Citrus Sinensis ID: 042537


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------79
MEEEREALLEFKQSLVDEYGILSSWGREDDKRDCCYWRGVRCSNTTGHVIVLDLQVLVHSEPLKGTISPSLLKLYHLRHLDLSENDFSGSRIPEFIGSLNKLRYLSLSSAEFEGPIPSQLGNLSRLKYLDLSYINLNKSRDWLRIIDKLPSLRTLNLEHCHLPPIIPSDLLHLNFSTSSLGALYLFENSLSSSIYPWLFNISSKLVVLDLDSNLLQGSLLEPFDRMVSLRTLYLGFNELEELFLGKNRLNGTINQWLSRMYKLDALSLSGNSLTGVVTESVFSELSNLKALHLDDNSFTLKFSHDWIPPFQLIIILLGSCQMGPHFPKWLQTQNQIEVLDISDAGISDTVPDWFWDLSHTIADFNLSNNHIKGKLPNLSLRFDPFSSSIDISSNYFEGLIPPLPSNASVLNLSRNKFSESISFLCSINGHKLEFLDLSNNILSGRLPDCWMQFDRLAVLSLANNFFSGKIPKSMGFLHSIQTLSLYNNSLIGELPSFFKSCSQLILMDLGKNGLSGEIPTWIGEGLPKLVVLSLKSNKFHGNIPFQVCQLSYIQILDLSLNNISGIIPKCLNNFTGMAQKSSSNLAITSNYTFERQGIEFLESYVDNVVLTWKGSQHEYRSTLGLVKILDFSMNKLSGTIPEEIMDLVGLVALNLSRNNLTGQITPKIDQLKSLDFLDLSQNQFVGGIPSSLCQLSRLSVMNLSYNNLSGKIPLGTQLQSFNASVYAGNPELCGLPLRNKCPDEDSAASPERDDANTPEGEDQLITFGFYVSVILGFFIGFWGVCGTLL
cHHHHHHHHHHHcccccccccccccccccccccccccccEEEccccccEEEEEccccccccccEEEccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHcccccccEEEccccccccccccccHHcccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEcccccccEEEcccccccccccHHHHccccccEEEccccccEEEEccccccccccccEEEccccEEEEEEcccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHHcccccEEEccccccccccccccccccccccEEEccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccEEEccccEEEEEccHHHHHcccccEEEcccccccccccHHHHcccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHcccccccccccccEEcccccccccccccEEEEEEEEEEEcccccEEcccccccEEEEccccccccccHHHHHccccccccccccccccccccccccccccccEEccccccccccccHHHHccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEHHHHHHHHHHHHHcccc
ccHHHHHHHHHHHHccccccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccccccHHHHccccccEEEccccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccccHHHccccccEEEEcccccccccccHHHHHHHHccccccEEEcccccccccccHHHHcccccccEEEcccccccccccHHHcccccccEEEccccccEEEEEccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEEccccccccccHHcccccccEEEEcccccccccccHHHHcccccEEEEEccccccccccHHHHHHHHHHcEEEcccccccccccHHHHccccccEEEEEcccccccccccccccccEEEcccccccccccHHHcccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHcHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHHHHcccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHcccHHHcEEccccccccccccHHHcccHHHHHHHHHHcccccccccHHHcccccEEEEEccEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccccccHHHccHHHcccccEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHc
MEEEREALLEFKQSLVDEYGIlsswgreddkrdccywrgvrcsnttgHVIVLDLQVlvhseplkgtispsllklyhlrhldlsendfsgsripefIGSLNKLrylslssaefegpipsqlgnlsrlkylDLSYINlnksrdwlriidklpslrtlnlehchlppiipsdllhlnfstsSLGALYLFEnslsssiypwLFNISSKLVVLDLdsnllqgsllepfDRMVSLRTLYLGFNELEELflgknrlnGTINQWLSRMYKldalslsgnsltgVVTESVFSELSNlkalhlddnsftlkfshdwippFQLIIILLgscqmgphfpkwlqtqnqievldisdagisdtvpdwfwdlshtiadfnlsnnhikgklpnlslrfdpfsssidissnyfeglipplpsnasvlnlsrnkfsESISFLCSinghklefLDLSnnilsgrlpdcwmqFDRLAVLSLANnffsgkipksmgflHSIQTLSLYNNSLIGELPSFFKSCSQLILMDlgknglsgeiptwigeglPKLVVLSLksnkfhgnipfqvcQLSYIQILDLSLNnisgiipkclnnftgmaqksssnlaitsnytfeRQGIEFLESYVDNVVLTWKGSQHEYRSTLGLVKILDFSmnklsgtipEEIMDLVGLVALNlsrnnltgqitpkidqlksldfldlsqnqfvggipsslcqlSRLSVMNLSynnlsgkiplgtqlqsfnasvyagnpelcglplrnkcpdedsaasperddantpegedqlITFGFYVSVILGFFIGFWGVCGTLL
MEEEREALLEFKQSLVDEygilsswgreddkrdCCYWRGVRCSNTTGHVIVLDLQVLVHSEPLKGTISPSLLKLYHLRHLDLSENDFSGSRIPEFIGSLNKLRYLSLSSAEFEGPIPSQLGNLSRLKYLDLSYINLNKSRDWLRIIDKLPSLRTLNLEHCHLPPIIPSDLLHLNFSTSSLGALYLFENSLSSSIYPWLFNISSKLVVLDLDSNLLQGSLLEPFDRMVSLRTLYLGFNELEELFLGKNRLNGTINQWLSRMYKLDALSLSGNSLTGVVTESVFSELSNLKALHLDDNSFTLKFSHDWIPPFQLIIILLGSCQMGPHFPKWLQTQNQIEVLDISDAGISDTVPDWFWDLSHTIADFNLSNNHIKGKLPNLSLRFDPFSSSIDISSNYFEGLIPPLPSNASVLNLSRNKFSESISFLCSINGHKLEFLDLSNNILSGRLPDCWMQFDRLAVLSLANNFFSGKIPKSMGFLHSIQTLSLYNNSLIGELPSFFKSCSQLILMDLGKNGLSGEIPTWIGEGLPKLVVLSLKSNKFHGNIPFQVCQLSYIQILDLSLNNISGIIPKCLNNFTGMAQKSSSNLAITSNYTFERQGIEFLESYVDNVVLTWKGSQHEYRSTLGLVKILDFSMNKLSGTIPEEIMDLVGLVALNLSRNNLTGQITPKIDQLKSLDFLDLSQNQFVGGIPSSLCQLSRLSVMNLSYNNLSGKIPLGTQLQSFNASVYAGNPELCGLPLRNKCPDEDSAASPERDDANTPEGEDQLITFGFYVSVILGFFIGFWGVCGTLL
MEEEREALLEFKQSLVDEYGILSSWGREDDKRDCCYWRGVRCSNTTGHVIVLDLQVLVHSEPLKGTISPSllklyhlrhldlSENDFSGSRIPEFIGSLNKLRYLSLSSAEFEGPIPSQLGNLSRLKYLDLSYINLNKSRDWLRIIDKLPSLRTLNLEHCHLPPIIPSDLLHLNFSTSSLGALYLFENSLSSSIYPWLFNISSKLVVLDLDSNLLQGSLLEPFDRMVSLRTlylgfneleelflgKNRLNGTINQWLSRMYKLDALSLSGNSLTGVVTESVFSELSNLKALHLDDNSFTLKFSHDWIPPFQLIIILLGSCQMGPHFPKWLQTQNQIEVLDISDAGISDTVPDWFWDLSHTIADFNLSNNHIKGKLPNLSLRfdpfsssidissNYFEGLIPPLPSNASVLNLSRNKFSESISFLCSINGHKLEFLDLSNNILSGRLPDCWMQFDRLAVLSLANNFFSGKIPKSMGFLHSIQTLSLYNNSLIGELPSFFKSCSQLILMDLGKNGLSGEIPTWIGEGLPKLVVLSLKSNKFHGNIPFQVCQLSYIQILDLSLNNISGIIPKCLNNFTGMAQKSSSNLAITSNYTFERQGIEFLESYVDNVVLTWKGSQHEYRSTLGLVKILDFSMNKLSGTIPEEIMDLVGLVALNLSRNNLTGQITPKIDQLKSLDFLDLSQNQFVGGIPSSLCQLSRLSVMNLSYNNLSGKIPLGTQLQSFNASVYAGNPELCGLPLRNKCPDEDSAASPERDDANTPEGEDQLITFGFYVSVILGFFIGFWGVCGTLL
********LEFKQSLVDEYGILSSWGREDDKRDCCYWRGVRCSNTTGHVIVLDLQVLVHSEPLKGTISPSLLKLYHLRHLDLSENDFSGSRIPEFIGSLNKLRYLSLSSAEFEGPIPSQLGNLSRLKYLDLSYINLNKSRDWLRIIDKLPSLRTLNLEHCHLPPIIPSDLLHLNFSTSSLGALYLFENSLSSSIYPWLFNISSKLVVLDLDSNLLQGSLLEPFDRMVSLRTLYLGFNELEELFLGKNRLNGTINQWLSRMYKLDALSLSGNSLTGVVTESVFSELSNLKALHLDDNSFTLKFSHDWIPPFQLIIILLGSCQMGPHFPKWLQTQNQIEVLDISDAGISDTVPDWFWDLSHTIADFNLSNNHIKGKLPNLSLRFDPFSSSIDISSNYFEGLIPPLPSNASVLNLSRNKFSESISFLCSINGHKLEFLDLSNNILSGRLPDCWMQFDRLAVLSLANNFFSGKIPKSMGFLHSIQTLSLYNNSLIGELPSFFKSCSQLILMDLGKNGLSGEIPTWIGEGLPKLVVLSLKSNKFHGNIPFQVCQLSYIQILDLSLNNISGIIPKCLNNFTGMAQKSSSNLAITSNYTFERQGIEFLESYVDNVVLTWKGSQHEYRSTLGLVKILDFSMNKLSGTIPEEIMDLVGLVALNLSRNNLTGQITPKIDQLKSLDFLDLSQNQFVGGIPSSLCQLSRLSVMNLSYNNLSGKIPLGTQLQSFNASVYAGNPELCGLPL*************************QLITFGFYVSVILGFFIGFWGVCGT**
MEEEREALLEFKQSLVDEYGILSSWGREDDKRDCCYWRGVRCSNTTGHVIVLDLQVLVHSEPLKGTISPSLLKLYHLRHLDLSENDFSGSRIPEFIGSLNKLRYLSLSSAEFEGPIPSQLGNLSRLKYLDLSYINLNKSRDWLRIIDKLPSLRTLNLEHCHLPPIIPSDLLHLNFSTSSLGALYLFENSLSSSIYPWLFNISSKLVVLDLDSNLLQGSLLEPFDRMVSLRTLYLGFNELEELFLGKNRLNGTINQWLSRMYKLDALSLSGNSLTGVVTESVFSELSNLKALHLDDNSFTLKFSHDWIPPFQLIIILLGSCQMGPHFPKWLQTQNQIEVLDISDAGISDTVPDWFWDLSHTIADFNLSNNHIKGKLPNLSLRFDPFSSSIDISSNYFEGLIPPLPSNASVLNLSRNKFSESISFLCSINGHKLEFLDLSNNILSGRLPDCWMQFDRLAVLSLANNFFSGKIPKSMGFLHSIQTLSLYNNSLIGELPSFFKSCSQLILMDLGKNGLSGEIPTWIGEGLPKLVVLSLKSNKFHGNIPFQVCQLSYIQILDLSLNNISGIIPKCLNNFTGMAQK*****AITSNYTFERQGIEFLESYVDNVVLTWKGSQHEYRSTLGLVKILDFSMNKLSGTIPEEIMDLVGLVALNLSRNNLTGQITPKIDQLKSLDFLDLSQNQFVGGIPSSLCQLSRLSVMNLSYNNLSGKIPLGTQLQSFNASVYAGNPELCGLP***************************LITFGFYVSVILGFFIGFWGVCGTLL
MEEEREALLEFKQSLVDEYGILSSWGREDDKRDCCYWRGVRCSNTTGHVIVLDLQVLVHSEPLKGTISPSLLKLYHLRHLDLSENDFSGSRIPEFIGSLNKLRYLSLSSAEFEGPIPSQLGNLSRLKYLDLSYINLNKSRDWLRIIDKLPSLRTLNLEHCHLPPIIPSDLLHLNFSTSSLGALYLFENSLSSSIYPWLFNISSKLVVLDLDSNLLQGSLLEPFDRMVSLRTLYLGFNELEELFLGKNRLNGTINQWLSRMYKLDALSLSGNSLTGVVTESVFSELSNLKALHLDDNSFTLKFSHDWIPPFQLIIILLGSCQMGPHFPKWLQTQNQIEVLDISDAGISDTVPDWFWDLSHTIADFNLSNNHIKGKLPNLSLRFDPFSSSIDISSNYFEGLIPPLPSNASVLNLSRNKFSESISFLCSINGHKLEFLDLSNNILSGRLPDCWMQFDRLAVLSLANNFFSGKIPKSMGFLHSIQTLSLYNNSLIGELPSFFKSCSQLILMDLGKNGLSGEIPTWIGEGLPKLVVLSLKSNKFHGNIPFQVCQLSYIQILDLSLNNISGIIPKCLNNFTGMAQKSSSNLAITSNYTFERQGIEFLESYVDNVVLTWKGSQHEYRSTLGLVKILDFSMNKLSGTIPEEIMDLVGLVALNLSRNNLTGQITPKIDQLKSLDFLDLSQNQFVGGIPSSLCQLSRLSVMNLSYNNLSGKIPLGTQLQSFNASVYAGNPELCGLPLRNKC*****************EGEDQLITFGFYVSVILGFFIGFWGVCGTLL
MEEEREALLEFKQSLVDEYGILSSWGREDDKRDCCYWRGVRCSNTTGHVIVLDLQVLVHSEPLKGTISPSLLKLYHLRHLDLSENDFSGSRIPEFIGSLNKLRYLSLSSAEFEGPIPSQLGNLSRLKYLDLSYINLNKSRDWLRIIDKLPSLRTLNLEHCHLPPIIPSDLLHLNFSTSSLGALYLFENSLSSSIYPWLFNISSKLVVLDLDSNLLQGSLLEPFDRMVSLRTLYLGFNELEELFLGKNRLNGTINQWLSRMYKLDALSLSGNSLTGVVTESVFSELSNLKALHLDDNSFTLKFSHDWIPPFQLIIILLGSCQMGPHFPKWLQTQNQIEVLDISDAGISDTVPDWFWDLSHTIADFNLSNNHIKGKLPNLSLRFDPFSSSIDISSNYFEGLIPPLPSNASVLNLSRNKFSESISFLCSINGHKLEFLDLSNNILSGRLPDCWMQFDRLAVLSLANNFFSGKIPKSMGFLHSIQTLSLYNNSLIGELPSFFKSCSQLILMDLGKNGLSGEIPTWIGEGLPKLVVLSLKSNKFHGNIPFQVCQLSYIQILDLSLNNISGIIPKCLNNFTGMAQKSSSNLAITSNYTFERQGIEFLESYVDNVVLTWKGSQHEYRSTLGLVKILDFSMNKLSGTIPEEIMDLVGLVALNLSRNNLTGQITPKIDQLKSLDFLDLSQNQFVGGIPSSLCQLSRLSVMNLSYNNLSGKIPLGTQLQSFNASVYAGNPELCGLPLRNKC******************GEDQLITFGFYVSVILGFFIGFWGVCGTLL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEEREALLEFKQSLVDEYGILSSWGREDDKRDCCYWRGVRCSNTTGHVIVLDLQVLVHSEPLKGTISPSLLKLYHLRHLDLSENDFSGSRIPEFIGSLNKLRYLSLSSAEFEGPIPSQLGNLSRLKYLDLSYINLNKSRDWLRIIDKLPSLRTLNLEHCHLPPIIPSDLLHLNFSTSSLGALYLFENSLSSSIYPWLFNISSKLVVLDLDSNLLQGSLLEPFDRMVSLRTLYLGFNELEELFLGKNRLNGTINQWLSRMYKLDALSLSGNSLTGVVTESVFSELSNLKALHLDDNSFTLKFSHDWIPPFQLIIILLGSCQMGPHFPKWLQTQNQIEVLDISDAGISDTVPDWFWDLSHTIADFNLSNNHIKGKLPNLSLRFDPFSSSIDISSNYFEGLIPPLPSNASVLNLSRNKFSESISFLCSINGHKLEFLDLSNNILSGRLPDCWMQFDRLAVLSLANNFFSGKIPKSMGFLHSIQTLSLYNNSLIGELPSFFKSCSQLILMDLGKNGLSGEIPTWIGEGLPKLVVLSLKSNKFHGNIPFQVCQLSYIQILDLSLNNISGIIPKCLNNFTGMAQKSSSNLAITSNYTFERQGIEFLESYVDNVVLTWKGSQHEYRSTLGLVKILDFSMNKLSGTIPEEIMDLVGLVALNLSRNNLTGQITPKIDQLKSLDFLDLSQNQFVGGIPSSLCQLSRLSVMNLSYNNLSGKIPLGTQLQSFNASVYAGNPELCGLPLRNKCPDEDSAASPERDDANTPEGEDQLITFGFYVSVILGFFIGFWGVCGTLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query789 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.927 0.864 0.295 1e-67
Q9FL28 1173 LRR receptor-like serine/ no no 0.896 0.602 0.311 1e-65
C0LGQ5 1249 LRR receptor-like serine/ no no 0.841 0.531 0.320 6e-59
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.804 0.507 0.318 5e-58
Q9LVP0 1102 Probable leucine-rich rep no no 0.842 0.603 0.310 9e-58
C0LGS2 1136 Probable LRR receptor-lik no no 0.893 0.620 0.311 2e-57
Q9SHI2 1101 Leucine-rich repeat recep no no 0.920 0.659 0.298 2e-56
Q9ZWC8 1166 Serine/threonine-protein no no 0.889 0.602 0.292 8e-53
Q9LYN8 1192 Leucine-rich repeat recep no no 0.827 0.547 0.295 5e-52
C0LGT6 1031 LRR receptor-like serine/ no no 0.743 0.569 0.289 9e-52
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  258 bits (659), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 246/833 (29%), Positives = 396/833 (47%), Gaps = 101/833 (12%)

Query: 2   EEEREALLEFKQSLVDEYGILSSW-------GREDDKRDCCYWRGVRCSNTTGHVIVLDL 54
           +++R+ALLEF+     E+ I +SW       G  +   DCC W GV C++ +G VI LD+
Sbjct: 36  DDQRDALLEFR----GEFPINASWHIMNQWRGPWNKSTDCCLWNGVTCNDKSGQVISLDI 91

Query: 55  QVLVHSEPLKGTISPSLLKLYHLRHLDLSE------------------------NDFSGS 90
                +  LK   + SL KL +LRHLDL+                         N F G 
Sbjct: 92  PNTFLNNYLK--TNSSLFKLQYLRHLDLTNCNLYGEIPSSLGNLSHLTLVNLYFNKFVG- 148

Query: 91  RIPEFIGSLNKLRYLSLSSAEFEGPIPSQLGNLSRLKYLDLSYINLNKSRDWLRIIDKLP 150
            IP  IG+LN+LR+L L++    G IPS LGNLSRL  L+L + N        R++ K+P
Sbjct: 149 EIPASIGNLNQLRHLILANNVLTGEIPSSLGNLSRLVNLEL-FSN--------RLVGKIP 199

Query: 151 -------SLRTLNLEHCHLPPIIPSDLLHLNFSTSSLGALYLFENSLSSSIYPWLFNISS 203
                   LR L+L   +L   IPS L +L    S+L  L L  N L   +   + N+  
Sbjct: 200 DSIGDLKQLRNLSLASNNLIGEIPSSLGNL----SNLVHLVLTHNQLVGEVPASIGNLI- 254

Query: 204 KLVVLDLDSNLLQGSLLEPFDRMVSLRTLYLGFNELEELFLGKNRLNGTINQWLSRMYKL 263
           +L V+  ++N L G++   F  +  L    L  N     F             +S  + L
Sbjct: 255 ELRVMSFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFD----------MSIFHNL 304

Query: 264 DALSLSGNSLTGVVTESVFSELSNLKALHLDDNSFT--LKFSHDWIPPFQLIIILLGSCQ 321
           +   +S NS +G   +S+   + +L++++L +N FT  ++F++      +L  ++LG  +
Sbjct: 305 EYFDVSYNSFSGPFPKSLLL-IPSLESIYLQENQFTGPIEFANT-SSSTKLQDLILGRNR 362

Query: 322 MGPHFPKWLQTQNQIEVLDISDAGISDTVPDWFWDLSHTIADFNLSNNHIKGKLPNLSLR 381
           +    P+ +     +E LDIS    +  +P     L + +   +LS N+++G++P    R
Sbjct: 363 LHGPIPESISRLLNLEELDISHNNFTGAIPPTISKLVN-LLHLDLSKNNLEGEVPACLWR 421

Query: 382 FDPFSSSIDISSNYFEGLIPPLPSNASV--LNLSRNKFSESISFL-CSINGHKLEFLDLS 438
            +    ++ +S N F          A +  L+L+ N F   I ++ C ++   L FLDLS
Sbjct: 422 LN----TMVLSHNSFSSFENTSQEEALIEELDLNSNSFQGPIPYMICKLSS--LGFLDLS 475

Query: 439 NNILSGRLPDCWMQFD-RLAVLSLANNFFSGKIPKSMGFLHSIQTLSLYNNSLIGELPSF 497
           NN+ SG +P C   F   +  L+L +N FSG +P        + +L + +N L G+ P  
Sbjct: 476 NNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKS 535

Query: 498 FKSCSQLILMDLGKNGLSGEIPTWIGEGLPKLVVLSLKSNKFHGNIPFQVCQLSY--IQI 555
             +C  L L+++  N +    P+W+ E LP L VL+L+SNKF+G +  +   + +  ++I
Sbjct: 536 LINCKALELVNVESNKIKDIFPSWL-ESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRI 594

Query: 556 LDLSLNNISGIIPKC-LNNFTGMAQKSSSNLAITSNYTFERQGIEFLESYVDNVVLTWKG 614
           +D+S NN SG +P    +N+  M   +       + +        + +SY   + +  KG
Sbjct: 595 IDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEF------WRYADSYYHEMEMVNKG 648

Query: 615 SQHEYRSTLGLVKILDFSMNKLSGTIPEEIMDLVGLVALNLSRNNLTGQITPKIDQLKSL 674
               +       + +DFS NK++G IPE +  L  L  LNLS N  T  I   +  L  L
Sbjct: 649 VDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKL 708

Query: 675 DFLDLSQNQFVGGIPSSLCQLSRLSVMNLSYNNLSGKIPLGTQLQSFNASVYAGNPELCG 734
           + LD+S+N+  G IP  L  LS LS MN S+N L G +P GTQ Q    S +  NP L G
Sbjct: 709 ETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCSSFLDNPGLYG 768

Query: 735 LPLRNKCPDEDSAASPERDDANTPEGEDQLITF-----GFYVSVILGFFIGFW 782
             L + C D  +     +   +  E E+ +  +      +   V+ G  IG +
Sbjct: 769 --LEDICRDTGALNPTSQLPEDLSEAEENMFNWVAAAIAYGPGVLCGLVIGHF 819




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query789
359489995867 PREDICTED: probable LRR receptor-like se 0.953 0.867 0.490 0.0
224105895 963 predicted protein [Populus trichocarpa] 0.994 0.815 0.459 0.0
225464712 1021 PREDICTED: receptor-like protein 12-like 0.998 0.771 0.432 0.0
224115848884 predicted protein [Populus trichocarpa] 0.980 0.875 0.441 1e-176
359490572 975 PREDICTED: probable LRR receptor-like se 0.988 0.8 0.429 1e-175
359490164 1198 PREDICTED: LRR receptor-like serine/thre 0.912 0.601 0.475 1e-170
359490166 1265 PREDICTED: LRR receptor-like serine/thre 0.953 0.594 0.439 1e-169
225466147 1024 PREDICTED: LRR receptor-like serine/thre 0.896 0.690 0.495 1e-167
225470187870 PREDICTED: receptor-like protein kinase 0.967 0.877 0.431 1e-166
359490426 1436 PREDICTED: LRR receptor-like serine/thre 0.968 0.532 0.429 1e-160
>gi|359489995|ref|XP_003634011.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/861 (49%), Positives = 535/861 (62%), Gaps = 109/861 (12%)

Query: 1   MEEEREALLEFKQSLVDEYGILSSWGREDDKRDCCYWRGVRCSNTTGHVIVLDLQV---- 56
           +E ER+ALL FK  LVD+YGILSSW    D RDCC WRGVRCSN +GH+++L L      
Sbjct: 34  VERERQALLRFKHGLVDDYGILSSW----DTRDCCQWRGVRCSNQSGHIVMLHLPAPPTE 89

Query: 57  ----LVHS-EPLKGTISPSLLKLYHLRHLDLSENDFSGSRIPEFIGSLNKLRYLSLSSAE 111
                VH  + L+G ISPSLL+L HL HLDLS NDF  S IP F+ SL+K++YL+LS A 
Sbjct: 90  FEDEYVHKFQSLRGEISPSLLELEHLTHLDLSCNDFERSHIPPFVASLSKIQYLNLSYAN 149

Query: 112 FEGPIPSQ-------------------------LGNLSRLKYLDLSYINLN--------- 137
           F G +PSQ                         L +L+++++L LSY N           
Sbjct: 150 FTGRLPSQLGNLSNLLSLDLSSNDFEGRPIPPFLASLTKIQHLSLSYANFTGRLPSHFGN 209

Query: 138 -----------------KSRDWLRIIDKLPSLRTLNLEHC-------HLPPIIPSDLLHL 173
                             + +WL     L SLR L+L++        +LPP+       +
Sbjct: 210 LSNLLSLDLSYNYDLNCGNLEWL---SHLSSLRHLDLKYVNLSKAIHYLPPLTTPSFSPV 266

Query: 174 NFSTSSLGALYLFENSLSSSIYPWLFNISSKLVVLDLDSNLLQGSLLEPFDRMVSLRTLY 233
           N S++ L  L L +N   SSIYPWLFN ++ L       N   GS  +           +
Sbjct: 267 N-SSAPLAFLDLSDNDYDSSIYPWLFNFTTTLT-----DNQFAGSFPD-----------F 309

Query: 234 LGFNELEELFLGKNRLNGTINQWLSRMYKLDALSLSGNSLTGVVTESVFSELSNLKALHL 293
           +GF+ L+EL L  N++NGT+ + + ++ KL+AL +  NSL GV++E+    LS L  L L
Sbjct: 310 IGFSSLKELELDHNQINGTLPKSIGQLTKLEALIIGSNSLQGVISEAHLLHLSRLSYLDL 369

Query: 294 DDNSFTLKFSHDWIPPFQLIIILLGSCQMGPHFPKWLQTQNQIEVLDISDAGISDTVPDW 353
             NSF    S +W+PPFQLI + L SCQ+GP FP WL+TQ Q++ LDIS + ISD +P W
Sbjct: 370 SSNSFNFNMSSEWVPPFQLIFLQLTSCQLGPRFPSWLRTQKQLQSLDISTSDISDVIPHW 429

Query: 354 FWDLSHTIADFNLSNNHIKGKLPNLSLRFD-PFSSSIDISSNYFEGLIPPLPSNASVLNL 412
           FW+L+  I  FN+SNN I G LPNLS +FD P    ID+SSN+ EG IP LPS  S L+L
Sbjct: 430 FWNLTSLIYFFNISNNQITGTLPNLSSKFDQPL--YIDMSSNHLEGSIPQLPSGLSWLDL 487

Query: 413 SRNKFSESISFLCSINGHKLEFLDLSNNILSGRLPDCWMQFDRLAVLSLANNFFSGKIPK 472
           S NKFS SI+ LC++    L +LDLSNN+LSG LP+CW Q+  L VL+L NN FS KIP+
Sbjct: 488 SNNKFSGSITLLCTVANSYLAYLDLSNNLLSGELPNCWPQWKSLTVLNLENNQFSRKIPE 547

Query: 473 SMGFLHSIQTLSLYNNSLIGELPSFFKSCSQLILMDLGKNGLSGEIPTWIGEGLPKLVVL 532
           S G L  IQTL L N +LIGELPS  K C  L  +DL KN LSGEIP WIG  LP L+VL
Sbjct: 548 SFGSLQLIQTLHLRNKNLIGELPSSLKKCKSLSFIDLAKNRLSGEIPPWIGGNLPNLMVL 607

Query: 533 SLKSNKFHGNIPFQVCQLSYIQILDLSLNNISGIIPKCLNNFTGMAQKSSSNLAITSNYT 592
           +L+SNKF G+I  +VCQL  IQILDLS NN+SG IP+CL+NFT M +K S  L IT N++
Sbjct: 608 NLQSNKFSGSISPEVCQLKKIQILDLSDNNMSGTIPRCLSNFTAMTKKES--LTITYNFS 665

Query: 593 FERQGIEFLESYVDNVVLTWKGSQHEYRSTLGLVKILDFSMNKLSGTIPEEIMDLVGLVA 652
              Q      SYVD   + WKG + E+++TLGLVK +D S NKL+G IP+E+ DL+ LV+
Sbjct: 666 MSYQHW----SYVDKEFVKWKGREFEFKNTLGLVKSIDLSSNKLTGEIPKEVTDLLELVS 721

Query: 653 LNLSRNNLTGQITPKIDQLKSLDFLDLSQNQFVGGIPSSLCQLSRLSVMNLSYNNLSGKI 712
           LN SRNNLTG I   I QLKSLD LDLSQNQ +G IPSSL ++ RLS ++LS NNLSG I
Sbjct: 722 LNFSRNNLTGLIPITIGQLKSLDILDLSQNQLIGEIPSSLSEIDRLSTLDLSNNNLSGMI 781

Query: 713 PLGTQLQSFNASVYAGNPELCGLPLRNKCPDEDSAASP----ERDDANTPEGEDQLITFG 768
           P GTQLQSFN   Y GNP LCG PL  KCP + +  +P    + DD    +G D      
Sbjct: 782 PQGTQLQSFNTFSYEGNPTLCGPPLLKKCPRDKAEGAPNVYSDEDDIQQ-DGND----MW 836

Query: 769 FYVSVILGFFIGFWGVCGTLL 789
           FYVS+ LGF +GFWGVCGTLL
Sbjct: 837 FYVSIALGFIVGFWGVCGTLL 857




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224105895|ref|XP_002333753.1| predicted protein [Populus trichocarpa] gi|222838401|gb|EEE76766.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225464712|ref|XP_002276171.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224115848|ref|XP_002332072.1| predicted protein [Populus trichocarpa] gi|222831958|gb|EEE70435.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359490572|ref|XP_003634116.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490164|ref|XP_002268910.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490166|ref|XP_003634046.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225466147|ref|XP_002270042.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225470187|ref|XP_002268274.1| PREDICTED: receptor-like protein kinase 5-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490426|ref|XP_003634086.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query789
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.922 0.897 0.319 2.7e-77
TAIR|locus:2044767905 AT2G34930 "AT2G34930" [Arabido 0.806 0.702 0.331 9.3e-75
TAIR|locus:2046357890 RLP23 "receptor like protein 2 0.889 0.788 0.296 3.8e-69
TAIR|locus:2078112868 RLP32 "receptor like protein 3 0.932 0.847 0.313 1.7e-68
TAIR|locus:2119430741 RLP47 "receptor like protein 4 0.830 0.883 0.317 7.2e-68
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.869 0.769 0.327 5.1e-67
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.840 0.650 0.312 8.7e-67
TAIR|locus:2825384847 RLP12 "AT1G71400" [Arabidopsis 0.958 0.892 0.277 8.5e-65
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.885 0.741 0.308 6.2e-64
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.870 0.785 0.318 2e-63
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 778 (278.9 bits), Expect = 2.7e-77, P = 2.7e-77
 Identities = 252/788 (31%), Positives = 377/788 (47%)

Query:     2 EEEREALLEFKQSLV----DEYGILSSWGREDDKRDCCYWRGVRC--SNTTGHVIVLDLQ 55
             +++R++LLEFK  L+    D Y      G      DCC W  V C  S+ +  VI L+L 
Sbjct:    26 QDQRQSLLEFKNLLIHNIKDNYTAFEELGTWRPNSDCCKWLRVTCNASSPSKEVIDLNLF 85

Query:    56 VLVHSEPLKGTISPSXXXXXXXXXXXXSENDFSGSRIPEF-IGSLNKLRYLSLSSAEFEG 114
             +L+    +  +I               S N+  G  IP +   +L  L  L +    F G
Sbjct:    86 LLIPPGLVSSSILRPILRINSLVGLDVSFNNIQGE-IPGYAFVNLTSLISLDMCCNRFNG 144

Query:   115 PIPSQLGNLSRLKYLDLS--YINLNKSRDWLRIIDKLPSLRTLNLEHCHLPPIIPSDLLH 172
              IP +L +L+ L+ LDLS   I    S D    I +L +L+ L L+   +   IPS++  
Sbjct:   145 SIPHELFSLTNLQRLDLSRNVIGGTLSGD----IKELKNLQELILDENLIGGAIPSEI-- 198

Query:   173 LNFSTSSLGALYLFENSLSSSIYPWLFNISSKLVVLDLDSNLLQGSLLEPFDRMVSLRTX 232
                S   L  L L +N  +SSI P   +  +KL  +DL +N L   + +    +V+L T 
Sbjct:   199 --GSLVELLTLTLRQNMFNSSI-PSSVSRLTKLKTIDLQNNFLSSKIPDDIGNLVNLSTL 255

Query:   233 XXXXXXXXXXXXXKNRLNGTINQWLSRMYKLDALSLSGNS-LTGVVTESVFSELSNLKAL 291
                           N+L+G I   +  +  L+ L L  N+ L+G +  +    L  LK L
Sbjct:   256 SLSM----------NKLSGGIPSSIHNLKNLETLQLENNNGLSGEIPAAWLFGLQKLKVL 305

Query:   292 HLDDNSFTLKFSHDW--IPPFQLIIILLGSCQMGPHFPKWLQTQNQIEVLDISDAGISDT 349
              L+ N+  L+++++    P F+L  + L SC +  + P WL+ Q  +  LD+S   +   
Sbjct:   306 RLEGNN-KLQWNNNGYVFPQFKLTHLSLRSCGLEGNIPDWLKNQTALVYLDLSINRLEGR 364

Query:   350 VPDWFWDLSHTIADFNLSNNHIKGKLP-NLSLRXXXXXXXXXXXXNYFEGLIPPL--PSN 406
              P W  DL   I +  LS+N + G LP NL  R            N F G IP     S 
Sbjct:   365 FPKWLADLK--IRNITLSDNRLTGSLPPNLFQRPSLYYLVLSR--NNFSGQIPDTIGESQ 420

Query:   407 ASVLNLSRNKFSESI-SFLCSINGHKLEFLDLSNNILSGRLPDCWMQFDRLAVLSLANNF 465
               VL LS N FS S+   +  I   KL  LDLS N LSG  P  +     L  L +++N 
Sbjct:   421 VMVLMLSENNFSGSVPKSITKIPFLKL--LDLSKNRLSGEFPR-FRPESYLEWLDISSNE 477

Query:   466 FSGKIPKSMGFLHSIQTLSLYNNSLIGELPSFFKSCSQLILMDLGKNGLSGEIPTWIGEG 525
             FSG +P   G   S   L +  N+  GE P  F++ S LI +DL  N +SG + + I + 
Sbjct:   478 FSGDVPAYFG--GSTSMLLMSQNNFSGEFPQNFRNLSYLIRLDLHDNKISGTVASLISQL 535

Query:   526 LPKLVVLSLKSNKFHGNIPFQVCQLSYIQILDLSLNNISGIIPKCLNNFTGMAQKSSSNL 585
                + VLSL++N   G+IP  +  L+ +++LDLS NN+ G +P  L N T M  KS    
Sbjct:   536 SSSVEVLSLRNNSLKGSIPEGISNLTSLKVLDLSENNLDGYLPSSLGNLTCMI-KSPEPS 594

Query:   586 AIT-----SNYT----FERQGIEFLESYVDNVVLTWKGSQHE-YRSTLGLVKILDFSMNK 635
             A+T     S+YT     ER  IE     + ++V+ WK S+   +     L  +LD S NK
Sbjct:   595 AMTIRPYFSSYTDIPNIERL-IEIESEDIFSLVVNWKNSKQVLFDRNFYLYTLLDLSKNK 653

Query:   636 LSGTIPEEIMDLVGLVALNLSRNNLTGQITPKIDQLKSLDFLDLSQNQFVGGIPSSLCQL 695
             L G IP  + +L  L  LNLS N  +G I      L+ ++ LDLS N   G IP +L +L
Sbjct:   654 LHGEIPTSLGNLKSLKVLNLSNNEFSGLIPQSFGDLEKVESLDLSHNNLTGEIPKTLSKL 713

Query:   696 SRLSVMNLSYNNLSGKIPLGTQLQSFN-ASVYAGNPELCGLPLRNKC-PDEDSAASPERD 753
             S L+ ++L  N L G+IP   QL   N  ++YA N  +CG+ ++  C P +    + E++
Sbjct:   714 SELNTLDLRNNKLKGRIPESPQLDRLNNPNIYANNSGICGMQIQVPCFPTQTKQPAEEKE 773

Query:   754 DANTPEGE 761
             + +  E E
Sbjct:   774 EEDKEEEE 781




GO:0005886 "plasma membrane" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119430 RLP47 "receptor like protein 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query789
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-70
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-07
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 9e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  248 bits (634), Expect = 4e-70
 Identities = 234/778 (30%), Positives = 343/778 (44%), Gaps = 167/778 (21%)

Query: 3   EEREALLEFKQSLVDEYGILSSWGREDDKRDCCYWRGVRCSNTTGHVIVLDLQVLVHSEP 62
           EE E LL FK S+ D    LS+W   +   D C W+G+ C+N++  V+ +DL      + 
Sbjct: 29  EELELLLSFKSSINDPLKYLSNW---NSSADVCLWQGITCNNSS-RVVSIDLS----GKN 80

Query: 63  LKGTISPSLLKLYHLRHLDLSENDFSGSRIPEFIGSL-NKLRYLSLSSAEFEGPIPSQLG 121
           + G IS ++ +L +++ ++LS N  SG  IP+ I +  + LRYL+LS+  F G IP    
Sbjct: 81  ISGKISSAIFRLPYIQTINLSNNQLSG-PIPDDIFTTSSSLRYLNLSNNNFTGSIPR--- 136

Query: 122 NLSRLKYLDLSYINLNKSRDWLRIIDKLPSLRTLNLEHCHLPPIIPSDLLHLNFSTSSLG 181
                                      +P+L TL+L +  L   IP+D+     S SSL 
Sbjct: 137 -------------------------GSIPNLETLDLSNNMLSGEIPNDI----GSFSSLK 167

Query: 182 ALYLFENSLSSSIYPWLFNISSKLVVLDLDSNLLQGSLLEPFDRMVSLRTLYLGFNELEE 241
            L L  N L   I   L N++S L  L L SN L G +     +M SL+ +YLG+N    
Sbjct: 168 VLDLGGNVLVGKIPNSLTNLTS-LEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNN--- 223

Query: 242 LFLGKNRLNGTINQWLSRMYKLDALSLSGNSLTGVVTESVFSELSNLKALHLDDNSFTLK 301
                  L+G I   +  +  L+ L L  N+LTG +  S    L NL+ L L  N  +  
Sbjct: 224 -------LSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSS-LGNLKNLQYLFLYQNKLS-- 273

Query: 302 FSHDWIPPFQLIIILLGSCQMGPHFPKWLQTQNQIEVLDISDAGISDTVPDWFWDLSHTI 361
                                GP  P     Q  I  LD+SD  +S  +P+    L   +
Sbjct: 274 ---------------------GPIPPSIFSLQKLIS-LDLSDNSLSGEIPELVIQL-QNL 310

Query: 362 ADFNLSNNHIKGKLPNLSLRFDPFSSSIDISSNYFEGLIPPLPSNASVLNLSRNKFSESI 421
              +L +N+  GK+P ++L   P    + + SN F G IP         NL ++      
Sbjct: 311 EILHLFSNNFTGKIP-VALTSLPRLQVLQLWSNKFSGEIPK--------NLGKH------ 355

Query: 422 SFLCSINGHKLEFLDLSNNILSGRLPDCWMQFDRLAVLSLANNFFSGKIPKSMGFLHSIQ 481
                   + L  LDLS N L+G +P+       L  L L +N   G+IPKS+G   S++
Sbjct: 356 --------NNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLR 407

Query: 482 TLSLYNNSLIGELPSFFKSCSQLILMDLGKNGLSGEIPTWIGEGLPKLVVLSLKSNKFHG 541
            + L +NS  GELPS F     +  +D+  N L G I +   + +P L +LSL  NKF G
Sbjct: 408 RVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWD-MPSLQMLSLARNKFFG 466

Query: 542 NIPFQVCQLSYIQILDLSLNNISGIIPKCLNNFTGMAQKSSSNLAITSNYTFERQGIEFL 601
            +P        ++ LDLS N  SG +P+ L + + + Q                      
Sbjct: 467 GLP-DSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQ---------------------- 503

Query: 602 ESYVDNVVLTWKGSQHEYRSTLGLVKILDFSMNKLSGTIPEEIMDLVGLVALNLSRNNLT 661
                                      L  S NKLSG IP+E+     LV+L+LS N L+
Sbjct: 504 ---------------------------LKLSENKLSGEIPDELSSCKKLVSLDLSHNQLS 536

Query: 662 GQITPKIDQLKSLDFLDLSQNQFVGGIPSSLCQLSRLSVMNLSYNNLSGKIPLGTQLQSF 721
           GQI     ++  L  LDLSQNQ  G IP +L  +  L  +N+S+N+L G +P      + 
Sbjct: 537 GQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAI 596

Query: 722 NASVYAGNPELCGLPLRNKCPDEDSAASPERDDANTPEGEDQLITFGFYVSVILGFFI 779
           NAS  AGN +LCG        D  S   P +    TP       ++ FY++  LG F+
Sbjct: 597 NASAVAGNIDLCG-------GDTTSGLPPCKRVRKTP-------SWWFYITCTLGAFL 640


Length = 968

>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 789
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
PLN03150623 hypothetical protein; Provisional 99.56
PLN03150623 hypothetical protein; Provisional 99.51
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.35
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.34
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.24
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.22
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.18
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.14
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.08
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.06
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.05
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.91
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.9
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.89
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.88
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.86
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.84
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.61
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.57
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.51
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.49
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.42
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.4
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.32
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.21
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.19
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.13
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.12
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.09
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.03
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.95
PRK15386426 type III secretion protein GogB; Provisional 97.83
PRK15386426 type III secretion protein GogB; Provisional 97.71
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.66
KOG4341483 consensus F-box protein containing LRR [General fu 97.54
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.52
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.52
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.5
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.47
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.4
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.38
KOG4341483 consensus F-box protein containing LRR [General fu 96.89
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.85
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.7
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.81
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.53
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.5
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.46
KOG4308478 consensus LRR-containing protein [Function unknown 94.66
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.05
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.26
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.13
KOG4308478 consensus LRR-containing protein [Function unknown 92.77
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.92
smart0037026 LRR Leucine-rich repeats, outliers. 90.92
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.27
smart0037026 LRR Leucine-rich repeats, outliers. 89.88
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.88
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.07
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.85
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.3e-71  Score=669.31  Aligned_cols=583  Identities=35%  Similarity=0.523  Sum_probs=476.5

Q ss_pred             HHHHHHHHHHhhcCcCCCCCCCCCCCCCCCCCCCceeeeEecCCCCcEEEEEcCCCCCCCCcccccCccccCCCCCCEEe
Q 042537            2 EEEREALLEFKQSLVDEYGILSSWGREDDKRDCCYWRGVRCSNTTGHVIVLDLQVLVHSEPLKGTISPSLLKLYHLRHLD   81 (789)
Q Consensus         2 ~~~~~~ll~~~~~~~~~~~~~~~w~~~~~~~~~c~w~gv~c~~~~~~v~~l~L~~~~~~~~l~~~l~~~~~~l~~L~~L~   81 (789)
                      ++|++||++||+++.+|.+.+.+|.   ..++||.|.||+|++ .++|+.|+|++    +.+.|.+++.|..+++|++|+
T Consensus        28 ~~~~~~l~~~~~~~~~~~~~~~~w~---~~~~~c~w~gv~c~~-~~~v~~L~L~~----~~i~~~~~~~~~~l~~L~~L~   99 (968)
T PLN00113         28 AEELELLLSFKSSINDPLKYLSNWN---SSADVCLWQGITCNN-SSRVVSIDLSG----KNISGKISSAIFRLPYIQTIN   99 (968)
T ss_pred             HHHHHHHHHHHHhCCCCcccCCCCC---CCCCCCcCcceecCC-CCcEEEEEecC----CCccccCChHHhCCCCCCEEE
Confidence            6899999999999988888899997   577899999999974 57999999999    888999999999999999999


Q ss_pred             CCCCCCCCCCCcccc-cCCCCCCEEecCCCcCCCCCCccccCCCCCcEEeccCccCCCCcchHHhhCCCCCCCEEEcCCC
Q 042537           82 LSENDFSGSRIPEFI-GSLNKLRYLSLSSAEFEGPIPSQLGNLSRLKYLDLSYINLNKSRDWLRIIDKLPSLRTLNLEHC  160 (789)
Q Consensus        82 Ls~n~i~~~~~~~~~-~~l~~L~~L~Ls~n~i~~~~p~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~L~~n  160 (789)
                      |++|++++. +|..+ ..+++|++|+|++|.+++.+|.  +.+++|++|+|++|.+.+.  +|..++++++|++|++++|
T Consensus       100 Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~--~p~~~~~l~~L~~L~L~~n  174 (968)
T PLN00113        100 LSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGE--IPNDIGSFSSLKVLDLGGN  174 (968)
T ss_pred             CCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCccccc--CChHHhcCCCCCEEECccC
Confidence            999999875 77655 4899999999999999988775  5689999999999999864  6788999999999999999


Q ss_pred             CCCCCccccccccccCCCCCCeEEccCCCCCCCchhHHHhhcCCCcEEEccCCCCcccCchhhhcCCCCcEEECCCCCcc
Q 042537          161 HLPPIIPSDLLHLNFSTSSLGALYLFENSLSSSIYPWLFNISSKLVVLDLDSNLLQGSLLEPFDRMVSLRTLYLGFNELE  240 (789)
Q Consensus       161 ~l~~~~~~~~~~~~l~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~L~~n~L~  240 (789)
                      .+.+..|.  .+.++  ++|++|++++|.+.+.+|..+..+. +|++|++++|.+.+..|..++++++|++|+++     
T Consensus       175 ~l~~~~p~--~~~~l--~~L~~L~L~~n~l~~~~p~~l~~l~-~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~-----  244 (968)
T PLN00113        175 VLVGKIPN--SLTNL--TSLEFLTLASNQLVGQIPRELGQMK-SLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLV-----  244 (968)
T ss_pred             cccccCCh--hhhhC--cCCCeeeccCCCCcCcCChHHcCcC-CccEEECcCCccCCcCChhHhcCCCCCEEECc-----
Confidence            98877773  34444  7777777777777766666666554 67777777777776677777777777777666     


Q ss_pred             EEecCCCcCcccchhhhhCCCCCCEEEccCCCCCCccChhhhhcCCCCcEEEccCCcccccccCCCCCcccceeEeccCc
Q 042537          241 ELFLGKNRLNGTINQWLSRMYKLDALSLSGNSLTGVVTESVFSELSNLKALHLDDNSFTLKFSHDWIPPFQLIIILLGSC  320 (789)
Q Consensus       241 ~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~~~~L~~L~l~~~  320 (789)
                           +|.+.+.+|..++++++|++|++++|.+.+.+|. .+.++++|++|++++|.+.+                    
T Consensus       245 -----~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~L~Ls~n~l~~--------------------  298 (968)
T PLN00113        245 -----YNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPP-SIFSLQKLISLDLSDNSLSG--------------------  298 (968)
T ss_pred             -----CceeccccChhHhCCCCCCEEECcCCeeeccCch-hHhhccCcCEEECcCCeecc--------------------
Confidence                 5555556666677777777777777776655554 45666666666666666553                    


Q ss_pred             cCCCCCchhccCCCCccEEEccCCcCCCCcchhHhhhccCCCeeeeccccccccCCCCCCCCCCCCCEEEccCCcccccC
Q 042537          321 QMGPHFPKWLQTQNQIEVLDISDAGISDTVPDWFWDLSHTIADFNLSNNHIKGKLPNLSLRFDPFSSSIDISSNYFEGLI  400 (789)
Q Consensus       321 ~~~~~~~~~l~~l~~L~~L~ls~n~i~~~~~~~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~~L~~L~l~~n~l~~~~  400 (789)
                          .+|.++..+++|+.|++++|.+.+..|..+..+ ++|+.|++++|.+.+.+|.                       
T Consensus       299 ----~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l-~~L~~L~L~~n~l~~~~p~-----------------------  350 (968)
T PLN00113        299 ----EIPELVIQLQNLEILHLFSNNFTGKIPVALTSL-PRLQVLQLWSNKFSGEIPK-----------------------  350 (968)
T ss_pred             ----CCChhHcCCCCCcEEECCCCccCCcCChhHhcC-CCCCEEECcCCCCcCcCCh-----------------------
Confidence                556666667777777777777666555544332 2344444444433332222                       


Q ss_pred             CCCCCCCcEEEcCCCcCccccchhcccCCCCCCEEEcCCCccccCCCcccccCCCCcEEEcCCCcCcccCCccccccCcc
Q 042537          401 PPLPSNASVLNLSRNKFSESISFLCSINGHKLEFLDLSNNILSGRLPDCWMQFDRLAVLSLANNFFSGKIPKSMGFLHSI  480 (789)
Q Consensus       401 ~~~~~~L~~L~l~~n~i~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L  480 (789)
                        .+.                      ..++|+.|++++|++++.+|..+..+++|+.|++++|++.+..|..+..+++|
T Consensus       351 --~l~----------------------~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L  406 (968)
T PLN00113        351 --NLG----------------------KHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSL  406 (968)
T ss_pred             --HHh----------------------CCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCC
Confidence              100                      01678888888888888888888888899999999999988889888889999


Q ss_pred             cEEEccCCeeeeeCCcCccCCCCCcEEeCCCCcccccCchhhhhcCCCCcEEEcCCCcccccCCCCccCCCcCceEeccC
Q 042537          481 QTLSLYNNSLIGELPSFFKSCSQLILMDLGKNGLSGEIPTWIGEGLPKLVVLSLKSNKFHGNIPFQVCQLSYIQILDLSL  560 (789)
Q Consensus       481 ~~L~L~~n~l~~~~~~~~~~l~~L~~L~ls~n~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~  560 (789)
                      +.|++++|++++..|..|..+++|+.|++++|.+.+.+|..+. .+++|+.|++++|++.+.+|..+ ..++|+.|++++
T Consensus       407 ~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~-~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~  484 (968)
T PLN00113        407 RRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKW-DMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSR  484 (968)
T ss_pred             CEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhc-cCCCCcEEECcCceeeeecCccc-ccccceEEECcC
Confidence            9999999999988999999999999999999999988887766 68999999999999998888755 468999999999


Q ss_pred             CcccccCCccccccccCcccCCCccccccCcccccccccccccccceeEEEeeccccccccccCceeEEEcccCcccccc
Q 042537          561 NNISGIIPKCLNNFTGMAQKSSSNLAITSNYTFERQGIEFLESYVDNVVLTWKGSQHEYRSTLGLVKILDFSMNKLSGTI  640 (789)
Q Consensus       561 N~l~~~~p~~~~~l~~L~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~N~l~~~~  640 (789)
                      |++++..|..+.++++|                                                 +.|++++|++.+.+
T Consensus       485 n~l~~~~~~~~~~l~~L-------------------------------------------------~~L~Ls~N~l~~~~  515 (968)
T PLN00113        485 NQFSGAVPRKLGSLSEL-------------------------------------------------MQLKLSENKLSGEI  515 (968)
T ss_pred             CccCCccChhhhhhhcc-------------------------------------------------CEEECcCCcceeeC
Confidence            99999988887776665                                                 89999999999999


Q ss_pred             chhhhccccCcEEEccCCcceeecCcccccCCCCCEEeCCCCcccccCchhhhcCCCCCeEeccCCcccccCCCCCcccc
Q 042537          641 PEEIMDLVGLVALNLSRNNLTGQITPKIDQLKSLDFLDLSQNQFVGGIPSSLCQLSRLSVMNLSYNNLSGKIPLGTQLQS  720 (789)
Q Consensus       641 p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~~  720 (789)
                      |+.+..+++|++|+|++|.+++.+|..++.+++|+.|||++|++++.+|..+..+++|++|++++|+++|.+|..+++.+
T Consensus       516 p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~  595 (968)
T PLN00113        516 PDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLA  595 (968)
T ss_pred             ChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccCCCCCCCCCC
Q 042537          721 FNASVYAGNPELCGLP  736 (789)
Q Consensus       721 ~~~~~~~~n~~lc~~~  736 (789)
                      +....+.|||.+|+.+
T Consensus       596 ~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        596 INASAVAGNIDLCGGD  611 (968)
T ss_pred             cChhhhcCCccccCCc
Confidence            9999999999999864



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query789
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-47
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-46
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 9e-17
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 4e-05
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 5e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 186 bits (472), Expect = 4e-47, Method: Compositional matrix adjust. Identities = 204/699 (29%), Positives = 314/699 (44%), Gaps = 101/699 (14%) Query: 96 IGSLNKLRYLSLSSA--EFEGPIPSQLGNLSRLKYLDLSYINLNKSR--DWLRIIDKLPS 151 +GS + L++L++SS +F G + L L+ L+ LDLS +++ + W+ + D Sbjct: 119 LGSCSGLKFLNVSSNTLDFPGKVSGGL-KLNSLEVLDLSANSISGANVVGWV-LSDGCGE 176 Query: 152 LRTLNLEHCHLPPIIP-SDLLHLNFSTSSLGALYLFENSLSSSIYPWLFNISSKLVVLDL 210 L+ L + + + S ++L F L + N+ S+ I P+L + S+ L LD+ Sbjct: 177 LKHLAISGNKISGDVDVSRCVNLEF-------LDVSSNNFSTGI-PFLGDCSA-LQHLDI 227 Query: 211 DSNLLQGSLLEPFDRMVSLRTXXXXXXXXXXXXXXKNRLNGTINQWLSR-----MYKLDA 265 N L G F R +S T LN + NQ++ + L Sbjct: 228 SGNKLSGD----FSRAISTCTELKL-------------LNISSNQFVGPIPPLPLKSLQY 270 Query: 266 LSLSGNSLTGVVTESVFSELSNLKALHLDDNSFTLKFSHDWIPPF-----QLIIILLGSC 320 LSL+ N TG + + + L L L N F + +PPF L + L S Sbjct: 271 LSLAENKFTGEIPDFLSGACDTLTGLDLSGNHF-----YGAVPPFFGSCSLLESLALSSN 325 Query: 321 QMGPHFP-KWLQTQNQIEVLDISDAGISDTVPDWFWDLSHTIADFNLSNNHIKGK-LPNL 378 P L ++VLD+S S +P+ +LS ++ +LS+N+ G LPNL Sbjct: 326 NFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNL 385 Query: 379 SLRXXXXXXXXXXXXNYFEGLIPPLPSNASVLNLSRNKFSESISFLCSINGHKLEFLDLS 438 N F G IPP SN S +L L LS Sbjct: 386 CQNPKNTLQELYLQNNGFTGKIPPTLSNCS----------------------ELVSLHLS 423 Query: 439 NNILSGRLPDCWMQFDRLAVLSLANNFFSGKIPKSMGFLHSIQTLSLYNNSLIGELPSFF 498 N LSG +P +L L L N G+IP+ + ++ +++TL L N L GE+PS Sbjct: 424 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGL 483 Query: 499 KSCSQLILMDLGKNGLSGEIPTWIGEGLPKLVVLSLKSNKFHGNIPFQVCQLSYIQILDL 558 +C+ L + L N L+GEIP WIG L L +L L +N F GNIP ++ + LDL Sbjct: 484 SNCTNLNWISLSNNRLTGEIPKWIGR-LENLAILKLSNNSFSGNIPAELGDCRSLIWLDL 542 Query: 559 SLNNISGIIPKCLNNFTGMAQKSSSNLAITSNYTFERQGIEFLESYVDNVVLTWKGSQHE 618 + N +G IP + +G K ++N Y + + E + +L ++G + E Sbjct: 543 NTNLFNGTIPAAMFKQSG---KIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSE 599 Query: 619 YRSTL------------------------GLVKILDFSMNKLSGTIPEEIMDLVGLVALN 654 + L G + LD S N LSG IP+EI + L LN Sbjct: 600 QLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILN 659 Query: 655 LSRNNLTGQITPKIDQLKSLDFLDLSQNQFVGGIPSSLCQLSRLSVMNLSYNNLSGKIPL 714 L N+++G I ++ L+ L+ LDLS N+ G IP ++ L+ L+ ++LS NNLSG IP Sbjct: 660 LGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE 719 Query: 715 GTQLQSFNASVYAGNPELCGLPLRNKCP-DEDSAASPER 752 Q ++F + + NP LCG PL P + D A +R Sbjct: 720 MGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQR 758
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query789
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-169
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-77
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-66
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-64
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-60
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-52
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-69
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-57
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-56
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-54
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-65
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-48
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-38
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-32
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-24
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-65
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-43
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-36
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-33
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-57
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-47
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-45
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-42
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-39
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-34
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-54
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-48
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-47
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-51
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-48
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-42
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-38
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-42
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-38
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-40
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-30
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-12
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-27
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-15
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-18
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-17
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-11
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-18
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-07
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  505 bits (1304), Expect = e-169
 Identities = 200/802 (24%), Positives = 314/802 (39%), Gaps = 103/802 (12%)

Query: 2   EEEREALLEFKQSLVDEYGILSSWGREDDKRDCCYWRGVRCSNTTGHVIVLDLQVLVHSE 61
             E   L+ FK  L D+  +L  W      ++ C + GV C +    V  +DL     + 
Sbjct: 11  YREIHQLISFKDVLPDK-NLLPDW---SSNKNPCTFDGVTCRD--DKVTSIDLSSKPLNV 64

Query: 62  PLKGTISPSLLKLYHLRHLDLSENDFSGSRIPEFIGSLNKLRYLSLSSAEFEGPIPSQLG 121
                +S SLL L  L  L LS +  +GS +  F                          
Sbjct: 65  GF-SAVSSSLLSLTGLESLFLSNSHINGS-VSGF-------------------------K 97

Query: 122 NLSRLKYLDLSYINLNKSRDWLRIIDKLPSLRTLNLEHCHLPPIIPSDLLHLNFSTSSLG 181
             + L  LDLS  +L+     L  +     L+ LN+    L               +SL 
Sbjct: 98  CSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGG---LKLNSLE 154

Query: 182 ALYLFENSLSSSIYPWLFNIS--SKLVVLDLDSNLLQGSLLEPFDRMVSLRTLYLGFN-- 237
            L L  NS+S +            +L  L +  N + G +     R V+L  L +  N  
Sbjct: 155 VLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDV--DVSRCVNLEFLDVSSNNF 212

Query: 238 -----------ELEELFLGKNRLNGTINQWLSRMYKLDALSLSGNSLTGVVTESVFSELS 286
                       L+ L +  N+L+G  ++ +S   +L  L++S N   G +       L 
Sbjct: 213 STGIPFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP---LPLK 269

Query: 287 NLKALHLDDNSFTLKFSHDWIPPF------QLIIILLGSCQMGPHFPKWLQTQNQIEVLD 340
           +L+ L L +N FT       IP F       L  + L         P +  + + +E L 
Sbjct: 270 SLQYLSLAENKFT-----GEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLA 324

Query: 341 ISDAGISDTVPDWFWDLSHTIADFNLSNNHIKGKLPNLSLRFDPFSSSIDISSNYFEGLI 400
           +S    S  +P         +   +LS N   G+LP           ++D+SSN F G I
Sbjct: 325 LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPI 384

Query: 401 PP-----LPSNASVLNLSRNKFSESI-SFLCSINGHKLEFLDLSNNILSGRLPDCWMQFD 454
            P       +    L L  N F+  I   L   N  +L  L LS N LSG +P       
Sbjct: 385 LPNLCQNPKNTLQELYLQNNGFTGKIPPTLS--NCSELVSLHLSFNYLSGTIPSSLGSLS 442

Query: 455 RLAVLSLANNFFSGKIPKSMGFLHSIQTLSLYNNSLIGELPSFFKSCSQLILMDLGKNGL 514
           +L  L L  N   G+IP+ + ++ +++TL L  N L GE+PS   +C+ L  + L  N L
Sbjct: 443 KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRL 502

Query: 515 SGEIPTWIGEGLPKLVVLSLKSNKFHGNIPFQVCQLSYIQILDLSLNNISGIIPKCLNNF 574
           +GEIP WIG  L  L +L L +N F GNIP ++     +  LDL+ N  +G IP  +   
Sbjct: 503 TGEIPKWIGR-LENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQ 561

Query: 575 TGMAQKSSSNLAITSNYTFERQGIEFLESYVDNVVLTWKGSQHEYRSTLGLVKILDFSMN 634
           +G     ++N      Y + +      E +    +L ++G + E  + L      + +  
Sbjct: 562 SGKI---AANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSR 618

Query: 635 KLSGTIPEEIMDLVGLVALNLSRNNLTGQITPKIDQLKSLDFLDLSQNQFVGGIPSSLCQ 694
              G       +   ++ L++S N L+G I  +I  +  L  L+L  N   G IP  +  
Sbjct: 619 VYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGD 678

Query: 695 LSRLSVMNLSYNNLS------------------------GKIPLGTQLQSFNASVYAGNP 730
           L  L++++LS N L                         G IP   Q ++F  + +  NP
Sbjct: 679 LRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNP 738

Query: 731 ELCGLPLRNKCPDEDSAASPER 752
            LCG PL    P      +  +
Sbjct: 739 GLCGYPLPRCDPSNADGYAHHQ 760


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query789
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.47
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.37
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.32
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.32
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.32
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.27
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.24
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.23
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.23
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.0
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.97
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.86
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.75
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.4
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.37
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.32
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.21
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.9
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.58
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.29
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.15
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.98
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.61
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4.8e-89  Score=801.28  Aligned_cols=708  Identities=30%  Similarity=0.424  Sum_probs=615.3

Q ss_pred             HHHHHHHHHHhhcCcCCCCCCCCCCCCCCCCCCCceeeeEecCCCCcEEEEEcCCCCCCCCcccc---cCccccCCCCCC
Q 042537            2 EEEREALLEFKQSLVDEYGILSSWGREDDKRDCCYWRGVRCSNTTGHVIVLDLQVLVHSEPLKGT---ISPSLLKLYHLR   78 (789)
Q Consensus         2 ~~~~~~ll~~~~~~~~~~~~~~~w~~~~~~~~~c~w~gv~c~~~~~~v~~l~L~~~~~~~~l~~~---l~~~~~~l~~L~   78 (789)
                      ++|++|||+||+++.||. ++++|+   .+++||+|+||+|+  .++|++|+|++    ..+.|.   +|+++.++++|+
T Consensus        11 ~~~~~all~~k~~~~~~~-~l~~W~---~~~~~C~w~gv~C~--~~~v~~L~L~~----~~l~g~~~~l~~~l~~L~~L~   80 (768)
T 3rgz_A           11 YREIHQLISFKDVLPDKN-LLPDWS---SNKNPCTFDGVTCR--DDKVTSIDLSS----KPLNVGFSAVSSSLLSLTGLE   80 (768)
T ss_dssp             HHHHHHHHHHHTTCSCTT-SSTTCC---TTSCGGGSTTEEEE--TTEEEEEECTT----SCCCEEHHHHHHHTTTCTTCC
T ss_pred             HHHHHHHHHHHhhCCCcc-cccCCC---CCCCCcCCcceEEC--CCcEEEEECCC----CCcCCccCccChhHhccCccc
Confidence            679999999999999998 999998   47899999999998  68999999999    788898   899999999999


Q ss_pred             EEeCCCCCCCCCCCcccccCCCCCCEEecCCCcCCCCCCc--cccCCCCCcEEeccCccCCCCcchHHhh-CCCCCCCEE
Q 042537           79 HLDLSENDFSGSRIPEFIGSLNKLRYLSLSSAEFEGPIPS--QLGNLSRLKYLDLSYINLNKSRDWLRII-DKLPSLRTL  155 (789)
Q Consensus        79 ~L~Ls~n~i~~~~~~~~~~~l~~L~~L~Ls~n~i~~~~p~--~~~~l~~L~~L~Ls~n~l~~~~~~~~~l-~~l~~L~~L  155 (789)
                      .++++.+.+.  ..|..++.+++|++|+|++|.+.+.+|.  .++++++|++|+|++|.+.+.  .|..+ .++++|++|
T Consensus        81 ~l~~~~~~~~--~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~--~~~~~~~~l~~L~~L  156 (768)
T 3rgz_A           81 SLFLSNSHIN--GSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFP--GKVSGGLKLNSLEVL  156 (768)
T ss_dssp             EEECTTSCEE--ECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECC--SSCCSCCCCTTCSEE
T ss_pred             ccCCcCCCcC--CCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCc--CCHHHhccCCCCCEE
Confidence            9999999876  4678899999999999999999988888  999999999999999998864  34444 889999999


Q ss_pred             EcCCCCCCCCcccccc-ccccCCCCCCeEEccCCCCCCCchhHHHhhcCCCcEEEccCCCCcccCchhhhcCCCCcEEEC
Q 042537          156 NLEHCHLPPIIPSDLL-HLNFSTSSLGALYLFENSLSSSIYPWLFNISSKLVVLDLDSNLLQGSLLEPFDRMVSLRTLYL  234 (789)
Q Consensus       156 ~L~~n~l~~~~~~~~~-~~~l~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~L  234 (789)
                      ++++|.+++..+..+. +.++  ++|++|++++|.+.+..+.   ...++|++|++++|.+.+.+|. ++++++|++|++
T Consensus       157 ~Ls~n~l~~~~~~~~~~~~~l--~~L~~L~Ls~n~l~~~~~~---~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~L  230 (768)
T 3rgz_A          157 DLSANSISGANVVGWVLSDGC--GELKHLAISGNKISGDVDV---SRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDI  230 (768)
T ss_dssp             ECCSSCCEEETHHHHHHTTCC--TTCCEEECCSSEEESCCBC---TTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEEC
T ss_pred             ECCCCccCCcCChhhhhhccC--CCCCEEECCCCcccccCCc---ccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEEC
Confidence            9999999887763211 4555  8999999999999876664   3345999999999999988777 999999999999


Q ss_pred             CCCCccEEecCCCcCcccchhhhhCCCCCCEEEccCCCCCCccChhhhhcCCCCcEEEccCCcccccccCCCCCc-ccce
Q 042537          235 GFNELEELFLGKNRLNGTINQWLSRMYKLDALSLSGNSLTGVVTESVFSELSNLKALHLDDNSFTLKFSHDWIPP-FQLI  313 (789)
Q Consensus       235 ~~n~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~~-~~L~  313 (789)
                      +          +|.+++.+|..++++++|++|++++|.+.+.+|.  . .+++|++|++++|++++..+..+... ++|+
T Consensus       231 s----------~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~--~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~  297 (768)
T 3rgz_A          231 S----------GNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP--L-PLKSLQYLSLAENKFTGEIPDFLSGACDTLT  297 (768)
T ss_dssp             C----------SSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCC--C-CCTTCCEEECCSSEEEESCCCCSCTTCTTCS
T ss_pred             c----------CCcCCCcccHHHhcCCCCCEEECCCCcccCccCc--c-ccCCCCEEECcCCccCCccCHHHHhhcCcCC
Confidence            9          7778888999999999999999999999987776  2 89999999999999998888888775 9999


Q ss_pred             eEeccCccCCCCCchhccCCCCccEEEccCCcCCCCcchhHhhhccCCCeeeeccccccccCCCCCCCCCC-CCCEEEcc
Q 042537          314 IILLGSCQMGPHFPKWLQTQNQIEVLDISDAGISDTVPDWFWDLSHTIADFNLSNNHIKGKLPNLSLRFDP-FSSSIDIS  392 (789)
Q Consensus       314 ~L~l~~~~~~~~~~~~l~~l~~L~~L~ls~n~i~~~~~~~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~-~L~~L~l~  392 (789)
                      +|++++|.+.+.+|..+..+++|++|++++|.+.+.+|.......++|+.|++++|.+++.+|. .+..++ .|+.|+++
T Consensus       298 ~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~-~l~~l~~~L~~L~Ls  376 (768)
T 3rgz_A          298 GLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPE-SLTNLSASLLTLDLS  376 (768)
T ss_dssp             EEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCT-THHHHTTTCSEEECC
T ss_pred             EEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccH-HHHhhhcCCcEEEcc
Confidence            9999999999999999999999999999999999888877445567999999999999998988 566665 89999999


Q ss_pred             CCcccccCCCC-----CCCCcEEEcCCCcCccccchhcccCCCCCCEEEcCCCccccCCCcccccCCCCcEEEcCCCcCc
Q 042537          393 SNYFEGLIPPL-----PSNASVLNLSRNKFSESISFLCSINGHKLEFLDLSNNILSGRLPDCWMQFDRLAVLSLANNFFS  467 (789)
Q Consensus       393 ~n~l~~~~~~~-----~~~L~~L~l~~n~i~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~  467 (789)
                      +|.+++.+|..     .++|+.|++++|++++.++..... +++|++|++++|.+++.+|..|.++++|+.|++++|+++
T Consensus       377 ~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~-l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~  455 (768)
T 3rgz_A          377 SNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN-CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLE  455 (768)
T ss_dssp             SSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGG-CTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCC
T ss_pred             CCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhc-CCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCccc
Confidence            99999887765     467999999999999876654433 389999999999999999999999999999999999999


Q ss_pred             ccCCccccccCcccEEEccCCeeeeeCCcCccCCCCCcEEeCCCCcccccCchhhhhcCCCCcEEEcCCCcccccCCCCc
Q 042537          468 GKIPKSMGFLHSIQTLSLYNNSLIGELPSFFKSCSQLILMDLGKNGLSGEIPTWIGEGLPKLVVLSLKSNKFHGNIPFQV  547 (789)
Q Consensus       468 ~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~ls~n~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~~~~~  547 (789)
                      +.+|..+..+++|++|++++|++++.+|..+.++++|++|++++|++++.+|.++. .+++|++|++++|++++.+|..+
T Consensus       456 ~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~-~l~~L~~L~L~~N~l~~~~p~~l  534 (768)
T 3rgz_A          456 GEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIG-RLENLAILKLSNNSFSGNIPAEL  534 (768)
T ss_dssp             SCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGG-GCTTCCEEECCSSCCEEECCGGG
T ss_pred             CcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHh-cCCCCCEEECCCCcccCcCCHHH
Confidence            99999999999999999999999999999999999999999999999999999987 79999999999999999999999


Q ss_pred             cCCCcCceEeccCCcccccCCccccccccCcccCCCcc-cc--ccC----------------ccccccccccccc--ccc
Q 042537          548 CQLSYIQILDLSLNNISGIIPKCLNNFTGMAQKSSSNL-AI--TSN----------------YTFERQGIEFLES--YVD  606 (789)
Q Consensus       548 ~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~l~~~~~-~~--~~~----------------~~~~~~~~~~~~~--~~~  606 (789)
                      ..+++|+.|++++|++++.+|..+.....+........ ..  ...                .......+..+..  ...
T Consensus       535 ~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~  614 (768)
T 3rgz_A          535 GDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCN  614 (768)
T ss_dssp             GGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSC
T ss_pred             cCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccc
Confidence            99999999999999999999998877666544322110 00  000                0000000000000  000


Q ss_pred             eeEEEeeccccccccccCceeEEEcccCccccccchhhhccccCcEEEccCCcceeecCcccccCCCCCEEeCCCCcccc
Q 042537          607 NVVLTWKGSQHEYRSTLGLVKILDFSMNKLSGTIPEEIMDLVGLVALNLSRNNLTGQITPKIDQLKSLDFLDLSQNQFVG  686 (789)
Q Consensus       607 ~~~~~~~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~  686 (789)
                      .......|..+.....++.|+.||+++|+++|.+|..|+++++|+.|+|++|+++|.+|..++++++|++|||++|+++|
T Consensus       615 l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g  694 (768)
T 3rgz_A          615 ITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDG  694 (768)
T ss_dssp             TTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEE
T ss_pred             cccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccC
Confidence            00122344455556778899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCchhhhcCCCCCeEeccCCcccccCCCCCccccccccccCCCCCCCCCCCCCCCCCCCC
Q 042537          687 GIPSSLCQLSRLSVMNLSYNNLSGKIPLGTQLQSFNASVYAGNPELCGLPLRNKCPDEDS  746 (789)
Q Consensus       687 ~~p~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~l~~~c~~~~~  746 (789)
                      .+|..+..+++|++||+++|+++|.||.++++.+|...+|.|||++||.|+. .|..+..
T Consensus       695 ~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~~  753 (768)
T 3rgz_A          695 RIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSNA  753 (768)
T ss_dssp             CCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC-
T ss_pred             cCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCCcc
Confidence            9999999999999999999999999999999999999999999999999987 8976543



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 789
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 84.0 bits (206), Expect = 3e-18
 Identities = 59/265 (22%), Positives = 96/265 (36%), Gaps = 4/265 (1%)

Query: 475 GFLHSIQTLSLYNNSLIG--ELPSFFKSCSQLILMDLGKNGLSGEIPTWIGEGLPKLVVL 532
              + +  L L   +L     +PS   +   L  + +G               L +L  L
Sbjct: 47  TQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYL 106

Query: 533 SLKSNKFHGNIPFQVCQLSYIQILDLSLNNISGIIPKCLNNFTGMAQKSSSNLAITSNYT 592
            +      G IP  + Q+  +  LD S N +SG +P  +++   +   +     I+    
Sbjct: 107 YITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIP 166

Query: 593 FERQGIEFLESYVDNVVLTWKGSQHEYRSTLGLVKILDFSMNKLSGTIPEEIMDLVGLVA 652
                   L + +       + +     +   L          +       +        
Sbjct: 167 DSYGSFSKLFTSMTIS--RNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQ 224

Query: 653 LNLSRNNLTGQITPKIDQLKSLDFLDLSQNQFVGGIPSSLCQLSRLSVMNLSYNNLSGKI 712
                 N       K+   K+L+ LDL  N+  G +P  L QL  L  +N+S+NNL G+I
Sbjct: 225 KIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEI 284

Query: 713 PLGTQLQSFNASVYAGNPELCGLPL 737
           P G  LQ F+ S YA N  LCG PL
Sbjct: 285 PQGGNLQRFDVSAYANNKCLCGSPL 309


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query789
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.98
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.38
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.31
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.29
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.49
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.21
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.61
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.53
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.96
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.66
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=1.2e-37  Score=322.94  Aligned_cols=291  Identities=27%  Similarity=0.411  Sum_probs=241.1

Q ss_pred             CHHHHHHHHHHhhcCcCCCCCCCCCCCCCCCCCCCc--eeeeEecCCC--CcEEEEEcCCCCCCCCccc--ccCccccCC
Q 042537            1 MEEEREALLEFKQSLVDEYGILSSWGREDDKRDCCY--WRGVRCSNTT--GHVIVLDLQVLVHSEPLKG--TISPSLLKL   74 (789)
Q Consensus         1 ~~~~~~~ll~~~~~~~~~~~~~~~w~~~~~~~~~c~--w~gv~c~~~~--~~v~~l~L~~~~~~~~l~~--~l~~~~~~l   74 (789)
                      .|+||+||++||+++.||. .+++|.   .++|||.  |.||+|+...  +||++|+|++    +.+.|  .+|++++++
T Consensus         4 ~~~e~~aLl~~k~~~~~~~-~l~sW~---~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~----~~l~g~~~lp~~l~~L   75 (313)
T d1ogqa_           4 NPQDKQALLQIKKDLGNPT-TLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSG----LNLPKPYPIPSSLANL   75 (313)
T ss_dssp             CHHHHHHHHHHHHHTTCCG-GGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEEC----CCCSSCEECCGGGGGC
T ss_pred             CHHHHHHHHHHHHHCCCCC-cCCCCC---CCCCCCCCcCCCeEEeCCCCcEEEEEEECCC----CCCCCCCCCChHHhcC
Confidence            4899999999999999875 699998   5789995  9999998543  4899999999    77776  688999999


Q ss_pred             CCCCEEeCCC-CCCCCCCCcccccCCCCCCEEecCCCcCCCCCCccccCCCCCcEEeccCccCCCCcchHHhhCCCCCCC
Q 042537           75 YHLRHLDLSE-NDFSGSRIPEFIGSLNKLRYLSLSSAEFEGPIPSQLGNLSRLKYLDLSYINLNKSRDWLRIIDKLPSLR  153 (789)
Q Consensus        75 ~~L~~L~Ls~-n~i~~~~~~~~~~~l~~L~~L~Ls~n~i~~~~p~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~  153 (789)
                      ++|++|+|++ |.+++. +|..|+++++|++|+|++|++.+..+..+..+.+|+++++++|.+...  +|..++++++|+
T Consensus        76 ~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~--~p~~l~~l~~L~  152 (313)
T d1ogqa_          76 PYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGT--LPPSISSLPNLV  152 (313)
T ss_dssp             TTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESC--CCGGGGGCTTCC
T ss_pred             ccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhccccccccccccc--CchhhccCcccc
Confidence            9999999996 888875 999999999999999999999998899999999999999999998874  678999999999


Q ss_pred             EEEcCCCCCCCCccccccccccCCCC-CCeEEccCCCCCCCchhHHHhhcCCCcEEEccCCCCcccCchhhhcCCCCcEE
Q 042537          154 TLNLEHCHLPPIIPSDLLHLNFSTSS-LGALYLFENSLSSSIYPWLFNISSKLVVLDLDSNLLQGSLLEPFDRMVSLRTL  232 (789)
Q Consensus       154 ~L~L~~n~l~~~~~~~~~~~~l~~~~-L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L  232 (789)
                      ++++++|.+.+.+|..+  ..+  .. ++.++++.|++++..+..+...  ....++++++...+.+|..+..+++|+.+
T Consensus       153 ~l~l~~n~l~~~ip~~~--~~l--~~l~~~l~~~~n~l~~~~~~~~~~l--~~~~l~l~~~~~~~~~~~~~~~~~~l~~l  226 (313)
T d1ogqa_         153 GITFDGNRISGAIPDSY--GSF--SKLFTSMTISRNRLTGKIPPTFANL--NLAFVDLSRNMLEGDASVLFGSDKNTQKI  226 (313)
T ss_dssp             EEECCSSCCEEECCGGG--GCC--CTTCCEEECCSSEEEEECCGGGGGC--CCSEEECCSSEEEECCGGGCCTTSCCSEE
T ss_pred             eeecccccccccccccc--ccc--ccccccccccccccccccccccccc--ccccccccccccccccccccccccccccc
Confidence            99999999988877433  333  44 4888899998887777665544  45678899888888888888888888888


Q ss_pred             ECCCCCccEEecCCCcCcccchhhhhCCCCCCEEEccCCCCCCccChhhhhcCCCCcEEEccCCcccccccCCCCCcccc
Q 042537          233 YLGFNELEELFLGKNRLNGTINQWLSRMYKLDALSLSGNSLTGVVTESVFSELSNLKALHLDDNSFTLKFSHDWIPPFQL  312 (789)
Q Consensus       233 ~L~~n~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~~~~L  312 (789)
                      +++          +|.+.+.++ .++.+++|++|+|++|+++|.+|. .|.++++|++|+|++|++++.+| .+..+.+|
T Consensus       227 ~~~----------~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~-~l~~L~~L~~L~Ls~N~l~g~iP-~~~~L~~L  293 (313)
T d1ogqa_         227 HLA----------KNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQ-GLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRF  293 (313)
T ss_dssp             ECC----------SSEECCBGG-GCCCCTTCCEEECCSSCCEECCCG-GGGGCTTCCEEECCSSEEEEECC-CSTTGGGS
T ss_pred             ccc----------ccccccccc-ccccccccccccCccCeecccCCh-HHhCCCCCCEEECcCCcccccCC-CcccCCCC
Confidence            888          566655554 477788899999999999888887 58888999999999998887655 34455566


Q ss_pred             eeEeccCcc
Q 042537          313 IIILLGSCQ  321 (789)
Q Consensus       313 ~~L~l~~~~  321 (789)
                      +.+++++|+
T Consensus       294 ~~l~l~~N~  302 (313)
T d1ogqa_         294 DVSAYANNK  302 (313)
T ss_dssp             CGGGTCSSS
T ss_pred             CHHHhCCCc
Confidence            666666654



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure