Citrus Sinensis ID: 042439

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760------
MPVGIGRLTCLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKCVGDAKEAQLDGKKNLRELLLRWALNTDGSSSREAKTENDVLDMLKPHEILEQFCISGYGGTKFPAWLGDSSLPNLVTLKFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDPPIPFPCLETLIFENMREWEDWISHGSSQRVVEGFPKLRELHILRCSKLKGPFPEHLPALEMLVIEGCEELSVSVSSLPALCKLQIGGCKKVVWESATGHLGSQNSVVCRDASNQVFLAGPLKPQLPKLEELEINDMKEHTYIWKSHNGLLQDSCSLKRLTIASCPKLQSLVAEEEKDQQQQLCELSCRLEYLRLSGCQGLVKLPQSSLSLSSLREIEIYGCWSLVSFPEVALPSKLRKIEICSCDALKSLPEAWMCDTNSSLEILMEEGIQRSSSSRRYTSSLLEKLEIESCRSLTCIFSKNELPATLESLEVGNLPPSLKSLHVLSCSKLESIAERLDNNTSLETIDICYCGNLKNLPSGLHNLHQLQEISIGRCGNLESFPEGGLPCAKLSKLRIHGCERLEALPKGLHNLTSLQELTIGRGVELPSLEEDGLPTNLHSLWIAGNMEIWKSTIEWGRGFHRFSSLRQLRISGCDDDMVSFPPKADDIRLGTALPLPASLTSLLIFSFPNLERLSSSIVDLQNLTELYLEDCPKLKYFPEKGLPSSLLQLYIGGCPLIAEKCRKDGGQYWDLLTHIPYVVIDRKWVFDDDSTED
ccccccccccccccccEEEcccccccHHHHccccccccEEEEccccccccHHHHHHHcccccccccEEEEEEccccccccccccccHHHHHccccccccccEEEEEccccccccccccccccccEEEEEEEccccccccccccccccccEEEEccccccEEEcccccccccccccccccEEEEccccccccccccccccccccccccccEEEEEcccccccccccccccccEEEEEccccccccccccccccEEEEccccccEEcccccccccccEEEEcccccccccccccccccccccEEEEccccccccccccccccccccccccEEEEccccccccccHHHHHHHHHHHHcccccccEEEEEcccccEEccccccccccccEEEEEccccccccccccccccccEEEEccccccccccccccccccccccEEEEccccccccccccccccccEEEEccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEcccccHHHHHHHHHccccccccccEEEEEcccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEEccHHHHHHHcccccccccccccccEEEEccEEEEccccccc
cccccccHHHHHHccEEEEcccccccHHHHHHHHHcccEEEEEcccccccHHHHHHHHHcccccccEEEEEEccccccccccccccHHHHHHHcccccccEEEEEEccccccccccccccccHccEEEEEcccccccccccccccccccEEEEcccccEEEccHHHcccccccccccccEEEEcccHHHHHccccccccccccccccccEEEEcccccHcccccccccccEEEEEcccccccccccccccccEEEEcccccEEccccccccccccEEEEEEcccccccccccccccccccEEEEEccccccccccHccccccccccHcEEEccccccHccccHHHcccccHHHccccccccEEEEcccccHHcccccccccccccEEEEcccccccccccccccccccEEEEcccccHHcccHHHcccccHHHHHHHcccccccccccccccccccEEEEcccccHcccccccccccHHHHHccccccccccEEEEccccccccccHHccccccccEEEEcccccHccccHcccccccccEEEEcccccccEccccccccccccEEEEcccHHHHcccccccccccccEEEEcccccccccccccccccccEEEEcccHHHHHHHHHccccccccccccEEEEccccHHHHHcccccccccccccccccccccEEEEcccccHHHccHHccccccccEEEEcccccccccccccccccccEEEEcccHHHHHHHccccccccccEccccEEEEcccEEcccccccc
MPVGIGRLTCLQTLCNfvvgkgsgsglRELKLLTHLHgtlnisklenvkcvgdakeaqLDGKKNLRELLLRWALntdgsssreaktendvldmlkphEILEQFCisgyggtkfpawlgdsslpnlvtlkfencdmctalpsvgqlpslkhlAVCGMSRvkrlgsefygndppipfpcletLIFENMREWEDWishgssqrvvegfpKLRELHILRCsklkgpfpehlpALEMLVIEGCEELSVSVSslpalcklqiggckKVVWesatghlgsqnsvvcrdasnqvflagplkpqlpkleeleINDMKEHTYIWkshngllqdscslkrltiascpklqSLVAEEEKDQQQQLCELSCRLEYLRlsgcqglvklpqsslslsslrEIEIYGCwslvsfpevalpsklrkIEICscdalkslpeawmcdtnsSLEILMEEGIQRSSSSRRYTSSLLEKLEIESCRSLTcifsknelpatleslevgnlppslkslhVLSCSKLESIAErldnntsletidicycgnlknlpsglhnlhqlqeisigrcgnlesfpegglpcaklsklrihGCERLEalpkglhnltslqeltigrgvelpsleedglptnlhSLWIAGNMEIWKSTIEWGRGFHRFSSLRQLRisgcdddmvsfppkaddirlgtalplpasltsllifsfpnlerlsssivdlqnltelyledcpklkyfpekglpssLLQLYIGGCPLIAEKCrkdggqywdllthipyvvidrkwvfdddsted
MPVGIGRLTCLQTLCNFVVGKGSGSGLRELKLLTHLHGtlnisklenvkcVGDAKEAQLDGKKNLRELLLRWalntdgsssreaktendVLDMLKPHEILEQFCISGYGGTKFPAWLGDSSLPNLVTLKFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSefygndppipFPCLETLIFENMREWEDWISHGSSQRVVEGFPKLRELHILRCSKLKGPFPEHLPALEMLVIEGCEELSVSVSSLPALCKLQIGGCKKVVWESATGHLGSQNSVVCRDASNQVFLagplkpqlpkLEELEINDMKEHTYIWKSHNGLLQDSCSLKRLTIASCPKLQSLVAEEEKDQQQQLCELSCRLEYLRLSGCQGLVKLPQSSLSLSSLREIEIYGCWSLVSFPEVALPSKLRKIEICSCDALKSLPEAWMCDTNSSLEILMEegiqrssssrRYTSSLLEKLEIESCRSLTCIFSKNELPATLESLEVGNLPPSLKSLHVLSCSKLESIAerldnntslETIDICYCGNLKNLPSGLHNLHQLQEISIGRCGNLESFPEGGLPCAKLSKLRIHGCERLEALPKGLHNLTSLQELTIGRGVELPSLEEDGLPTNLHSLWIAGNMEIWKSTIEWGRGFHRFSSLRQLRISGCDDDMVSFPPKADDIRLGTALPLPASLTSLLIFSFPNLERLSSSIVDLQNLTELYLEDCPKLKYFPEKGLPSSLLQLYIGGCPLIAEKCRKDGGQYWDLLTHIPYVVIDRKWVfdddsted
MPVGIGRLTCLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKCVGDAKEAQLDGKKNLRELLLRWALNTDGSSSREAKTENDVLDMLKPHEILEQFCISGYGGTKFPAWLGDSSLPNLVTLKFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDPPIPFPCLETLIFENMREWEDWISHGSSQRVVEGFPKLRELHILRCSKLKGPFPEHLPALEMLVIEGCEELSVSVSSLPALCKLQIGGCKKVVWESATGHLGSQNSVVCRDASNQVFLAGplkpqlpkleeleINDMKEHTYIWKSHNGLLQDSCSLKRLTIASCPKLQSLVAEEEKDQQQQLCELSCRLEYLRLSGCQGLVKLPQsslslsslREIEIYGCWSLVSFPEVALPSKLRKIEICSCDALKSLPEAWMCDTNSSLEILMEEGIQrssssrrytssLLEKLEIESCRSLTCIFSKNELPATLESLEVGNLPPSLKSLHVLSCSKLESIAERLDNNTSLETIDICYCGNLKNLPSGLHNLHQLQEISIGRCGNLESFPEGGLPCAKLSKLRIHGCERLEALPKGLHNLTSLQELTIGRGVELPSLEEDGLPTNLHSLWIAGNMEIWKSTIEWGRGFHRFSSLRQLRISGCDDDMVSFPPKADDIRLGtalplpasltsllIFSFPNLERLSSSIVDLQNLTELYLEDCPKLKYFPEKGLPSSLLQLYIGGCPLIAEKCRKDGGQYWDLLTHIPYVVIDRKWVFDDDSTED
***GIGRLTCLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKCVGDAKEAQLDGKKNLRELLLRWALN**************VLDMLKPHEILEQFCISGYGGTKFPAWLGDSSLPNLVTLKFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDPPIPFPCLETLIFENMREWEDWISHGSSQRVVEGFPKLRELHILRCSKLKGPFPEHLPALEMLVIEGCEELSVSVSSLPALCKLQIGGCKKVVWESATGHLGSQNSVVCRDASNQVFLAGPLKPQLPKLEELEINDMKEHTYIWKSHNGLLQDSCSLKRLTIASCPKLQSLVA*******QQLCELSCRLEYLRLSGCQGLVKLPQSSLSLSSLREIEIYGCWSLVSFPEVALPSKLRKIEICSCDALKSLPEAWMCDTNSSLEILM****************LLEKLEIESCRSLTCIFSKNELPATLESLEVGNLPPSLKSLHVLSCSKLESIAERLDNNTSLETIDICYCGNLKNLPSGLHNLHQLQEISIGRCGNLESFPEGGLPCAKLSKLRIHGCERLEALPKGLHNLTSLQELTIGRGVELPSLEEDGLPTNLHSLWIAGNMEIWKSTIEWGRGFHRFS***********************IRLGTALPLPASLTSLLIFSFPNLERLSSSIVDLQNLTELYLEDCPKLKYFPEKGLPSSLLQLYIGGCPLIAEKCRKDGGQYWDLLTHIPYVVIDRKWVFD******
MPVGIGRLTCLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKCVGDAKEAQLDGKKNLRELLLRWALNTD********TENDVLDMLKPHEILEQFCISGYGGTKFPAWLGDSSLPNLVTLKFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDPPIPFPCLETLIFENMREWEDWISHGSSQRVVEGFPKLRELHILRCSKLKGPFPEHLPALEMLVIEGCEELSVSVSSLPALCKLQIGGCKKVVW******LGSQNSVVCRDASNQVFLAGPLKPQLPKLEELEINDMKEHTYIWKSHNGLLQDSCSLKRLTIASCPKLQSLVAEEEKDQQQQLCELSCRLEYLRLSGCQGLVKLPQSSLSLSSLREIEIYGCWSLVSFPEVALPSKLRKIEICSCDALKS*************EILMEEGIQRSSSSRRYTSSLLEKLEIESCRSLTCIFSKNELPATLESLEVGNLPPSLKSLHVLSCSKLESIAERLDNNTSLETIDICYCGNLKNLPSGLHNLHQLQEISIGRCGNLESFPEGGLPCAKLSKLRIHGCERLEALPKGLHNLTSLQELTIGRGVELPSLEEDGLPTNLHSLWIAGNMEIWKSTIEWGRGFHRFSSLRQLRISGCDDDMVSFPPKADDIRLGTALPLPASLTSLLIFSFPNLERLSSSIVDLQNLTELYLEDCPKLKYFPEKGLPSSLLQLYIGGCPLIAEKCRKDGGQYWDLLTHIPYVVIDRKWV*D******
MPVGIGRLTCLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKCVGDAKEAQLDGKKNLRELLLRWALNT**********ENDVLDMLKPHEILEQFCISGYGGTKFPAWLGDSSLPNLVTLKFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDPPIPFPCLETLIFENMREWEDWISHGSSQRVVEGFPKLRELHILRCSKLKGPFPEHLPALEMLVIEGCEELSVSVSSLPALCKLQIGGCKKVVWESATGHLGSQNSVVCRDASNQVFLAGPLKPQLPKLEELEINDMKEHTYIWKSHNGLLQDSCSLKRLTIASCPKLQSLV*********QLCELSCRLEYLRLSGCQGLVKLPQSSLSLSSLREIEIYGCWSLVSFPEVALPSKLRKIEICSCDALKSLPEAWMCDTNSSLEILMEEG***********SSLLEKLEIESCRSLTCIFSKNELPATLESLEVGNLPPSLKSLHVLSCSKLESIAERLDNNTSLETIDICYCGNLKNLPSGLHNLHQLQEISIGRCGNLESFPEGGLPCAKLSKLRIHGCERLEALPKGLHNLTSLQELTIGRGVELPSLEEDGLPTNLHSLWIAGNMEIWKSTIEWGRGFHRFSSLRQLRISGCDDDMVSFPPKADDIRLGTALPLPASLTSLLIFSFPNLERLSSSIVDLQNLTELYLEDCPKLKYFPEKGLPSSLLQLYIGGCPLIAEKCRKDGGQYWDLLTHIPYVVIDRKWVFDDDSTED
***GIGRLTCLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKCVGDAKEAQLDGKKNLRELLLRWALNTDGSSSREAKTENDVLDMLKPHEILEQFCISGYGGTKFPAWLGDSSLPNLVTLKFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDPPIPFPCLETLIFENMREWEDWISHGSSQRVVEGFPKLRELHILRCSKLKGPFPEHLPALEMLVIEGCEELSVSVSSLPALCKLQIGGCKKVVWESATGHLGSQNSVVCRDASNQVFLAGPLKPQLPKLEELEINDMKEHTYIWKSHNGLLQDSCSLKRLTIASCPKLQSLVAEEEKDQQQQLCELSCRLEYLRLSGCQGLVKLPQSSLSLSSLREIEIYGCWSLVSFPEVALPSKLRKIEICSCDALKSLPEAWMCDTNSSLEILMEEGIQRSSSSRRYTSSLLEKLEIESCRSLTCIFSKNELPATLESLEVGNLPPSLKSLHVLSCSKLESIAERLDNNTSLETIDICYCGNLKNLPSGLHNLHQLQEISIGRCGNLESFPEGGLPCAKLSKLRIHGCERLEALPKGLHNLTSLQELTIGRGVELPSLEEDGLPTNLHSLWIAGNMEIWKSTIEWGRGFHRFSSLRQLRISGCDDDMVSFPPKADDIRLGTALPLPASLTSLLIFSFPNLERLSSSIVDLQNLTELYLEDCPKLKYFPEKGLPSSLLQLYIGGCPLIAEKCRKDGGQYWDLLTHIPYVVIDRKWVFDD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPVGIGRLTCLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKCVGDAKEAQLDGKKNLRELLLRWALNTDGSSSREAKTENDVLDMLKPHEILEQFCISGYGGTKFPAWLGDSSLPNLVTLKFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDPPIPFPCLETLIFENMREWEDWISHGSSQRVVEGFPKLRELHILRCSKLKGPFPEHLPALEMLVIEGCEELSVSVSSLPALCKLQIGGCKKVVWESATGHLGSQNSVVCRDASNQVFLAGPLKPQLPKLEELEINDMKEHTYIWKSHNGLLQDSCSLKRLTIASCPKLQSLVAEEEKDQQQQLCELSCRLEYLRLSGCQGLVKLPQSSLSLSSLREIEIYGCWSLVSFPEVALPSKLRKIEICSCDALKSLPEAWMCDTNSSLEILMEEGIQRSSSSRRYTSSLLEKLEIESCRSLTCIFSKNELPATLESLEVGNLPPSLKSLHVLSCSKLESIAERLDNNTSLETIDICYCGNLKNLPSGLHNLHQLQEISIGRCGNLESFPEGGLPCAKLSKLRIHGCERLEALPKGLHNLTSLQELTIGRGVELPSLEEDGLPTNLHSLWIAGNMEIWKSTIEWGRGFHRFSSLRQLRISGCDDDMVSFPPKADDIRLGTALPLPASLTSLLIFSFPNLERLSSSIVDLQNLTELYLEDCPKLKYFPEKGLPSSLLQLYIGGCPLIAEKCRKDGGQYWDLLTHIPYVVIDRKWVFDDDSTED
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query766 2.2.26 [Sep-21-2011]
Q9LRR51424 Putative disease resistan yes no 0.915 0.492 0.298 8e-72
Q9LRR41054 Putative disease resistan no no 0.301 0.219 0.415 5e-44
Q7XA42979 Putative disease resistan N/A no 0.310 0.243 0.347 8e-28
Q7XA39988 Putative disease resistan N/A no 0.449 0.348 0.308 2e-26
Q7XBQ9970 Disease resistance protei N/A no 0.443 0.350 0.317 2e-25
Q7XA40992 Putative disease resistan N/A no 0.422 0.326 0.290 2e-24
O23530 1301 Protein SUPPRESSOR OF npr no no 0.455 0.268 0.27 4e-13
P23799630 Putative adenylate cyclas N/A no 0.385 0.468 0.263 1e-07
P26337630 Putative adenylate cyclas N/A no 0.356 0.433 0.263 8e-07
Q9SZ67 1895 Probable WRKY transcripti no no 0.312 0.126 0.278 2e-06
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function desciption
 Score =  272 bits (695), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 243/815 (29%), Positives = 386/815 (47%), Gaps = 114/815 (13%)

