sbjct: 551 --F--LPKIEENLICSKYTDLLRIALMAE 575
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 350 | |||
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 99.94 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 99.87 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.87 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 99.77 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.55 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.54 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.53 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.51 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.5 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.49 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.49 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.47 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.47 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.47 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.47 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.46 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.46 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.45 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.44 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.44 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.43 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.43 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.42 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.42 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.42 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.42 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.42 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.41 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.41 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.41 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.41 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.41 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.41 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.4 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.4 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.4 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.4 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.4 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.39 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.39 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.39 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.38 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.37 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.37 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.37 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.37 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.37 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.36 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.36 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.35 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.35 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.34 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.34 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.34 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.34 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.34 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.33 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.33 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.32 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.32 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.32 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.32 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.32 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.31 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.31 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.31 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.31 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.31 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.31 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.31 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.31 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.31 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.31 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.3 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.3 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.3 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.29 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.29 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.29 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.29 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.29 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.28 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.28 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.28 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.28 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.27 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.27 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.27 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.27 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.27 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.27 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.25 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.25 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.24 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.24 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.24 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.24 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.24 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.24 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.23 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.22 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.22 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.22 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.22 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.22 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.22 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.21 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.19 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.19 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.18 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.18 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.18 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.17 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.16 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.16 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.16 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.16 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.15 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.14 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.14 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.13 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.12 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.12 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.09 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.08 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.08 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.03 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.0 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.98 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.96 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.94 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.89 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.85 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.83 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.74 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.69 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.57 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.48 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.45 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.39 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.33 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.29 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.27 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.12 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.1 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.1 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.03 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.98 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 97.94 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.92 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.91 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.78 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.31 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.15 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 96.76 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 96.71 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.52 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.13 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 95.39 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 95.26 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 94.81 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 94.4 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 94.1 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 93.51 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 93.46 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 92.17 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 91.74 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 91.48 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 90.87 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 80.98 |
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
Probab=99.94 E-value=1.9e-27 Score=233.88 Aligned_cols=151 Identities=21% Similarity=0.301 Sum_probs=124.7
Q ss_pred CCcEEEEEeCChHHHhhcccccCCCCCCCceEEcCCCCCChhhhhhccc---ccc-----------------CCchhHHH
Q 042413 18 NGSRVLITVTDPELLLSLEMENGEKIRPDSVLNGGPMIRLKHESWQFFI---LHY-----------------GSMPLENY 77 (350)
Q Consensus 18 ~GSrIivTTR~~~v~~~~~~~~~~~~~~~~~~~l~~L~~~~~~s~~Lf~---f~~-----------------~GlPLai~ 77 (350)
+|||||||||++.|+..++... .+|++++|+ +++||+||+ |+. +|+||||+
T Consensus 264 ~gs~ilvTTR~~~v~~~~~~~~-------~~~~l~~L~--~~ea~~Lf~~~a~~~~~~~~~~~~~~~I~~~c~GlPLAl~ 334 (549)
T 2a5y_B 264 LRLRCLVTTRDVEISNAASQTC-------EFIEVTSLE--IDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLM 334 (549)
T ss_dssp TTCEEEEEESBGGGGGGCCSCE-------EEEECCCCC--HHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHH
T ss_pred CCCEEEEEcCCHHHHHHcCCCC-------eEEECCCCC--HHHHHHHHHHHhcCCCCchhHHHHHHHHHHHhCCChHHHH
Confidence 7999999999999999886321 689999999 999999999 543 99999999
Q ss_pred HHHHHHH-HHHHhh--hc------------------cCCCChhhHHHHh-----------hhhcCCCCceeeHHHHHHHH
Q 042413 78 FLGEAFL-TVWRQI--YT------------------VMELPFHLKVCCI-----------YLCVFPPSIEISTRQLYQLW 125 (350)
Q Consensus 78 ~lg~~L~-~~W~~~--l~------------------y~~L~~~lk~cfl-----------~~a~Fp~~~~i~~~~li~~w 125 (350)
++|+.|+ ..|+.+ +. |++||+++|.||+ |||+||+++.|+ +++|
T Consensus 335 ~~g~~l~~~~w~~~~~l~~~l~~~~~~~i~~~l~~Sy~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w 410 (549)
T 2a5y_B 335 MFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLW 410 (549)
T ss_dssp HHHTTCCSSSHHHHHHHHHHHHHHCSSTTCCCSSSSSSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHH
T ss_pred HHHHHhccchHHHHHHhHHHhhcccHHHHHHHHhcccccccHHHHHHHhccchhhhhHhhheeeeCCCCeee----eeee
Confidence 9999877 333322 11 9999999999999 999999999998 8999
Q ss_pred HHc--CCCCCC--C---hhHHHHHHHHHHHcCcceeeecCCCCCeeEEEeCHHHHHHHHHHhhhcCc
Q 042413 126 VAE--GFIPYN--G---EETAEHYLKELIHRGFIKVSKRRARDTIKSCYVPSFIYTSLALVAEKTGF 185 (350)
Q Consensus 126 ~a~--g~i~~~--~---e~~~~~~~~~Lv~r~li~~~~~~~~g~~~~~~mhdli~dl~~~i~~~~~~ 185 (350)
+|+ ||+... + ++.++ |+++|+++||++....+ ....|+|||+||++|+.++.++++
T Consensus 411 ~a~~~G~i~~~~~~~~~~~~~~-~l~~L~~rsLl~~~~~~---~~~~~~mHdlv~~~a~~~~~~~~~ 473 (549)
T 2a5y_B 411 SCVIPVDICSNEEEQLDDEVAD-RLKRLSKRGALLSGKRM---PVLTFKIDHIIHMFLKHVVDAQTI 473 (549)
T ss_dssp HHHSCC-------CCCTHHHHH-HHHHTTTBSSCSEEECS---SSCEEECCHHHHHHHHTTSCTHHH
T ss_pred eeeccceeccCCCCCCHHHHHH-HHHHHHHcCCeeEecCC---CceEEEeChHHHHHHHHHHHHHHH
Confidence 999 999765 2 77777 99999999999987643 346799999999999998877653
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 350 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 99.62 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.48 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.44 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.38 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.26 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.26 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.22 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.2 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.19 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.19 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.18 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.17 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.13 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.11 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.11 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.09 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.04 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.03 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.02 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.99 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.99 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.98 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.96 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.96 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.96 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.94 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.7 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.65 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.53 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.45 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.39 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.33 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.2 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.12 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.11 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.96 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 97.69 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.63 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.56 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.19 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.99 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.67 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 95.88 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.62 E-value=1e-16 Score=141.58 Aligned_cols=91 Identities=13% Similarity=0.127 Sum_probs=76.6
Q ss_pred CChhhHHHHHhhcCCCCCCcEEEEEeCChHHHhhcccccCCCCCCCceEEcCCCCCChhhhhhccc---ccc--------
Q 042413 1 MTFQQWDNLEQVLPDNQNGSRVLITVTDPELLLSLEMENGEKIRPDSVLNGGPMIRLKHESWQFFI---LHY-------- 69 (350)
Q Consensus 1 ~~~~~w~~l~~~l~~~~~GSrIivTTR~~~v~~~~~~~~~~~~~~~~~~~l~~L~~~~~~s~~Lf~---f~~-------- 69 (350)
|+.+.|+.+. ..|||||||||++.|+..+.... .+|++++|+ ++|||+||+ |..
T Consensus 145 ~~~~~~~~~~------~~~srilvTTR~~~v~~~~~~~~-------~~~~l~~L~--~~ea~~Lf~~~~~~~~~~~~~~~ 209 (277)
T d2a5yb3 145 VQEETIRWAQ------ELRLRCLVTTRDVEISNAASQTC-------EFIEVTSLE--IDECYDFLEAYGMPMPVGEKEED 209 (277)
T ss_dssp CCHHHHHHHH------HTTCEEEEEESBGGGGGGCCSCE-------EEEECCCCC--HHHHHHHHHHTSCCCC--CHHHH
T ss_pred hHHhhhhhhc------ccCceEEEEeehHHHHHhcCCCC-------ceEECCCCC--HHHHHHHHHHHhCCccCchhhHH
Confidence 6677776553 25899999999999998876542 789999999 999999998 443
Q ss_pred ---------CCchhHHHHHHHHHH----HHHHhhhc-----------------cCCCChhhHHHHhh
Q 042413 70 ---------GSMPLENYFLGEAFL----TVWRQIYT-----------------VMELPFHLKVCCIY 106 (350)
Q Consensus 70 ---------~GlPLai~~lg~~L~----~~W~~~l~-----------------y~~L~~~lk~cfl~ 106 (350)
+|+|||++++|+.|+ ++|.+..+ |++||+++|+||-+
T Consensus 210 ~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~~~~v~~il~~sY~~L~~~lk~c~~~ 276 (277)
T d2a5yb3 210 VLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEV 276 (277)
T ss_dssp HHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSSTTCCCSSSSSSSHHHHHHHHHHT
T ss_pred HHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhcCcHHHHHHHHHHHHhcccHHHHHHHHh
Confidence 999999999999998 67766544 99999999999965
|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|