Query: 1    MPVGIGRLTCLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKCVGDAKEAQLD 60
            MP GI +L  LQ L NFV+G+ SG+GL ELK L+HL GTL IS+L+NV    +AK+A L 
Sbjct: 658  MPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLK 717

Query: 61   GKKNLRELLLRWALN----TDGSSSREAKTENDVLDMLKPHEILEQFCISGYGGTKFPAW 116
             K  L  L+L+W +       GS +  A  + +VL ML+PH  L+ FCI  Y G  FP W
Sbjct: 718  RKPFLDGLILKWTVKGSGFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKW 777

Query: 117  LGDSSLPNLVTLKFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFY---GNDPPI 173
            LGDSS   + ++   +C++C +LP VGQLPSLK+L++   + ++++G +F+    N   +
Sbjct: 778  LGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRGV 837

Query: 174  PFPCLETLIFENMREWEDWISHGSSQRVVEGFPKLRELHILRCSKLKGPFPEHLPALEML 233
            PF  L+ L F  M  W++WI       +   FP L++L I RC  L+  FPE LP+   +
Sbjct: 838  PFQSLQILKFYGMPRWDEWICPELEDGI---FPCLQKLIIQRCPSLRKKFPEGLPSSTEV 894

Query: 234  VIEGCEELSV----------------SVSSLPALCKLQI----GGCKKVVWESATGHLGS 273
             I  C   +V                S +S+P++ + ++    G  K     SA     S
Sbjct: 895  TISDCPLRAVSGGENSFRRSLTNIPESPASIPSMSRRELSSPTGNPKSDASTSAQPGFAS 954

Query: 274  QNSVVCRDASNQV-----FLAGPLKPQLPKLEELEI------NDMKEHTYIWKSHNGLLQ 322
             +     +  N+V       + P   Q    ++ E          +E   I   ++G + 
Sbjct: 955  SSQ---SNDDNEVTSTSSLSSLPKDRQTEDFDQYETQLGSLPQQFEEPAVISARYSGYIS 1011

Query: 323  DSCSLKRLTIASCPKLQSLVAEEEKDQQQQLCELSCRLEYLRLSGCQGLVKLPQSSLSLS 382
            D  S    T++      SLV + +   +  +   S   +Y +  G +  V  P+SS ++ 
Sbjct: 1012 DIPS----TLSPYMSRTSLVPDPK--NEGSILPGSSSYQYHQY-GIKSSVPSPRSSEAIK 1064

Query: 383  SLREIEIYGCWSLVSFPEVA----LPSKLRKIEICSCDALKSLPEAWMCDTNSSLEILME 438
              +  +       +   +++    LP  L+ + I SCD L SLPE       +  E+L+ 
Sbjct: 1065 PSQYDDDETDMEYLKVTDISHLMELPQNLQSLHIDSCDGLTSLPENLTESYPNLHELLII 1124

Query: 439  EGIQRSSSSRRYTSSLLEKLEIESCRSLTCIFSKNELP----ATLESLEVG-------NL 487
                  S    +  + L+ L I  C+ L   F+++  P    + LE L +G       N 
Sbjct: 1125 ACHSLESFPGSHPPTTLKTLYIRDCKKLN--FTESLQPTRSYSQLEYLFIGSSCSNLVNF 1182

Query: 488  P----PSLKSLHVLSCSKLESIAERL---DNNTSLETIDICYCGNLKNLPSGLHNLHQLQ 540
            P    P L+SL +  C   ++ +      D+  +LE+++I  C NL              
Sbjct: 1183 PLSLFPKLRSLSIRDCESFKTFSIHAGLGDDRIALESLEIRDCPNL-------------- 1228

Query: 541  EISIGRCGNLESFPEGGLPCAKLSKLRIHGCERLEALPKGLHNLTSLQELTIGRGVELPS 600
                      E+FP+GGLP  KLS + +  C++L+ALP+ L  LTSL  L I +  E+ +
Sbjct: 1229 ----------ETFPQGGLPTPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFIIKCPEIET 1278

Query: 601  LEEDGLPTNLHSLWIAGNMEIWKSTIEWGRGFHRFSSLRQLRISGCDDDMVSFPPKADDI 660
            +   G P+NL +L I+   ++    IEW  G     +LR L I G ++D+ SFP +    
Sbjct: 1279 IPGGGFPSNLRTLCISLCDKL-TPRIEW--GLRDLENLRNLEIDGGNEDIESFPEEG--- 1332

Query: 661  RLGTALPLPASLTSLLIFSFPNLERLS-SSIVDLQNLTELYLEDCPKLKYFPEKGLPSSL 719
                   LP S+ SL I  F NL+ L+     D + +  + +  C KL+   ++ LP  L
Sbjct: 1333 ------LLPKSVFSLRISRFENLKTLNRKGFHDTKAIETMEISGCDKLQISIDEDLP-PL 1385

Query: 720  LQLYIGGCPLIAEKCRKDGGQYWDLLTHIPYVVID 754
              L I  C L+ E   +   +++ +L +IPYV ID
Sbjct: 1386 SCLRISSCSLLTETFAEVETEFFKVL-NIPYVEID 1419
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|P23799|ESAG8_TRYBB Putative adenylate cyclase regulatory protein OS=Trypanosoma brucei brucei GN=ESAG8 PE=2 SV=1 Back     alignment and function description
>sp|P26337|ESA8C_TRYEQ Putative adenylate cyclase regulatory protein OS=Trypanosoma equiperdum GN=ESAG8C PE=2 SV=1 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query766
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.955 0.514 0.408 1e-129
45826061739 resistance protein [Quercus suber] 0.932 0.966 0.412 1e-126
356554923 1399 PREDICTED: putative disease resistance R 0.925 0.506 0.397 1e-124
296085123 1278 unnamed protein product [Vitis vinifera] 0.894 0.535 0.381 1e-117
400131587 1388 FB_MR5 [Malus x robusta] 0.917 0.506 0.398 1e-114
359487253 1390 PREDICTED: putative disease resistance p 0.895 0.493 0.363 1e-112
225449649 1418 PREDICTED: putative disease resistance p 0.903 0.488 0.373 1e-109
255556671 1318 Disease resistance protein RPS2, putativ 0.886 0.515 0.364 1e-105
224059590 1381 cc-nbs-lrr resistance protein [Populus t 0.903 0.501 0.361 1e-102
147770925 1361 hypothetical protein VITISV_018147 [Viti 0.853 0.480 0.356 1e-101
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
 Score =  470 bits (1209), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 320/784 (40%), Positives = 444/784 (56%), Gaps = 52/784 (6%)

Query: 1    MPVGIGRLTCLQTLCNFVVGKG-SGSGLRELKLLTHLHGTLNISKLENVKCVGDAKEAQL 59
            MP+ IG L+ LQTL NFVVGK  S   +REL  L HL GTL ISKLENV    +A+++ L
Sbjct: 666  MPLSIGNLSSLQTLSNFVVGKADSFCVIRELGPLVHLRGTLCISKLENVTKAQEARDSYL 725

Query: 60   DGKKNLRELLLRWALNTDGSSSREAKTENDVLDMLKPHEILEQFCISGYGGTKFPAWLGD 119
             GK++L E+++ W+ N + S   E + E  VL+ML+P+  L++  +  YGGTKFP W+GD
Sbjct: 726  YGKQDLNEVVMEWSSNLNESQDEETQLE--VLNMLQPNVKLKELTVKCYGGTKFPTWIGD 783

Query: 120  SSLPNLVTLKFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDPPIPFPCLE 179
             S  NLV L+FENCD C +LP VGQLP LK L + GM+ VK +G EFYG     PF  LE
Sbjct: 784  PSFSNLVLLRFENCDNCNSLPPVGQLPFLKDLLIKGMAGVKSVGREFYGESCSRPFQSLE 843

Query: 180  TLIFENMREWEDWISHGSSQRVVEGFPKLRELHILRCSKLKGPFPEHLPALEMLVIEGCE 239
            TL FE+M  W +WI  G    V E F  L +L I+RC  L    P+HLP+L+ LVI GC 
Sbjct: 844  TLHFEDMPRWVNWIPLG----VNEAFACLHKLSIIRCHNLVRKLPDHLPSLKKLVIHGCW 899

Query: 240  ELSVSVSSLPALCKLQIGGCKKVVWESATGHLGSQNSVVCRDASNQVFLAGPLKPQLPKL 299
             + VSVS+LP LC L I GCK+V  ES+ G  GS  S+     S        L   + K+
Sbjct: 900  NMVVSVSNLPMLCVLVIEGCKRVECESSVG-FGSPYSMAFSKISEFGNATAGLMHGVSKV 958

Query: 300  EELEINDMKEHTYIWKSHNGLLQDSCSLKRLTIASCPKLQSLVAEEEKDQQQQLCELSCR 359
            E L+I D ++ T +W+     L     L+ L+I  CP L S  A                
Sbjct: 959  EYLKIVDSEKLTTLWEKIPEGLHRLKFLRELSIEDCPTLVSFPAS----------GFPSM 1008

Query: 360  LEYLRLSGCQGLVK-LPQSSLSL---SSLREIEIYGCWSLVSFPEVALPSKLRKIEICSC 415
            L+ +++  C GL   LP+ +L     + L  + +  C S+ S     LP+ L+K+EI  C
Sbjct: 1009 LKVIQIKSCSGLKSLLPEGTLHSRENACLERLCVVRCDSMKSIARGQLPTTLKKLEISHC 1068

Query: 416  DALKSLPEAWMCDTNSSLEILMEEGIQRSSSSRRYTSSLLEKLEIESCRSLTCIFSKNEL 475
              L+ + +    + +SS   + +E I   S +       L+ L+I+SC SLT + S  +L
Sbjct: 1069 MNLQCVLDE--GEGSSSSSGMHDEDINNRSKTH------LQYLDIKSCPSLTTLTSSGKL 1120

Query: 476  PATLESL------------EVGNLPPSLKSLHVLSCSKLESIAERLDNNTSLETIDICYC 523
            PATL  L              G LP +L+ L + S SKL+ IAERL  NTSLE I I  C
Sbjct: 1121 PATLTHLLLRECPKLMCLSSTGKLPAALQYLEIQSISKLQKIAERLHQNTSLECIKIWNC 1180

Query: 524  GNLKNLPSGLHNLHQLQEISIGRCGNLESFPEGGLPCAKLSKLRIHGCERLEALPKGLHN 583
              LK+LP  LHNL +L++  I  C +  SFP  GLP + L  L I  C+ L+ALP G+ N
Sbjct: 1181 HGLKSLPEDLHNLSKLRQFLIFWCQSFSSFPAAGLP-SNLRVLGIKNCKNLKALPNGMRN 1239

Query: 584  LTSLQELTIGRGVE-LPSLEEDGLPTNLHSLWIAGNMEIWKSTIEWGRGFHRFSSLRQLR 642
            LTSLQ+L I   ++ LPS +E GLPTNL  L +  +++ +K   EW  G  + +SL +L 
Sbjct: 1240 LTSLQKLDISHRLDSLPSPQE-GLPTNLIELNMH-DLKFYKPMFEW--GLQQPTSLIKLS 1295

Query: 643  ISGCDDDMVSFPPKADDIRLGTALPLPASLTSLLIFSFPNLERLS-SSIVDLQNLTELYL 701
            I G   D+ S+P + ++   G  + LP SL+ L I  F NLE LS     +L +L +L +
Sbjct: 1296 IHGECLDVDSYPGEREN---GVMMLLPNSLSILCISYFQNLECLSPKGFQNLTSLNQLKI 1352

Query: 702  EDCPKLKYFPEKGLPSSLLQLYIGGCPLIAEKCRKDGGQYWDLLTHIPYVVIDRKWVFDD 761
             +C KL   P++GLP SL QL I  CPL+++ C  + GQ W  + HIP V+ID K++ + 
Sbjct: 1353 YNCLKLTSLPKEGLPPSLTQLEIRNCPLLSQHCNNEKGQEWSKIAHIPCVLIDNKFIHET 1412

Query: 762  DSTE 765
             +T+
Sbjct: 1413 VTTD 1416

Source: Quercus suber

Species: Quercus suber

Genus: Quercus

Family: Fagaceae

Order: Fagales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|45826061|gb|AAS77675.1| resistance protein [Quercus suber] Back     alignment and taxonomy information
>gi|356554923|ref|XP_003545790.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|296085123|emb|CBI28618.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] Back     alignment and taxonomy information
>gi|359487253|ref|XP_003633548.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255556671|ref|XP_002519369.1| Disease resistance protein RPS2, putative [Ricinus communis] gi|223541436|gb|EEF42986.1| Disease resistance protein RPS2, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224059590|ref|XP_002299922.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222847180|gb|EEE84727.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147770925|emb|CAN69703.1| hypothetical protein VITISV_018147 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query766
TAIR|locus:20916621424 AT3G14460 [Arabidopsis thalian 0.314 0.169 0.414 6.9e-68
TAIR|locus:20916721054 AT3G14470 [Arabidopsis thalian 0.305 0.222 0.408 1e-41
UNIPROTKB|O486471802 O48647 "XA1" [Oryza sativa (ta 0.720 0.306 0.257 2.6e-09
TAIR|locus:2163426 1187 TAO1 "target of AVRB operation 0.366 0.236 0.299 3.5e-17
TAIR|locus:2053405 1215 AT2G14080 [Arabidopsis thalian 0.342 0.215 0.291 2.9e-16
TAIR|locus:2147992 1189 AT5G11250 [Arabidopsis thalian 0.373 0.240 0.276 5.2e-14
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.379 0.146 0.269 4.9e-13
TAIR|locus:20981101219 AT3G44670 [Arabidopsis thalian 0.267 0.168 0.280 1.4e-13
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.492 0.291 0.261 1.9e-12
TAIR|locus:2205804 1556 AT1G27180 [Arabidopsis thalian 0.464 0.228 0.249 7.5e-08
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 474 (171.9 bits), Expect = 6.9e-68, Sum P(2) = 6.9e-68
 Identities = 104/251 (41%), Positives = 149/251 (59%)

Query:     1 MPVGIGRLTCLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKCVGDAKEAQLD 60
             MP GI +L  LQ L NFV+G+ SG+GL ELK L+HL GTL IS+L+NV    +AK+A L 
Sbjct:   658 MPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLK 717

Query:    61 GKKNLRELLLRWALN----TDGSSSREAKTENDVLDMLKPHEILEQFCISGYGGTKFPAW 116
              K  L  L+L+W +       GS +  A  + +VL ML+PH  L+ FCI  Y G  FP W
Sbjct:   718 RKPFLDGLILKWTVKGSGFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKW 777

Query:   117 LGDSSLPNLVTLKFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFY---GNDPPI 173
             LGDSS   + ++   +C++C +LP VGQLPSLK+L++   + ++++G +F+    N   +
Sbjct:   778 LGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRGV 837

Query:   174 PFPCLETLIFENMREWEDWISHGSSQRVVEGFPKLRELHILRCSKLKGPFPEHLPALEML 233
             PF  L+ L F  M  W++WI       +   FP L++L I RC  L+  FPE LP+   +
Sbjct:   838 PFQSLQILKFYGMPRWDEWICPELEDGI---FPCLQKLIIQRCPSLRKKFPEGLPSSTEV 894

Query:   234 VIEGCEELSVS 244
              I  C   +VS
Sbjct:   895 TISDCPLRAVS 905
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098110 AT3G44670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00010803001
SubName- Full=Chromosome chr13 scaffold_286, whole genome shotgun sequence; (1418 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query766
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-13
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-13
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-09
PRK15386426 PRK15386, PRK15386, type III secretion protein Gog 3e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 73.4 bits (180), Expect = 3e-13
 Identities = 63/219 (28%), Positives = 97/219 (44%), Gaps = 44/219 (20%)

Query: 513 TSLETIDICYCGNLKNLPSGLHNLHQLQEISIGRCGNLESFPEGGLPCAKLSKLRIHGCE 572
           T+LET+ +  C +L  LPS +  L++L+++ + RC NLE  P  G+    L +L + GC 
Sbjct: 657 TNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPT-GINLKSLYRLNLSGCS 715

Query: 573 RLEALPKGLHNLTSLQELTIGRGVELPSLEEDGLPTNLH--SLWIAGNMEIWKSTIEWGR 630
           RL++ P    N++ L        ++  ++EE   P+NL   +L      E+ KS   W R
Sbjct: 716 RLKSFPDISTNISWLD-------LDETAIEE--FPSNLRLENLDELILCEM-KSEKLWER 765

Query: 631 GFHRFSSLRQLRISGCDDDMVSFPPKADDIRLGTAL--PLPASLTSLLIFSFPNLERLSS 688
                                        ++  T L   L  SLT L +   P+L  L S
Sbjct: 766 -----------------------------VQPLTPLMTMLSPSLTRLFLSDIPSLVELPS 796

Query: 689 SIVDLQNLTELYLEDCPKLKYFPEKGLPSSLLQLYIGGC 727
           SI +L  L  L +E+C  L+  P      SL  L + GC
Sbjct: 797 SIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGC 835

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 766
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.92
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.91
PLN032101153 Resistant to P. syringae 6; Provisional 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.9
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.65
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.59
KOG4237498 consensus Extracellular matrix protein slit, conta 99.52
KOG0617264 consensus Ras suppressor protein (contains leucine 99.47
KOG4237498 consensus Extracellular matrix protein slit, conta 99.46
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.42
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.39
KOG0617264 consensus Ras suppressor protein (contains leucine 99.31
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.23
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.15
KOG4341483 consensus F-box protein containing LRR [General fu 99.08
KOG4341483 consensus F-box protein containing LRR [General fu 99.01
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.85
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.69
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.64
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.62
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.58
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.55
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.48
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.45
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.45
PRK15386 426 type III secretion protein GogB; Provisional 98.45
PRK15386426 type III secretion protein GogB; Provisional 98.43
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.4
PLN03150623 hypothetical protein; Provisional 98.38
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.38
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.31
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.25
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.24
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.21
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.21
PLN03150623 hypothetical protein; Provisional 98.14
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.04
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.99
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.84
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.55
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.54
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.53
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.51
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.4
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.33
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.24
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.13
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.11
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.01
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.76
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.7
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.6
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 96.59
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 95.98
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.92
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 95.25
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.03
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.62
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.18
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.76
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.59
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.31
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.78
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 90.55
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.38
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 90.26
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.3e-40  Score=394.98  Aligned_cols=527  Identities=17%  Similarity=0.164  Sum_probs=344.8

Q ss_pred             CcceEEEEecCCC-CCCccccCCCCCCeeEEEEecCCCCCCCCC--CCCcCcccceeecCCCCceecCcccccCCCCCCC
Q 042439           99 ILEQFCISGYGGT-KFPAWLGDSSLPNLVTLKFENCDMCTALPS--VGQLPSLKHLAVCGMSRVKRLGSEFYGNDPPIPF  175 (766)
Q Consensus        99 ~L~~L~l~~~~~~-~lp~~~~~~~l~~L~~L~L~~~~~~~~l~~--l~~l~~L~~L~L~~~~~~~~~~~~~~~~~~~~~~  175 (766)
                      +++.|+++++.+. .+|..+  ..+++|++|+|++|.+.+.+|.  +..+++|++|++++|+....        .|...+
T Consensus        70 ~v~~L~L~~~~i~~~~~~~~--~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~--------~p~~~l  139 (968)
T PLN00113         70 RVVSIDLSGKNISGKISSAI--FRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGS--------IPRGSI  139 (968)
T ss_pred             cEEEEEecCCCccccCChHH--hCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccc--------cCcccc
Confidence            5666666655433 223333  3466666666666665555553  34666666666665442222        122225


Q ss_pred             CCccEEeccCccchhhhhccCCCccccccCcccceecccccccccCCCCC---CCCCccEEEEecCCC---cccccCCCC
Q 042439          176 PCLETLIFENMREWEDWISHGSSQRVVEGFPKLRELHILRCSKLKGPFPE---HLPALEMLVIEGCEE---LSVSVSSLP  249 (766)
Q Consensus       176 ~~L~~L~l~~~~~l~~~~~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~p~---~l~~L~~L~l~~~~~---l~~~~~~~~  249 (766)
                      ++|++|++++|.....      .+..++.+++|++|++++|. +.+.+|.   .+++|++|++++|..   +...++.++
T Consensus       140 ~~L~~L~Ls~n~~~~~------~p~~~~~l~~L~~L~L~~n~-l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~  212 (968)
T PLN00113        140 PNLETLDLSNNMLSGE------IPNDIGSFSSLKVLDLGGNV-LVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMK  212 (968)
T ss_pred             CCCCEEECcCCccccc------CChHHhcCCCCCEEECccCc-ccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcC
Confidence            6666666666653211      34455566666666666653 4434553   355666666666652   223455667


Q ss_pred             ccceEEEcCCCCceeeccccccCCCCceeeccCCccccccCCCCCCCCCccEEEecccCCccchhcccCccccCCCCCCE
Q 042439          250 ALCKLQIGGCKKVVWESATGHLGSQNSVVCRDASNQVFLAGPLKPQLPKLEELEINDMKEHTYIWKSHNGLLQDSCSLKR  329 (766)
Q Consensus       250 ~L~~L~l~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~L~~L~~~~l~~~~~~~~~~~~~~~~~~~L~~  329 (766)
                      +|+.|++++|.                           +.+.+|..+.++++|+.++++++.... ..+..+..+++|++
T Consensus       213 ~L~~L~L~~n~---------------------------l~~~~p~~l~~l~~L~~L~L~~n~l~~-~~p~~l~~l~~L~~  264 (968)
T PLN00113        213 SLKWIYLGYNN---------------------------LSGEIPYEIGGLTSLNHLDLVYNNLTG-PIPSSLGNLKNLQY  264 (968)
T ss_pred             CccEEECcCCc---------------------------cCCcCChhHhcCCCCCEEECcCceecc-ccChhHhCCCCCCE
Confidence            77777777665                           334445455555555555555554422 22345677778888


Q ss_pred             EEEccCCCccccchhhhHHHHhhhhhccCcccEEEeecCCCCcccCcccCCCCCccEEEecCCCCCcccCC-CCCCCCcc
Q 042439          330 LTIASCPKLQSLVAEEEKDQQQQLCELSCRLEYLRLSGCQGLVKLPQSSLSLSSLREIEIYGCWSLVSFPE-VALPSKLR  408 (766)
Q Consensus       330 L~l~~~~~l~~l~~~~~~~~~~~l~~~~~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~L~~~~~l~~~~~-~~~l~~L~  408 (766)
                      |+++++.....++..     +..    +++|++|++++|.+.+.+|..+.++++|++|++++|...+.+|. ...+++|+
T Consensus       265 L~L~~n~l~~~~p~~-----l~~----l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~  335 (968)
T PLN00113        265 LFLYQNKLSGPIPPS-----IFS----LQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQ  335 (968)
T ss_pred             EECcCCeeeccCchh-----Hhh----ccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCC
Confidence            888776433333221     112    26888888888887777777778888888888888876665553 44578888


Q ss_pred             eEEEccCCCCCccccccccCcchhHHHHHHhccccCcCcccccCCceeEEEecCCCCccccccCCCCccccccccccCCC
Q 042439          409 KIEICSCDALKSLPEAWMCDTNSSLEILMEEGIQRSSSSRRYTSSLLEKLEIESCRSLTCIFSKNELPATLESLEVGNLP  488 (766)
Q Consensus       409 ~L~l~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~l~~l~~~~~~  488 (766)
                      .|++++|.....+|..                        +..+++|+.|++++|.--.      .+|..+..+      
T Consensus       336 ~L~L~~n~l~~~~p~~------------------------l~~~~~L~~L~Ls~n~l~~------~~p~~~~~~------  379 (968)
T PLN00113        336 VLQLWSNKFSGEIPKN------------------------LGKHNNLTVLDLSTNNLTG------EIPEGLCSS------  379 (968)
T ss_pred             EEECcCCCCcCcCChH------------------------HhCCCCCcEEECCCCeeEe------eCChhHhCc------
Confidence            8888887765555543                        2335678888888764211      122222221      


Q ss_pred             CCcceeeecCCCchhhhHhhcCCCCCCCEEEeeeCCCCCcccccccCCCCCCEEEecCCCCccccCCCCCCCCCcceEEe
Q 042439          489 PSLKSLHVLSCSKLESIAERLDNNTSLETIDICYCGNLKNLPSGLHNLHQLQEISIGRCGNLESFPEGGLPCAKLSKLRI  568 (766)
Q Consensus       489 ~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~lp~~l~~l~~L~~L~l~~~~~l~~l~~~~~~~~~L~~L~l  568 (766)
                      ++|+.|++++|.....+|..++.+++|+.|++++|...+.+|..+..+++|+.|++++|...+.+|..+..+++|+.|++
T Consensus       380 ~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L  459 (968)
T PLN00113        380 GNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSL  459 (968)
T ss_pred             CCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEEC
Confidence            67888888888888788888888888888888888877777888888888888888888777777766677888888888


Q ss_pred             ccCcCccccCccCCCCCCCCeeEecCCCCCCCCCC-CCCCCCcceeEeccccccchhhhhcccccCCCCCCcEEEEeccC
Q 042439          569 HGCERLEALPKGLHNLTSLQELTIGRGVELPSLEE-DGLPTNLHSLWIAGNMEIWKSTIEWGRGFHRFSSLRQLRISGCD  647 (766)
Q Consensus       569 ~~~~~~~~~p~~~~~l~~L~~L~l~~~~~l~~~~~-~~~~~~L~~L~l~~N~~~l~~~~~~~~~~~~l~~L~~L~l~~~~  647 (766)
                      ++|.+.+.+|..+ ..++|+.|++++|.....++. ...+++|++|++++|    ......|..+..+++|+.|++++|.
T Consensus       460 ~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N----~l~~~~p~~~~~l~~L~~L~Ls~N~  534 (968)
T PLN00113        460 ARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSEN----KLSGEIPDELSSCKKLVSLDLSHNQ  534 (968)
T ss_pred             cCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhccCEEECcCC----cceeeCChHHcCccCCCEEECCCCc
Confidence            8888887777654 457888888888876555443 356788888888885    2333445557888899999998863


Q ss_pred             CCCccCCCCcccccccCCCCCccccceEEeccCCCCccchhhhccCCCcceeecccCcCcccCCCCCcccccceeeecCC
Q 042439          648 DDMVSFPPKADDIRLGTALPLPASLTSLLIFSFPNLERLSSSIVDLQNLTELYLEDCPKLKYFPEKGLPSSLLQLYIGGC  727 (766)
Q Consensus       648 ~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~~L~~L~i~~~  727 (766)
                       ....+|..+         ..+++|+.|++++|+....+|..+..+++|+++++++|+....+|..+.+.++....+.+|
T Consensus       535 -l~~~~p~~~---------~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n  604 (968)
T PLN00113        535 -LSGQIPASF---------SEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGN  604 (968)
T ss_pred             -ccccCChhH---------hCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCC
Confidence             334555544         4678899999998655557888888889999999999888788887665556666666666


Q ss_pred             hhH
Q 042439          728 PLI  730 (766)
Q Consensus       728 ~~l  730 (766)
                      +.+
T Consensus       605 ~~l  607 (968)
T PLN00113        605 IDL  607 (968)
T ss_pred             ccc
Confidence            643

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query766
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 6e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 74/178 (41%), Gaps = 33/178 (18%)
Query: 394 SLVSFPEVALPS------KLRKIEICSCDALKSLPEAWMCDTNSSLEILMEEGIQXXXXX 447
           +L   P  ALP+      +LR++ I +C  L  LPE  +  T++S E      +Q     
Sbjct: 133 TLARNPLRALPASIASLNRLRELSIRACPELTELPEP-LASTDASGEHQGLVNLQSL--- 188
Query: 448 XXXXXXLLEKLEIESCRSLTCIFSKNELPATLESLEVGNLP-----------PSLKSLHV 496
                    +LE    RSL    +  +    L+SL++ N P           P L+ L +
Sbjct: 189 ---------RLEWTGIRSLPASIANLQ---NLKSLKIRNSPLSALGPAIHHLPKLEELDL 236
Query: 497 LSCSKLESIAERLDNNTSLETIDICYCGNLKNLPSGLHNLHQLQEISIGRCGNLESFP 554
             C+ L +          L+ + +  C NL  LP  +H L QL+++ +  C NL   P
Sbjct: 237 RGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLP 294

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query766
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-11
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-11
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  100 bits (250), Expect = 4e-23
 Identities = 72/380 (18%), Positives = 114/380 (30%), Gaps = 90/380 (23%)

Query: 360 LEYLRLSGCQGLVKLPQSSLSLSSLREIEIYGCWSLVSFPEVALPSKLRKIEICSCDALK 419
            E L   G   L                +     S          S   +IE  +  ALK
Sbjct: 14  RENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQAN----SNNPQIETRTGRALK 69

Query: 420 SLPEAWMCDTNSSLEILMEEGIQRSSSSRRYTSSLLEKLEIESCRSLTCIFSKNELPATL 479
           +  +         LE                T      LE+ S   L       + P   
Sbjct: 70  ATAD--------LLEDA--------------TQPGRVALELRSV-PLP------QFPDQA 100

Query: 480 ESLEVGNLPPSLKSLHVLSCSKLESIAERLDNNTSLETIDICYCGNLKNLPSGLHNLHQL 539
             L        L+ +  +  + L  + + +     LET+ +     L+ LP+ + +L++L
Sbjct: 101 FRLS------HLQHMT-IDAAGLMELPDTMQQFAGLETLTLARN-PLRALPASIASLNRL 152

Query: 540 QEISIGRCGNLESFPE---------GGLPCAKLSKLRIHGCERLEALPKGLHNLTSLQEL 590
           +E+SI  C  L   PE                L  LR+     + +LP  + NL +L+ L
Sbjct: 153 RELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWT-GIRSLPASIANLQNLKSL 211

Query: 591 TIGRGVELPSLEEDGLPTNLHSLWIAGNMEIWKSTIEWGRGFHRFSSLRQLRISGCDDDM 650
            I        L    L   +H L                        L +L + GC   +
Sbjct: 212 KIRNS----PLSA--LGPAIHHL----------------------PKLEELDLRGCTA-L 242

Query: 651 VSFPPKADDIRLGTALPLPASLTSLLIFSFPNLERLSSSIVDLQNLTELYLEDCPKLKYF 710
            ++PP       G      A L  L++    NL  L   I  L  L +L L  C  L   
Sbjct: 243 RNYPPI-----FGGR----APLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRL 293

Query: 711 PEK-GLPSSLLQLYIGGCPL 729
           P       +   + +     
Sbjct: 294 PSLIAQLPANCIILVPPHLQ 313
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query766
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.98
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.84
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.84
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.81
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.8
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.8
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.78
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.77
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.77
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.77
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.75
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.74
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.74
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.73
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.71
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.71
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.69
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.68
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.68
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.67
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.67
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.67
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.66
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.66
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.64
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.62
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.62
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.6
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.6
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.6
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.54
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.54
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.53
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.52
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.49
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.49
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.48
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.46
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.45
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.45
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.43
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.39
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.37
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.37
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.37
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.36
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.33
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.32
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.32
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.31
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.3
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.26
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.26
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.26
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.26
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.25
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.22
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.22
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.2
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.18
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.14
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.13
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.11
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.03
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.99
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.98
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.97
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.97
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.97
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.95
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.95
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.88
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.82
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.79
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.75
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.73
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.71
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.7
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.66
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.65
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.37
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.34
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.33
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.3
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.24
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.22
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.15
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.9
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.8
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.43
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.31
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.72
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.66
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 91.84
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 91.84
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 85.98
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=7.9e-50  Score=464.42  Aligned_cols=630  Identities=17%  Similarity=0.098  Sum_probs=450.8

Q ss_pred             CCCCCCCccCCcCCceEeCcCC-CCChhcccccccCCceeEecCCCCcCChhhhhhh--ccCCCCCCCceEEEecCCCCC
Q 042439            2 PVGIGRLTCLQTLCNFVVGKGS-GSGLRELKLLTHLHGTLNISKLENVKCVGDAKEA--QLDGKKNLRELLLRWALNTDG   78 (766)
Q Consensus         2 P~~i~~l~~L~~L~~~~~~~~~-~~~~~~l~~L~~L~g~L~l~~l~~~~~~~~~~~~--~l~~l~~L~~L~L~~~~~~~~   78 (766)
                      |..+++|+.|+.+.   ..... ...+..++.+++|+ .|++.+..    .....+.  .++.+++|++|+|++|.... 
T Consensus        70 ~~~l~~L~~L~~l~---~~~~~~~~l~~~~~~l~~L~-~L~Ls~n~----l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~-  140 (768)
T 3rgz_A           70 SSSLLSLTGLESLF---LSNSHINGSVSGFKCSASLT-SLDLSRNS----LSGPVTTLTSLGSCSGLKFLNVSSNTLDF-  140 (768)
T ss_dssp             HHHTTTCTTCCEEE---CTTSCEEECCCCCCCCTTCC-EEECCSSE----EEEEGGGGGGGGGCTTCCEEECCSSEEEC-
T ss_pred             ChhHhccCcccccC---CcCCCcCCCchhhccCCCCC-EEECCCCc----CCCcCCChHHHhCCCCCCEEECcCCccCC-
Confidence            34566776666663   22211 11235688888888 88887632    2333444  78899999999998764311 


Q ss_pred             CCccchhhHHHHhhc-CCCCCCcceEEEEecCCCCCCc-c---ccCCCCCCeeEEEEecCCCCCCCCCCCCcCcccceee
Q 042439           79 SSSREAKTENDVLDM-LKPHEILEQFCISGYGGTKFPA-W---LGDSSLPNLVTLKFENCDMCTALPSVGQLPSLKHLAV  153 (766)
Q Consensus        79 ~~~~~~~~~~~~~~~-l~~~~~L~~L~l~~~~~~~lp~-~---~~~~~l~~L~~L~L~~~~~~~~l~~l~~l~~L~~L~L  153 (766)
                                ..+.. +..+++|++|++++|.+...+. +   +  ..+++|++|++++|.+.+..+ ++.+++|++|++
T Consensus       141 ----------~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~--~~l~~L~~L~Ls~n~l~~~~~-~~~l~~L~~L~L  207 (768)
T 3rgz_A          141 ----------PGKVSGGLKLNSLEVLDLSANSISGANVVGWVLS--DGCGELKHLAISGNKISGDVD-VSRCVNLEFLDV  207 (768)
T ss_dssp             ----------CSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHT--TCCTTCCEEECCSSEEESCCB-CTTCTTCCEEEC
T ss_pred             ----------cCCHHHhccCCCCCEEECCCCccCCcCChhhhhh--ccCCCCCEEECCCCcccccCC-cccCCcCCEEEC
Confidence                      12222 3677899999999888765433 2   3  468999999999998655444 488999999999


Q ss_pred             cCCCCceecCcccccCCCCCCCCCccEEeccCccchhhhhccCCCccccccCcccceecccccccccCCCCC-CCCCccE
Q 042439          154 CGMSRVKRLGSEFYGNDPPIPFPCLETLIFENMREWEDWISHGSSQRVVEGFPKLRELHILRCSKLKGPFPE-HLPALEM  232 (766)
Q Consensus       154 ~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~p~-~l~~L~~  232 (766)
                      ++|.....++. + +     .+++|++|++++|.....      .+..+..+++|++|++++|. +++.+|. .+++|++
T Consensus       208 s~n~l~~~~~~-l-~-----~l~~L~~L~Ls~n~l~~~------~~~~l~~l~~L~~L~Ls~n~-l~~~~~~~~l~~L~~  273 (768)
T 3rgz_A          208 SSNNFSTGIPF-L-G-----DCSALQHLDISGNKLSGD------FSRAISTCTELKLLNISSNQ-FVGPIPPLPLKSLQY  273 (768)
T ss_dssp             CSSCCCSCCCB-C-T-----TCCSCCEEECCSSCCCSC------HHHHTTTCSSCCEEECCSSC-CEESCCCCCCTTCCE
T ss_pred             cCCcCCCCCcc-c-c-----cCCCCCEEECcCCcCCCc------ccHHHhcCCCCCEEECCCCc-ccCccCccccCCCCE
Confidence            98764433332 2 2     289999999999875322      45667889999999998885 5545553 6789999


Q ss_pred             EEEecCCC---cccccCC-CCccceEEEcCCCCceeeccccccCCCCceeeccCCccccccCCCCCCCCCccEEEecccC
Q 042439          233 LVIEGCEE---LSVSVSS-LPALCKLQIGGCKKVVWESATGHLGSQNSVVCRDASNQVFLAGPLKPQLPKLEELEINDMK  308 (766)
Q Consensus       233 L~l~~~~~---l~~~~~~-~~~L~~L~l~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~L~~L~~~~l~  308 (766)
                      |++++|..   +...+.. +++|++|++++|.                           +.+.+|..+.++..|+.++++
T Consensus       274 L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~---------------------------l~~~~p~~~~~l~~L~~L~L~  326 (768)
T 3rgz_A          274 LSLAENKFTGEIPDFLSGACDTLTGLDLSGNH---------------------------FYGAVPPFFGSCSLLESLALS  326 (768)
T ss_dssp             EECCSSEEEESCCCCSCTTCTTCSEEECCSSE---------------------------EEECCCGGGGGCTTCCEEECC
T ss_pred             EECcCCccCCccCHHHHhhcCcCCEEECcCCc---------------------------CCCccchHHhcCCCccEEECC
Confidence            99998863   2233333 4899999999986                           334455556666666666666


Q ss_pred             CccchhcccCccccCCCCCCEEEEccCCCccccchhhhHHHHhhhhhccCcccEEEeecCCCCcccCcccCC--CCCccE
Q 042439          309 EHTYIWKSHNGLLQDSCSLKRLTIASCPKLQSLVAEEEKDQQQQLCELSCRLEYLRLSGCQGLVKLPQSSLS--LSSLRE  386 (766)
Q Consensus       309 ~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~~~~~~l~~~~~~L~~L~L~~~~~~~~~~~~~~~--l~~L~~  386 (766)
                      ++...+.++...+..+++|++|++++|.-...++...     .   ...++|++|++++|.+.+.+|..+..  +++|++
T Consensus       327 ~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l-----~---~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~  398 (768)
T 3rgz_A          327 SNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL-----T---NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQE  398 (768)
T ss_dssp             SSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTH-----H---HHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCE
T ss_pred             CCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHH-----H---hhhcCCcEEEccCCCcCCCcChhhhhcccCCccE
Confidence            6665444565668889999999999875333444321     1   11238999999999888878877766  788999


Q ss_pred             EEecCCCCCcccCC-CCCCCCcceEEEccCCCCCccccccccCcchhHHHHHHhccccCcCcccccCCceeEEEecCCCC
Q 042439          387 IEIYGCWSLVSFPE-VALPSKLRKIEICSCDALKSLPEAWMCDTNSSLEILMEEGIQRSSSSRRYTSSLLEKLEIESCRS  465 (766)
Q Consensus       387 L~L~~~~~l~~~~~-~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~L~~L~l~~c~~  465 (766)
                      |++++|...+.+|. ...+++|++|++++|...+.+|..                        +..+++|+.|++++|.-
T Consensus       399 L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~------------------------l~~l~~L~~L~L~~n~l  454 (768)
T 3rgz_A          399 LYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS------------------------LGSLSKLRDLKLWLNML  454 (768)
T ss_dssp             EECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGG------------------------GGGCTTCCEEECCSSCC
T ss_pred             EECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHH------------------------HhcCCCCCEEECCCCcc
Confidence            99999976666663 455889999999988755555544                        34577899999998752


Q ss_pred             ccccccCCCCccccccccccCCCCCcceeeecCCCchhhhHhhcCCCCCCCEEEeeeCCCCCcccccccCCCCCCEEEec
Q 042439          466 LTCIFSKNELPATLESLEVGNLPPSLKSLHVLSCSKLESIAERLDNNTSLETIDICYCGNLKNLPSGLHNLHQLQEISIG  545 (766)
Q Consensus       466 l~~~~~~~~~~~~l~~l~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~lp~~l~~l~~L~~L~l~  545 (766)
                      .      +.+|..+..+      ++|++|++++|...+.+|..+..+++|++|++++|...+.+|.++..+++|++|+++
T Consensus       455 ~------~~~p~~~~~l------~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~  522 (768)
T 3rgz_A          455 E------GEIPQELMYV------KTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLS  522 (768)
T ss_dssp             C------SCCCGGGGGC------TTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECC
T ss_pred             c------CcCCHHHcCC------CCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECC
Confidence            2      2334433333      789999999999888889999999999999999998888899999999999999999


Q ss_pred             CCCCccccCCCCCCCCCcceEEeccCcCccccCccCCCCCCCCeeEecCC------------------------------
Q 042439          546 RCGNLESFPEGGLPCAKLSKLRIHGCERLEALPKGLHNLTSLQELTIGRG------------------------------  595 (766)
Q Consensus       546 ~~~~l~~l~~~~~~~~~L~~L~l~~~~~~~~~p~~~~~l~~L~~L~l~~~------------------------------  595 (766)
                      +|...+.+|..+..+++|+.|++++|++.+.+|..+.....+..+.+..+                              
T Consensus       523 ~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  602 (768)
T 3rgz_A          523 NNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSE  602 (768)
T ss_dssp             SSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGG
T ss_pred             CCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccch
Confidence            99888889988889999999999999999999887766655544433221                              


Q ss_pred             ----------------CCCC-CCCCCCCCCCcceeEeccccccchhhhhcccccCCCCCCcEEEEeccCCCCccCCCCcc
Q 042439          596 ----------------VELP-SLEEDGLPTNLHSLWIAGNMEIWKSTIEWGRGFHRFSSLRQLRISGCDDDMVSFPPKAD  658 (766)
Q Consensus       596 ----------------~~l~-~~~~~~~~~~L~~L~l~~N~~~l~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~  658 (766)
                                      .... ..+..+.+++|++||+++|    ...+.+|..++.+++|+.|++++|. -...+|..+ 
T Consensus       603 ~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N----~l~g~ip~~l~~l~~L~~L~Ls~N~-l~g~ip~~l-  676 (768)
T 3rgz_A          603 QLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYN----MLSGYIPKEIGSMPYLFILNLGHND-ISGSIPDEV-  676 (768)
T ss_dssp             GGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSS----CCBSCCCGGGGGCTTCCEEECCSSC-CCSCCCGGG-
T ss_pred             hhhccccccccccccceecccCchhhhccccccEEECcCC----cccccCCHHHhccccCCEEeCcCCc-cCCCCChHH-
Confidence                            0000 1123455789999999997    3445667779999999999999963 345788877 


Q ss_pred             cccccCCCCCccccceEEeccCCCCccchhhhccCCCcceeecccCcCcccCCCCCcccccceeeecCChhHH----HHh
Q 042439          659 DIRLGTALPLPASLTSLLIFSFPNLERLSSSIVDLQNLTELYLEDCPKLKYFPEKGLPSSLLQLYIGGCPLIA----EKC  734 (766)
Q Consensus       659 ~~~~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~~L~~L~i~~~~~l~----~~~  734 (766)
                              ..+++|+.|+++++.--..+|..+..+++|++|++++|+..+.+|..+.+.++....+.|||.+=    ..|
T Consensus       677 --------~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C  748 (768)
T 3rgz_A          677 --------GDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRC  748 (768)
T ss_dssp             --------GGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSCCC
T ss_pred             --------hCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCcCC
Confidence                    36789999999995444489999999999999999999888899998778888888888887531    268


Q ss_pred             hccCCcccccccCcceEE
Q 042439          735 RKDGGQYWDLLTHIPYVV  752 (766)
Q Consensus       735 ~~~~~~~~~~i~~i~~v~  752 (766)
                      ....+++|++++|++.+.
T Consensus       749 ~~~~~~~~~~~~~~~~~~  766 (768)
T 3rgz_A          749 DPSNADGYAHHQRSHHHH  766 (768)
T ss_dssp             CSCC--------------
T ss_pred             CCCccCCCCCCCCccccC
Confidence            888899999999998764
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query766
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.81
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.78
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.78
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.72
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.64
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.63
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.62
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.6
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.6
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.47
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.43
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.43
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.42
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.4
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.38
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.36
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.34
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.17
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.1
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.09
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.06
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.04
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.97
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.95
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.93
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.7
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.62
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.61
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.53
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.49
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.46
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.93
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.37
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.31
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.93
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.86
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.56
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.82  E-value=1.7e-18  Score=182.07  Aligned_cols=81  Identities=15%  Similarity=0.231  Sum_probs=44.1

Q ss_pred             cCCCCCCCEEEeeeCCCCCcccccccCCCCCCEEEecCCCCccccCCCCCCCCCcceEEeccCcCccccCccCCCCCCCC
Q 042439          509 LDNNTSLETIDICYCGNLKNLPSGLHNLHQLQEISIGRCGNLESFPEGGLPCAKLSKLRIHGCERLEALPKGLHNLTSLQ  588 (766)
Q Consensus       509 ~~~l~~L~~L~l~~~~~l~~lp~~l~~l~~L~~L~l~~~~~l~~l~~~~~~~~~L~~L~l~~~~~~~~~p~~~~~l~~L~  588 (766)
                      +..+++++.|++++|.. ..++ .+..+++|++|++++| .++.++ .+..+++|++|++++|++.+..|  +.++++|+
T Consensus       303 ~~~~~~l~~L~ls~n~l-~~l~-~l~~l~~L~~L~L~~n-~l~~l~-~l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L~  376 (384)
T d2omza2         303 ISNLKNLTYLTLYFNNI-SDIS-PVSSLTKLQRLFFANN-KVSDVS-SLANLTNINWLSAGHNQISDLTP--LANLTRIT  376 (384)
T ss_dssp             GGGCTTCSEEECCSSCC-SCCG-GGGGCTTCCEEECCSS-CCCCCG-GGGGCTTCCEEECCSSCCCBCGG--GTTCTTCS
T ss_pred             cchhcccCeEECCCCCC-CCCc-ccccCCCCCEEECCCC-CCCCCh-hHcCCCCCCEEECCCCcCCCChh--hccCCCCC
Confidence            34455666666666643 3332 2555666666666666 334444 24555666666666665443222  55566666


Q ss_pred             eeEecCC
Q 042439          589 ELTIGRG  595 (766)
Q Consensus       589 ~L~l~~~  595 (766)
                      .|++++|
T Consensus       377 ~L~L~~N  383 (384)
T d2omza2         377 QLGLNDQ  383 (384)
T ss_dssp             EEECCCE
T ss_pred             EeeCCCC
Confidence            6666554
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure