Citrus Sinensis ID: 042580


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-
MDINFRLFSERLRRLIEGEEGTLPDATKEQFQNLYTEIEIVTSLLSNYENDMFQILFQSLGGEEEFVFSEVQGILKEMKDFVHESEKVIYTFMISRITQQISGSSSKDLFDALLGLQSQIIDIKQQLQQFRPNNIGLWVELKSYFTEARNSSSTLGFKKRNIMGLEDEIEELLDLLIVGEPSLFIVAIVGNSGFDKTNFAGEAYNNNYAKNYFDCRAWVGCEYYLHKVLDSIIKSVMPRSM
ccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEccccHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHcccccHHcccccEEEEEcccHHHHHHHHHHHHccccc
ccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcHcccccEEEcccccccccccccccccccccEEccccHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHccHHHHHcccEEEEEEccccHHHHHHHHHHHHccccc
MDINFRLFSERLRRLIegeegtlpdatkEQFQNLYTEIEIVTSLLSNYENDMFQILFQSLGGEEEFVFSEVQGILKEMKDFVHESEKVIYTFMISRITqqisgsssKDLFDALLGLQSQIIDIKQQLQQFRPNNIGLWVELKSYFTEarnssstlgfkkrniMGLEDEIEELLDLLIVGEPSLFIVAIVGnsgfdktnfageaynnnyaknyfdcrawvGCEYYLHKVLDSIIKSVMPRSM
MDINFRLFSERLRRliegeegtlpdatkeqFQNLYTEIEIVTSLLSNYENDMFQILFQSLGGEEEFVFSEVQGILKEMKDFVHESEKVIYTFMISRITQQISGSSSKDLFDALLGLQSQIIDIKQQLQQFRPNNIGLWVELKSYFTearnssstlgfkkrNIMGLEDEIEELLDLLIVGEPSLFIVAIVGNSGFDKTNFAGEAYNNNYAKNYFDCRAWVGCEYYLHKVLDSiiksvmprsm
MDINFRLFSerlrrliegeegTLPDATKEQFQNLYTEIEIVTSLLSNYENDMFQILFQSLGGEEEFVFSEVQGILKEMKDFVHESEKVIYTFMISRITQQISGSSSKDLFDALLGLQSQIIDIKQQLQQFRPNNIGLWVELKSYFTEARNSSSTLGFKKRNIMGledeieelldlliVGEPSLFIVAIVGNSGFDKTNFAGEAYNNNYAKNYFDCRAWVGCEYYLHKVLDSIIKSVMPRSM
******LFS*RLRRLI***********KEQFQNLYTEIEIVTSLLSNYENDMFQILFQSLGGEEEFVFSEVQGILKEMKDFVHESEKVIYTFMISRITQQISGSSSKDLFDALLGLQSQIIDIKQQLQQFRPNNIGLWVELKSYFTE*************************LDLLIVGEPSLFIVAIVGNSGFDKTNFAGEAYNNNYAKNYFDCRAWVGCEYYLHKVLDSIIK*******
MDINFRLFSERLRRLIEGEEGTLPDATKEQFQNLYTEIEIVTSLLSNYENDMFQILFQSLGGEEEFVFSEVQGILKEMKDFVHESEKVIYTFMISR************************IDIKQQLQ*******************************RNIMGLEDEIEELLDLLIVGEPSLFIVAIVGNSGFDKTNFAGEAYNNNYAKNYFDCRAWVGCEYYLHKVLDSIIKSVMP***
MDINFRLFSERLRRLIEGEEGTLPDATKEQFQNLYTEIEIVTSLLSNYENDMFQILFQSLGGEEEFVFSEVQGILKEMKDFVHESEKVIYTFMISRITQQISGSSSKDLFDALLGLQSQIIDIKQQLQQFRPNNIGLWVELKSYFTEARNSSSTLGFKKRNIMGLEDEIEELLDLLIVGEPSLFIVAIVGNSGFDKTNFAGEAYNNNYAKNYFDCRAWVGCEYYLHKVLDSIIKSVMPRSM
MDINFRLFSERLRRLIEGEEGTLPDATKEQFQNLYTEIEIVTSLLSNYENDMFQILFQSLGGEEEFVFSEVQGILKEMKDFVHESEKVIYTFMISRITQQISGSSSKDLFDALLGLQSQIIDIKQQLQQFRPNNIGLWVELK*************GFKKRNIMGLEDEIEELLDLLIVGEPSLFIVAIVGNSGFDKTNFAGEAYNNNYAKNYFDCRAWVGCEYYLHKVLDSIIKSVM****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDINFRLFSERLRRLIEGEEGTLPDATKEQFQNLYTEIEIVTSLLSNYENDMFQILFQSLGGEEEFVFSEVQGILKEMKDFVHESEKVIYTFMISRITQQISGSSSKDLFDALLGLQSQIIDIKQQLQQFRPNNIGLWVELKSYFTEARNSSSTxxxxxxxxxxxxxxxxxxxxxLIVGEPSLFIVAIVGNSGFDKTNFAGEAYNNNYAKNYFDCRAWVGCEYYLHKVLDSIIKSVMPRSM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query241 2.2.26 [Sep-21-2011]
Q9M667 835 Disease resistance protei yes no 0.834 0.240 0.263 5e-06
Q9STE7 847 Putative disease resistan no no 0.311 0.088 0.379 6e-06
Q9XIF0 906 Putative disease resistan no no 0.622 0.165 0.261 2e-05
Q9C646 899 Probable disease resistan no no 0.580 0.155 0.247 2e-05
P0C8S1 906 Probable disease resistan no no 0.663 0.176 0.251 4e-05
Q9LQ54 870 Probable disease resistan no no 0.643 0.178 0.254 5e-05
Q9LRR4 1054 Putative disease resistan no no 0.871 0.199 0.225 9e-05
Q9SX38 857 Putative disease resistan no no 0.253 0.071 0.327 0.0002
Q8W474 907 Probable disease resistan no no 0.597 0.158 0.239 0.0002
Q9STE5 847 Putative disease resistan no no 0.854 0.243 0.236 0.0003
>sp|Q9M667|RPP13_ARATH Disease resistance protein RPP13 OS=Arabidopsis thaliana GN=RPP13 PE=2 SV=2 Back     alignment and function desciption
 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 107/239 (44%), Gaps = 38/239 (15%)

Query: 19  EEGTLPDATKEQFQNLYTEIEIVTSLLSNYENDMFQILFQSLGGEEEFVFSEVQGILKEM 78
           EE ++  A KE  + L TE+  +   L + E             E E   S+     K +
Sbjct: 19  EEASMFMAVKEDLEELKTELTCIHGYLKDVE-----------AREREDEVSKEWS--KLV 65

Query: 79  KDFVHESEKVIYTFMIS-----------RITQQISGS-SSKDLFDALLGLQSQIIDIKQQ 126
            DF ++ E V+ T+ +            R+T +I     +  + D +  L+ +I+DI ++
Sbjct: 66  LDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSIVDDIRILKRRILDITRK 125

Query: 127 LQQF------RPNNIGLWVELKSYFTEARNSSSTLGFKKRNIMGLEDEIEELLD-LLIVG 179
            + +       P   G    L+    + R + S    ++  ++GLED+ + LL+ LL   
Sbjct: 126 RETYGIGGLKEPQGGGNTSSLR--VRQLRRARSV--DQEEVVVGLEDDAKILLEKLLDYE 181

Query: 180 EPSLFIVAIVGNSGFDKTNFAGEAYNNNYAKNYFDCRAW--VGCEYYLHKVLDSIIKSV 236
           E + FI++I G  G  KT  A + YN+   K  F+ RAW  V  EY    +L  II+S+
Sbjct: 182 EKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSL 240




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. In contrast to other resistance proteins, it works independently of ESD1 and NSD1 proteins and does not require the accumulation of salicylic acid, suggesting the existence of an independent signaling pathway. The specificity to avirulence proteins differs in the different cultivars.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9STE7|R13L3_ARATH Putative disease resistance RPP13-like protein 3 OS=Arabidopsis thaliana GN=RPP13L3 PE=3 SV=1 Back     alignment and function description
>sp|Q9XIF0|DRL13_ARATH Putative disease resistance protein At1g59780 OS=Arabidopsis thaliana GN=At1g59780 PE=2 SV=1 Back     alignment and function description
>sp|Q9C646|RX24L_ARATH Probable disease resistance protein RXW24L OS=Arabidopsis thaliana GN=RXW24L PE=2 SV=1 Back     alignment and function description
>sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LQ54|DRL12_ARATH Probable disease resistance protein At1g59620 OS=Arabidopsis thaliana GN=At1g59620 PE=2 SV=3 Back     alignment and function description
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q9SX38|DRL4_ARATH Putative disease resistance protein At1g50180 OS=Arabidopsis thaliana GN=At1g50180 PE=3 SV=2 Back     alignment and function description
>sp|Q8W474|DRL7_ARATH Probable disease resistance protein At1g58390 OS=Arabidopsis thaliana GN=At1g58390 PE=2 SV=4 Back     alignment and function description
>sp|Q9STE5|R13L2_ARATH Putative disease resistance RPP13-like protein 2 OS=Arabidopsis thaliana GN=RPP13L2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query241
255566508 985 conserved hypothetical protein [Ricinus 0.618 0.151 0.272 7e-08
225454212 936 PREDICTED: putative disease resistance p 0.912 0.235 0.273 8e-08
297744815 407 unnamed protein product [Vitis vinifera] 0.585 0.346 0.282 2e-07
147800242 801 hypothetical protein VITISV_002459 [Viti 0.821 0.247 0.262 3e-07
2258317 1240 resistance complex protein I2C-2 [Solanu 0.601 0.116 0.312 9e-07
255569114 563 leucine-rich repeat-containing protein, 0.639 0.273 0.289 1e-06
410129757 967 hypothetical protein [Beta vulgaris] 0.406 0.101 0.333 1e-06
297744817 543 unnamed protein product [Vitis vinifera] 0.788 0.349 0.258 1e-06
356496703 910 PREDICTED: disease resistance RPP8-like 0.311 0.082 0.376 1e-06
297745212 706 unnamed protein product [Vitis vinifera] 0.746 0.254 0.253 2e-06
>gi|255566508|ref|XP_002524239.1| conserved hypothetical protein [Ricinus communis] gi|223536516|gb|EEF38163.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score = 63.5 bits (153), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 80/165 (48%), Gaps = 16/165 (9%)

Query: 71  VQGILKEMKDFVHESEKVIYTFMISRITQQISGSSS-KDLFDALLGLQSQIIDIKQQLQQ 129
           V+  + E++   +++E VI TF++   T +  G+S     F +++     I +I+ Q++ 
Sbjct: 58  VRNWVAEIRGVAYDAEDVIETFILEAATGRGEGASGIMKRFTSIIKKVPHIHEIRNQIES 117

Query: 130 FRPNNIGLWVELKSY---FTEARN-SSSTLGFKKR-----------NIMGLEDEIEELLD 174
            R     +   L++Y   F   R  SSS    ++R           +++  +  I +L  
Sbjct: 118 IRTKICDISSSLQTYDIKFVAKREWSSSASEMQQRLRRSYPHDEDEHVISFDAVIRDLKA 177

Query: 175 LLIVGEPSLFIVAIVGNSGFDKTNFAGEAYNNNYAKNYFDCRAWV 219
            L++ E  L +V+IVG  G  KT  A + YN+N  K +FDC AW 
Sbjct: 178 QLMIEEERLRVVSIVGIGGLGKTTLAKKVYNDNRVKQHFDCYAWA 222




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225454212|ref|XP_002274233.1| PREDICTED: putative disease resistance protein At1g50180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297744815|emb|CBI38083.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147800242|emb|CAN77656.1| hypothetical protein VITISV_002459 [Vitis vinifera] Back     alignment and taxonomy information
>gi|2258317|gb|AAB63275.1| resistance complex protein I2C-2 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|255569114|ref|XP_002525526.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223535205|gb|EEF36884.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|410129757|dbj|BAM64835.1| hypothetical protein [Beta vulgaris] Back     alignment and taxonomy information
>gi|297744817|emb|CBI38085.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356496703|ref|XP_003517205.1| PREDICTED: disease resistance RPP8-like protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|297745212|emb|CBI40292.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query241
pfam00931 285 pfam00931, NB-ARC, NB-ARC domain 3e-06
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score = 46.9 bits (112), Expect = 3e-06
 Identities = 22/54 (40%), Positives = 31/54 (57%)

Query: 166 EDEIEELLDLLIVGEPSLFIVAIVGNSGFDKTNFAGEAYNNNYAKNYFDCRAWV 219
           ED IE L++ L+    +L +V IVG  G  KT  A + YN++    +FD  AWV
Sbjct: 2   EDMIEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWV 55


Length = 285

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 241
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 99.95
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.53
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.18
cd01128 249 rho_factor Transcription termination factor rho is 98.58
PRK09376 416 rho transcription termination factor Rho; Provisio 98.55
PTZ00202 550 tuzin; Provisional 98.44
PF13191 185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.39
PRK00411 394 cdc6 cell division control protein 6; Reviewed 98.32
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 98.3
PRK08118 167 topology modulation protein; Reviewed 98.19
TIGR00767 415 rho transcription termination factor Rho. Members 98.18
PF01637 234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.0
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.95
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 97.92
PRK07261 171 topology modulation protein; Provisional 97.87
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.84
PF05496 233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.83
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.82
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.81
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 97.71
PRK06696 223 uridine kinase; Validated 97.69
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 97.68
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 97.64
PRK07667 193 uridine kinase; Provisional 97.63
KOG2543 438 consensus Origin recognition complex, subunit 5 [R 97.59
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.57
PF12061402 DUF3542: Protein of unknown function (DUF3542); In 97.55
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 97.54
PRK13342 413 recombination factor protein RarA; Reviewed 97.48
PRK05480 209 uridine/cytidine kinase; Provisional 97.43
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 97.42
PRK15455 644 PrkA family serine protein kinase; Provisional 97.42
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.41
KOG2028 554 consensus ATPase related to the helicase subunit o 97.39
PF05729 166 NACHT: NACHT domain 97.38
TIGR00235 207 udk uridine kinase. Model contains a number of lon 97.38
PRK05564 313 DNA polymerase III subunit delta'; Validated 97.37
PRK08233 182 hypothetical protein; Provisional 97.37
COG1618 179 Predicted nucleotide kinase [Nucleotide transport 97.33
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.33
PRK09270 229 nucleoside triphosphate hydrolase domain-containin 97.32
PRK06762 166 hypothetical protein; Provisional 97.31
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.3
PRK04195 482 replication factor C large subunit; Provisional 97.26
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.25
PRK06547172 hypothetical protein; Provisional 97.25
PRK12402 337 replication factor C small subunit 2; Reviewed 97.24
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 97.24
PTZ00301 210 uridine kinase; Provisional 97.23
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.22
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 97.21
PRK05541 176 adenylylsulfate kinase; Provisional 97.21
PHA02544 316 44 clamp loader, small subunit; Provisional 97.19
CHL00095 821 clpC Clp protease ATP binding subunit 97.19
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 97.17
COG0572 218 Udk Uridine kinase [Nucleotide transport and metab 97.14
PRK14738 206 gmk guanylate kinase; Provisional 97.13
TIGR02237 209 recomb_radB DNA repair and recombination protein R 97.12
PTZ00112 1164 origin recognition complex 1 protein; Provisional 97.11
PRK00440 319 rfc replication factor C small subunit; Reviewed 97.1
PRK10751 173 molybdopterin-guanine dinucleotide biosynthesis pr 97.1
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.1
PRK13341 725 recombination factor protein RarA/unknown domain f 97.09
TIGR01360 188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 97.08
PRK04040 188 adenylate kinase; Provisional 97.08
PF13173128 AAA_14: AAA domain 97.07
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.06
PLN03025 319 replication factor C subunit; Provisional 97.06
KOG1532 366 consensus GTPase XAB1, interacts with DNA repair p 97.05
smart00382148 AAA ATPases associated with a variety of cellular 97.05
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 97.04
TIGR00554 290 panK_bact pantothenate kinase, bacterial type. Sho 97.03
PRK03992 389 proteasome-activating nucleotidase; Provisional 97.02
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 97.0
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 97.0
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 96.99
PRK10865 857 protein disaggregation chaperone; Provisional 96.98
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 96.96
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 96.94
PF00004132 AAA: ATPase family associated with various cellula 96.93
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 96.92
PRK05439 311 pantothenate kinase; Provisional 96.91
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 96.9
PRK13765 637 ATP-dependent protease Lon; Provisional 96.9
PHA00729 226 NTP-binding motif containing protein 96.89
PF05659147 RPW8: Arabidopsis broad-spectrum mildew resistance 96.88
PRK00300 205 gmk guanylate kinase; Provisional 96.88
PRK08903 227 DnaA regulatory inactivator Hda; Validated 96.88
cd01123 235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.87
cd01133 274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 96.87
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 96.86
PRK00131 175 aroK shikimate kinase; Reviewed 96.86
PLN02318 656 phosphoribulokinase/uridine kinase 96.85
PRK00625 173 shikimate kinase; Provisional 96.85
PF04665 241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.84
COG2256 436 MGS1 ATPase related to the helicase subunit of the 96.83
PRK04841 903 transcriptional regulator MalT; Provisional 96.81
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.81
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 96.79
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 96.79
PRK03846 198 adenylylsulfate kinase; Provisional 96.79
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 96.78
PRK13975 196 thymidylate kinase; Provisional 96.77
PRK10078 186 ribose 1,5-bisphosphokinase; Provisional 96.77
cd00227 175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 96.77
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 96.77
PRK00889 175 adenylylsulfate kinase; Provisional 96.76
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.76
cd04139 164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 96.73
PRK00771 437 signal recognition particle protein Srp54; Provisi 96.72
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 96.72
PF00005137 ABC_tran: ABC transporter This structure is on hol 96.71
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 96.71
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 96.7
PRK13949 169 shikimate kinase; Provisional 96.69
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 96.69
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 96.67
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 96.67
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 96.67
PRK10536 262 hypothetical protein; Provisional 96.67
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 96.66
COG0194 191 Gmk Guanylate kinase [Nucleotide transport and met 96.65
COG1100 219 GTPase SAR1 and related small G proteins [General 96.65
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 96.64
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 96.64
PLN02348 395 phosphoribulokinase 96.64
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 96.63
PRK13947 171 shikimate kinase; Provisional 96.63
TIGR00073 207 hypB hydrogenase accessory protein HypB. HypB is i 96.62
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 96.62
TIGR01313 163 therm_gnt_kin carbohydrate kinase, thermoresistant 96.61
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 96.61
PF03308 266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 96.6
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 96.6
CHL00181 287 cbbX CbbX; Provisional 96.59
PRK14737 186 gmk guanylate kinase; Provisional 96.59
PLN02796 347 D-glycerate 3-kinase 96.58
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 96.58
TIGR00064 272 ftsY signal recognition particle-docking protein F 96.58
PRK06893 229 DNA replication initiation factor; Validated 96.58
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 96.58
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 96.57
PRK14530 215 adenylate kinase; Provisional 96.57
COG1763 161 MobB Molybdopterin-guanine dinucleotide biosynthes 96.57
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 96.57
COG1428 216 Deoxynucleoside kinases [Nucleotide transport and 96.56
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 96.54
PF03266 168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 96.54
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.54
COG1124 252 DppF ABC-type dipeptide/oligopeptide/nickel transp 96.53
smart00173 164 RAS Ras subfamily of RAS small GTPases. Similar in 96.53
cd03116159 MobB Molybdenum is an essential trace element in t 96.52
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.51
cd04119 168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 96.51
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 96.51
PRK12339 197 2-phosphoglycerate kinase; Provisional 96.51
cd03255 218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 96.5
PRK09435 332 membrane ATPase/protein kinase; Provisional 96.49
PRK05057 172 aroK shikimate kinase I; Reviewed 96.49
PF13521 163 AAA_28: AAA domain; PDB: 1LW7_A. 96.49
PF07693 325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 96.48
cd03225 211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 96.47
PRK09361 225 radB DNA repair and recombination protein RadB; Pr 96.47
cd00879 190 Sar1 Sar1 subfamily. Sar1 is an essential componen 96.47
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 96.47
cd04159 159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 96.47
cd01862 172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 96.46
cd04155 173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 96.46
PF07726131 AAA_3: ATPase family associated with various cellu 96.46
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 96.46
COG2019 189 AdkA Archaeal adenylate kinase [Nucleotide transpo 96.45
PRK14527 191 adenylate kinase; Provisional 96.45
TIGR00960 216 3a0501s02 Type II (General) Secretory Pathway (IIS 96.45
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 96.45
PRK10463 290 hydrogenase nickel incorporation protein HypB; Pro 96.44
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.44
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 96.44
TIGR01166 190 cbiO cobalt transport protein ATP-binding subunit. 96.43
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 96.43
PRK08727 233 hypothetical protein; Validated 96.43
PRK06761 282 hypothetical protein; Provisional 96.42
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 96.42
PF01078 206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 96.42
cd04163 168 Era Era subfamily. Era (E. coli Ras-like protein) 96.42
PRK00698 205 tmk thymidylate kinase; Validated 96.41
cd04113 161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 96.41
PRK13531 498 regulatory ATPase RavA; Provisional 96.41
cd04138 162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 96.41
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 96.41
PRK12608 380 transcription termination factor Rho; Provisional 96.41
cd01120 165 RecA-like_NTPases RecA-like NTPases. This family i 96.4
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 96.4
PRK08084 235 DNA replication initiation factor; Provisional 96.4
cd00876 160 Ras Ras family. The Ras family of the Ras superfam 96.39
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 96.39
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 96.39
PRK08356 195 hypothetical protein; Provisional 96.38
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 96.38
TIGR00231 161 small_GTP small GTP-binding protein domain. This m 96.38
COG1136 226 SalX ABC-type antimicrobial peptide transport syst 96.38
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 96.38
cd00154 159 Rab Rab family. Rab GTPases form the largest famil 96.37
TIGR02236 310 recomb_radA DNA repair and recombination protein R 96.37
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 96.37
COG0237 201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 96.37
cd03293 220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 96.36
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 96.36
cd03261 235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 96.36
PLN02200 234 adenylate kinase family protein 96.36
cd03297 214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 96.36
cd03263 220 ABC_subfamily_A The ABCA subfamily mediates the tr 96.36
PRK09825 176 idnK D-gluconate kinase; Provisional 96.35
PRK13695 174 putative NTPase; Provisional 96.35
cd03269 210 ABC_putative_ATPase This subfamily is involved in 96.35
PF08298 358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 96.34
TIGR02673 214 FtsE cell division ATP-binding protein FtsE. This 96.34
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 96.34
cd01393 226 recA_like RecA is a bacterial enzyme which has rol 96.34
cd03256 241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 96.33
PRK05537 568 bifunctional sulfate adenylyltransferase subunit 1 96.32
cd03259 213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 96.32
cd03260 227 ABC_PstB_phosphate_transporter Phosphate uptake is 96.31
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 96.31
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 96.31
PRK11889 436 flhF flagellar biosynthesis regulator FlhF; Provis 96.31
cd01130 186 VirB11-like_ATPase Type IV secretory pathway compo 96.31
PRK14974 336 cell division protein FtsY; Provisional 96.3
TIGR02173 171 cyt_kin_arch cytidylate kinase, putative. Proteins 96.3
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.29
COG1703 323 ArgK Putative periplasmic protein kinase ArgK and 96.29
smart00175 164 RAB Rab subfamily of small GTPases. Rab GTPases ar 96.29
PRK13541 195 cytochrome c biogenesis protein CcmA; Provisional 96.29
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 96.29
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signa 96.29
cd03235 213 ABC_Metallic_Cations ABC component of the metal-ty 96.28
PRK10584 228 putative ABC transporter ATP-binding protein YbbA; 96.28
cd01876 170 YihA_EngB The YihA (EngB) subfamily. This subfamil 96.28
PF00071 162 Ras: Ras family; InterPro: IPR001806 Small GTPases 96.28
cd03226 205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 96.28
PRK10416 318 signal recognition particle-docking protein FtsY; 96.28
cd03292 214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 96.27
PRK06620 214 hypothetical protein; Validated 96.27
TIGR03864 236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 96.27
TIGR02211 221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 96.27
cd03265 220 ABC_DrrA DrrA is the ATP-binding protein component 96.27
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 96.27
cd03296 239 ABC_CysA_sulfate_importer Part of the ABC transpor 96.27
TIGR00041 195 DTMP_kinase thymidylate kinase. Function: phosphor 96.27
cd03264 211 ABC_drug_resistance_like ABC-type multidrug transp 96.26
PRK04301 317 radA DNA repair and recombination protein RadA; Va 96.25
cd03224 222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 96.25
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 96.24
PRK09087 226 hypothetical protein; Validated 96.24
PRK13946 184 shikimate kinase; Provisional 96.23
PRK08099 399 bifunctional DNA-binding transcriptional repressor 96.23
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 96.23
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 96.21
PRK12726 407 flagellar biosynthesis regulator FlhF; Provisional 96.21
cd03257 228 ABC_NikE_OppD_transporters The ABC transporter sub 96.21
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 96.21
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 96.2
PLN03046 460 D-glycerate 3-kinase; Provisional 96.2
TIGR03608 206 L_ocin_972_ABC putative bacteriocin export ABC tra 96.2
cd04160 167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 96.2
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 96.2
cd01878 204 HflX HflX subfamily. A distinct conserved domain w 96.2
cd03258 233 ABC_MetN_methionine_transporter MetN (also known a 96.19
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 96.19
PRK11629 233 lolD lipoprotein transporter ATP-binding subunit; 96.19
PRK13538 204 cytochrome c biogenesis protein CcmA; Provisional 96.19
cd01864 165 Rab19 Rab19 subfamily. Rab19 proteins are associat 96.19
cd04136 163 Rap_like Rap-like subfamily. The Rap subfamily con 96.19
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 96.19
COG4608 268 AppF ABC-type oligopeptide transport system, ATPas 96.19
cd00878 158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 96.18
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 96.18
cd03237 246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 96.18
cd00157 171 Rho Rho (Ras homology) family. Members of the Rho 96.18
cd04123 162 Rab21 Rab21 subfamily. The localization and functi 96.17
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 96.17
PRK15177 213 Vi polysaccharide export ATP-binding protein VexC; 96.17
cd04124 161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 96.17
PRK15453 290 phosphoribulokinase; Provisional 96.17
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 96.17
PRK10247 225 putative ABC transporter ATP-binding protein YbbL; 96.17
PRK13948 182 shikimate kinase; Provisional 96.16
cd01394 218 radB RadB. The archaeal protein radB shares simila 96.16
TIGR01184 230 ntrCD nitrate transport ATP-binding subunits C and 96.15
PRK14721 420 flhF flagellar biosynthesis regulator FlhF; Provis 96.15
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 96.14
cd03219 236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 96.14
TIGR02770 230 nickel_nikD nickel import ATP-binding protein NikD 96.14
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 96.14
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 96.14
cd03114148 ArgK-like The function of this protein family is u 96.13
PRK03731 171 aroL shikimate kinase II; Reviewed 96.13
PRK13233 275 nifH nitrogenase reductase; Reviewed 96.13
TIGR01978 243 sufC FeS assembly ATPase SufC. SufC is part of the 96.13
cd04177 168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 96.13
PRK11124 242 artP arginine transporter ATP-binding subunit; Pro 96.13
PRK13768 253 GTPase; Provisional 96.13
cd03278 197 ABC_SMC_barmotin Barmotin is a tight junction-asso 96.13
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.12
cd03301 213 ABC_MalK_N The N-terminal ATPase domain of the mal 96.12
cd01860 163 Rab5_related Rab5-related subfamily. This subfamil 96.12
cd03218 232 ABC_YhbG The ABC transporters belonging to the Yhb 96.12
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 96.12
COG1121 254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 96.11
smart00178 184 SAR Sar1p-like members of the Ras-family of small 96.11
PRK10908 222 cell division protein FtsE; Provisional 96.1
cd01898 170 Obg Obg subfamily. The Obg nucleotide binding prot 96.09
cd03268 208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 96.09
cd03262 213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 96.09
cd03295 242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 96.09
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 96.09
cd04171 164 SelB SelB subfamily. SelB is an elongation factor 96.08
cd03266 218 ABC_NatA_sodium_exporter NatA is the ATPase compon 96.08
cd04146 165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 96.08
PRK12377248 putative replication protein; Provisional 96.08
smart00072 184 GuKc Guanylate kinase homologues. Active enzymes c 96.08
PRK12724 432 flagellar biosynthesis regulator FlhF; Provisional 96.07
PRK14242 253 phosphate transporter ATP-binding protein; Provisi 96.07
PRK13236 296 nitrogenase reductase; Reviewed 96.07
TIGR02239 316 recomb_RAD51 DNA repair protein RAD51. This eukary 96.06
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 96.06
cd03232 192 ABC_PDR_domain2 The pleiotropic drug resistance-li 96.06
TIGR01189 198 ccmA heme ABC exporter, ATP-binding protein CcmA. 96.06
TIGR00972 247 3a0107s01c2 phosphate ABC transporter, ATP-binding 96.06
cd03246173 ABCC_Protease_Secretion This family represents the 96.05
PRK06851367 hypothetical protein; Provisional 96.05
PRK13540 200 cytochrome c biogenesis protein CcmA; Provisional 96.04
PRK07429 327 phosphoribulokinase; Provisional 96.04
cd03115 173 SRP The signal recognition particle (SRP) mediates 96.04
PRK13231 264 nitrogenase reductase-like protein; Reviewed 96.04
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 96.03
PRK13539 207 cytochrome c biogenesis protein CcmA; Provisional 96.03
cd04140 165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 96.03
TIGR02324 224 CP_lyasePhnL phosphonate C-P lyase system protein 96.03
PRK14247 250 phosphate ABC transporter ATP-binding protein; Pro 96.03
PRK07940 394 DNA polymerase III subunit delta'; Validated 96.02
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 96.02
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 96.02
cd04101 164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 96.02
TIGR00455 184 apsK adenylylsulfate kinase (apsK). Important resi 96.02
TIGR00017 217 cmk cytidylate kinase. This family consists of cyt 96.02
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 96.01
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 96.01
PF00625 183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 96.01
cd03252 237 ABCC_Hemolysin The ABC-transporter hemolysin B is 96.01
cd03233 202 ABC_PDR_domain1 The pleiotropic drug resistance (P 96.0
cd01869 166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 96.0
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 96.0
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 95.99
PRK10865 857 protein disaggregation chaperone; Provisional 95.99
PHA02530 300 pseT polynucleotide kinase; Provisional 95.99
PRK09544 251 znuC high-affinity zinc transporter ATPase; Review 95.99
cd03267 236 ABC_NatA_like Similar in sequence to NatA, this is 95.99
PRK14241 258 phosphate transporter ATP-binding protein; Provisi 95.98
TIGR01277 213 thiQ thiamine ABC transporter, ATP-binding protein 95.98
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 95.98
cd04162 164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 95.98
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.98
PRK14245 250 phosphate ABC transporter ATP-binding protein; Pro 95.97
PRK14274 259 phosphate ABC transporter ATP-binding protein; Pro 95.97
PRK14239 252 phosphate transporter ATP-binding protein; Provisi 95.97
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 95.96
PRK10575 265 iron-hydroxamate transporter ATP-binding subunit; 95.96
PRK14256 252 phosphate ABC transporter ATP-binding protein; Pro 95.96
PRK11264 250 putative amino-acid ABC transporter ATP-binding pr 95.96
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-bin 95.96
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 95.96
cd03215182 ABC_Carb_Monos_II This family represents domain II 95.96
PRK14250 241 phosphate ABC transporter ATP-binding protein; Pro 95.96
PRK14490 369 putative bifunctional molybdopterin-guanine dinucl 95.95
PRK10895 241 lipopolysaccharide ABC transporter ATP-binding pro 95.95
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 95.95
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 95.95
PRK09493 240 glnQ glutamine ABC transporter ATP-binding protein 95.94
cd01897 168 NOG NOG1 is a nucleolar GTP-binding protein presen 95.94
TIGR03410 230 urea_trans_UrtE urea ABC transporter, ATP-binding 95.94
cd04161 167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 95.94
cd03294 269 ABC_Pro_Gly_Bertaine This family comprises the gly 95.93
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.93
PRK12727 559 flagellar biosynthesis regulator FlhF; Provisional 95.93
PRK05642 234 DNA replication initiation factor; Validated 95.93
COG1123 539 ATPase components of various ABC-type transport sy 95.93
cd04115 170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 95.93
KOG3347 176 consensus Predicted nucleotide kinase/nuclear prot 95.93
PTZ00088 229 adenylate kinase 1; Provisional 95.92
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 95.92
TIGR03005 252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 95.91
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provi 95.91
COG3638 258 ABC-type phosphate/phosphonate transport system, A 95.91
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 95.91
PRK10744 260 pstB phosphate transporter ATP-binding protein; Pr 95.91
cd04175 164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 95.91
cd03245 220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 95.91
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provi 95.91
cd03231 201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 95.9
PRK11022 326 dppD dipeptide transporter ATP-binding subunit; Pr 95.9
TIGR01420 343 pilT_fam pilus retraction protein PilT. This model 95.9
PRK11831 269 putative ABC transporter ATP-binding protein YrbF; 95.89
PRK15056 272 manganese/iron transporter ATP-binding protein; Pr 95.89
cd03298 211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 95.89
cd03251 234 ABCC_MsbA MsbA is an essential ABC transporter, cl 95.89
PRK10619 257 histidine/lysine/arginine/ornithine transporter su 95.89
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 95.89
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 95.88
cd03234 226 ABCG_White The White subfamily represents ABC tran 95.88
PRK08533 230 flagellar accessory protein FlaH; Reviewed 95.88
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 95.88
PRK00089 292 era GTPase Era; Reviewed 95.87
cd03253 236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 95.87
PRK14262 250 phosphate ABC transporter ATP-binding protein; Pro 95.87
PRK11701 258 phnK phosphonate C-P lyase system protein PhnK; Pr 95.86
PRK14267 253 phosphate ABC transporter ATP-binding protein; Pro 95.86
cd03290 218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 95.86
cd03249 238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 95.86
COG0410 237 LivF ABC-type branched-chain amino acid transport 95.86
cd01870 175 RhoA_like RhoA-like subfamily. The RhoA subfamily 95.85
PRK14238 271 phosphate transporter ATP-binding protein; Provisi 95.85
cd03220 224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 95.85
PRK14273 254 phosphate ABC transporter ATP-binding protein; Pro 95.85
cd04153 174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 95.85
PRK05416 288 glmZ(sRNA)-inactivating NTPase; Provisional 95.85
cd04135 174 Tc10 TC10 subfamily. TC10 is a Rho family protein 95.85
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 95.85
PRK14531 183 adenylate kinase; Provisional 95.84
PRK14235 267 phosphate transporter ATP-binding protein; Provisi 95.84
cd04127 180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 95.83
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 95.83
COG3899 849 Predicted ATPase [General function prediction only 95.83
PLN02165 334 adenylate isopentenyltransferase 95.82
cd01868 165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 95.82
cd01866 168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 95.82
cd00877 166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 95.82
PRK14243 264 phosphate transporter ATP-binding protein; Provisi 95.81
PRK13640 282 cbiO cobalt transporter ATP-binding subunit; Provi 95.81
COG4619 223 ABC-type uncharacterized transport system, ATPase 95.81
PRK12338 319 hypothetical protein; Provisional 95.81
PRK13632 271 cbiO cobalt transporter ATP-binding subunit; Provi 95.81
CHL00131 252 ycf16 sulfate ABC transporter protein; Validated 95.81
cd04156 160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 95.81
PRK14237 267 phosphate transporter ATP-binding protein; Provisi 95.81
cd01129 264 PulE-GspE PulE/GspE The type II secretory pathway 95.8
PRK13543 214 cytochrome c biogenesis protein CcmA; Provisional 95.8
cd04106 162 Rab23_lke Rab23-like subfamily. Rab23 is a member 95.8
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 95.8
cd03283 199 ABC_MutS-like MutS-like homolog in eukaryotes. The 95.8
PRK09112 351 DNA polymerase III subunit delta'; Validated 95.8
PRK00454 196 engB GTP-binding protein YsxC; Reviewed 95.79
PRK14248 268 phosphate ABC transporter ATP-binding protein; Pro 95.79
cd03273 251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 95.79
cd04122 166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 95.79
TIGR03873 256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 95.79
COG0468 279 RecA RecA/RadA recombinase [DNA replication, recom 95.79
PRK13548 258 hmuV hemin importer ATP-binding subunit; Provision 95.79
cd03236 255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 95.79
PF00009 188 GTP_EFTU: Elongation factor Tu GTP binding domain; 95.79
PRK10418 254 nikD nickel transporter ATP-binding protein NikD; 95.78
COG0003 322 ArsA Predicted ATPase involved in chromosome parti 95.78
PRK11231 255 fecE iron-dicitrate transporter ATP-binding subuni 95.78
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 95.78
cd03244 221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 95.78
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 95.78
PF13604 196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 95.78
PRK14240 250 phosphate transporter ATP-binding protein; Provisi 95.78
cd04145 164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 95.77
PRK14265 274 phosphate ABC transporter ATP-binding protein; Pro 95.77
COG4107 258 PhnK ABC-type phosphonate transport system, ATPase 95.77
PRK14261 253 phosphate ABC transporter ATP-binding protein; Pro 95.77
PRK13547 272 hmuV hemin importer ATP-binding subunit; Provision 95.76
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 95.76
PRK15093 330 antimicrobial peptide ABC transporter ATP-binding 95.76
cd01861 161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 95.75
PRK14269 246 phosphate ABC transporter ATP-binding protein; Pro 95.75
PRK09580 248 sufC cysteine desulfurase ATPase component; Review 95.75
PRK10867 433 signal recognition particle protein; Provisional 95.75
TIGR03598 179 GTPase_YsxC ribosome biogenesis GTP-binding protei 95.74
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 95.74
PRK09183259 transposase/IS protein; Provisional 95.74
PRK13650 279 cbiO cobalt transporter ATP-binding subunit; Provi 95.74
PRK10771 232 thiQ thiamine transporter ATP-binding subunit; Pro 95.74
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 95.74
TIGR03771 223 anch_rpt_ABC anchored repeat-type ABC transporter, 95.74
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 95.74
cd03274 212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 95.73
PRK14260 259 phosphate ABC transporter ATP-binding protein; Pro 95.73
cd03254 229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 95.73
PRK12723 388 flagellar biosynthesis regulator FlhF; Provisional 95.73
cd03248 226 ABCC_TAP TAP, the Transporter Associated with Anti 95.73
cd04114 169 Rab30 Rab30 subfamily. Rab30 appears to be associa 95.72
PRK14255 252 phosphate ABC transporter ATP-binding protein; Pro 95.72
PRK13185 270 chlL protochlorophyllide reductase iron-sulfur ATP 95.72
PRK14270 251 phosphate ABC transporter ATP-binding protein; Pro 95.72
PTZ00035 337 Rad51 protein; Provisional 95.72
cd01865 165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 95.71
PF05621 302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.71
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 95.71
CHL00176 638 ftsH cell division protein; Validated 95.71
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.95  E-value=1.6e-26  Score=218.73  Aligned_cols=219  Identities=18%  Similarity=0.252  Sum_probs=175.5

Q ss_pred             CcchHHHHHHHHHHHHhhccccCchhHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhhccCCCCccchHHHHHHHHHHHH
Q 042580            1 MDINFRLFSERLRRLIEGEEGTLPDATKEQFQNLYTEIEIVTSLLSNYENDMFQILFQSLGGEEEFVFSEVQGILKEMKD   80 (241)
Q Consensus         1 ~~avv~~~~~kl~~~l~~~~~~~~~~~~~~~~~L~~~l~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~v~~Wl~~vr~   80 (241)
                      |+++++..++++.+++..+ +..+.+.+..+..|++.|..|+++++++++.  ..       ..    ..+..|...+++
T Consensus         1 ~~~~~s~~~~~~~~~l~~~-~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~--~~-------~~----~~~~~~~e~~~~   66 (889)
T KOG4658|consen    1 MGACVSFGVEKLDQLLNRE-SECLDGKDNYILELKENLKALQSALEDLDAK--RD-------DL----ERRVNWEEDVGD   66 (889)
T ss_pred             CCeEEEEehhhHHHHHHHH-HHHHhchHHHHHHHHHHHHHHHHHHHHHHhh--cc-------hH----HHHHHHHHHHHH
Confidence            7888899999999999999 9999999999999999999999999999998  66       66    899999999999


Q ss_pred             HHHhhHHHHHHHHHHHhhhcCC-----C----------CCchHHHHHHHHHHHHHHHHHHHhhccccccCCCCccccccc
Q 042580           81 FVHESEKVIYTFMISRITQQIS-----G----------SSSKDLFDALLGLQSQIIDIKQQLQQFRPNNIGLWVELKSYF  145 (241)
Q Consensus        81 ~~~~~ed~ld~~~~~~~~~~~~-----~----------~~~~~~~~~i~~l~~~i~~i~~~~~~~~~~~~~~~~~~~~~~  145 (241)
                      +.|+++|+++.|..+.......     .          .+|+.....+..+.+++..+.+....+...............
T Consensus        67 ~~~~~e~~~~~~~v~~~~~~~~~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~  146 (889)
T KOG4658|consen   67 LVYLAEDIIWLFLVEEIERKANDLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDP  146 (889)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhHHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccccccc
Confidence            9999999999997766543110     0          122666666666677777666666666543311111110112


Q ss_pred             cccCCCCCccCcccCCcccchHHHHHHHHHHhcCCCCeEEEEEEcCCCccHHHHHHHHHhccc-cccCCCeeEEEe--CC
Q 042580          146 TEARNSSSTLGFKKRNIMGLEDEIEELLDLLIVGEPSLFIVAIVGNSGFDKTNFAGEAYNNNY-AKNYFDCRAWVG--CE  222 (241)
Q Consensus       146 ~~~~~~~~~~~~~~~~~vG~~~~~~~l~~~L~~~~~~~~vI~IvG~gGvGKTTLak~v~~~~~-v~~~F~~~~wV~--~~  222 (241)
                      ...+.+.+.  .++.. ||.++.++++++.|.+++.  .++||+||||+||||||++|||+.. ++++||.+|||+  ++
T Consensus       147 ~~~~e~~~~--~~~~~-VG~e~~~~kl~~~L~~d~~--~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~  221 (889)
T KOG4658|consen  147 REKVETRPI--QSESD-VGLETMLEKLWNRLMEDDV--GIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKE  221 (889)
T ss_pred             hhhcccCCC--Ccccc-ccHHHHHHHHHHHhccCCC--CEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEccc
Confidence            233444554  44555 9999999999999998774  9999999999999999999999988 999999999999  99


Q ss_pred             CCHHHHHHHHHHHhCC
Q 042580          223 YYLHKVLDSIIKSVMP  238 (241)
Q Consensus       223 ~~~~~il~~Il~~l~~  238 (241)
                      |+..+|+++|++.++.
T Consensus       222 f~~~~iq~~Il~~l~~  237 (889)
T KOG4658|consen  222 FTTRKIQQTILERLGL  237 (889)
T ss_pred             ccHHhHHHHHHHHhcc
Confidence            9999999999998875



>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query241
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 6e-06
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 54.9 bits (131), Expect = 6e-09
 Identities = 36/187 (19%), Positives = 68/187 (36%), Gaps = 40/187 (21%)

Query: 62  GEEEFVFSEVQGILKE--MKDF----VHESEKVIYTFMISRITQQISGSSSKD-----LF 110
           GE ++ + ++  + ++  + +F    V +  K I +         I  S         LF
Sbjct: 12  GEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILS---KEEIDHIIMSKDAVSGTLRLF 68

Query: 111 DALLGLQSQIIDIKQQLQQF-----RPNNIGLWVELKS----------YFTEARNSSSTL 155
             LL  Q +++      Q+F     R N   L   +K+           + E R+     
Sbjct: 69  WTLLSKQEEMV------QKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYND 122

Query: 156 G--FKKRNIMGLEDEIEELLDLLIVGEPSLFIVAIVGNSGFDKTNFAGEAYNNNYAKNYF 213
              F K N+  L+    +L   L+   P+  ++ I G  G  KT  A +   +   +   
Sbjct: 123 NQVFAKYNVSRLQ-PYLKLRQALLELRPAKNVL-IDGVLGSGKTWVALDVCLSYKVQCKM 180

Query: 214 DCRA-WV 219
           D +  W+
Sbjct: 181 DFKIFWL 187


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query241
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 99.73
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.61
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.31
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.31
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 99.2
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 98.47
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.36
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 98.33
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 98.31
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 98.25
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 98.25
2fna_A 357 Conserved hypothetical protein; structural genomic 98.21
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.11
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.01
2chg_A 226 Replication factor C small subunit; DNA-binding pr 97.96
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 97.95
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 97.88
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.69
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 97.62
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.61
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.53
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.5
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 97.45
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.45
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 97.45
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 97.44
1rz3_A 201 Hypothetical protein rbstp0775; MCSG, structural g 97.42
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.38
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.37
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.37
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 97.36
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.36
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 97.36
3co5_A143 Putative two-component system transcriptional RES 97.36
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 97.35
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 97.35
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 97.34
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.33
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 97.32
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 97.31
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.29
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 97.28
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.28
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 97.28
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 97.27
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.27
3bos_A 242 Putative DNA replication factor; P-loop containing 97.27
3pvs_A 447 Replication-associated recombination protein A; ma 97.25
2chq_A 319 Replication factor C small subunit; DNA-binding pr 97.24
1zp6_A 191 Hypothetical protein ATU3015; alpha-beta protein., 97.21
1kgd_A 180 CASK, peripheral plasma membrane CASK; maguk, guan 97.2
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.17
1ly1_A 181 Polynucleotide kinase; PNK, phosphatase, transfera 97.13
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 97.13
3kb2_A 173 SPBC2 prophage-derived uncharacterized protein YOR 97.13
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 97.12
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 97.1
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 97.1
4gp7_A 171 Metallophosphoesterase; polynucleotide kinase phos 97.09
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.08
1kag_A 173 SKI, shikimate kinase I; transferase, structural g 97.08
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 97.07
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.06
3vaa_A 199 Shikimate kinase, SK; structural genomics, center 97.06
1qhx_A 178 CPT, protein (chloramphenicol phosphotransferase); 97.06
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.06
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.05
3uie_A 200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.03
2bdt_A 189 BH3686; alpha-beta protein, structural genomics, P 97.03
1knq_A 175 Gluconate kinase; ALFA/beta structure, transferase 97.02
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 97.02
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 97.02
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.01
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 97.01
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 97.01
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 97.01
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 97.0
4eun_A 200 Thermoresistant glucokinase; putative sugar kinase 96.99
2rhm_A 193 Putative kinase; P-loop containing nucleoside trip 96.98
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 96.98
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 96.97
1kht_A 192 Adenylate kinase; phosphotransferase, signaling pr 96.96
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 96.95
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.94
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 96.94
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 96.94
1lvg_A 198 Guanylate kinase, GMP kinase; transferase; HET: AD 96.94
2hf9_A 226 Probable hydrogenase nickel incorporation protein 96.93
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 96.93
2wsm_A 221 Hydrogenase expression/formation protein (HYPB); m 96.93
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 96.91
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 96.91
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.9
3trf_A 185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.9
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 96.9
1uf9_A 203 TT1252 protein; P-loop, nucleotide binding domain, 96.89
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.89
1tev_A 196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.88
1ukz_A 203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.88
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 96.88
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 96.87
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.87
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 96.85
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.85
2r44_A 331 Uncharacterized protein; putative ATPase, structur 96.84
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 96.83
2yvu_A 186 Probable adenylyl-sulfate kinase; transferase, str 96.83
1zuh_A 168 Shikimate kinase; alpha-beta protein, transferase; 96.83
3iij_A 180 Coilin-interacting nuclear ATPase protein; alpha a 96.82
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 96.82
1jjv_A 206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.82
2c95_A 196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.82
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.81
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 96.8
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 96.79
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 96.79
1qf9_A 194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.79
3fwy_A 314 Light-independent protochlorophyllide reductase I 96.79
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 96.78
1xjc_A 169 MOBB protein homolog; structural genomics, midwest 96.77
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 96.77
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.77
3cm0_A 186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.77
1via_A 175 Shikimate kinase; structural genomics, transferase 96.76
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 96.76
3ney_A 197 55 kDa erythrocyte membrane protein; structural ge 96.76
2bwj_A 199 Adenylate kinase 5; phosphoryl transfer reaction, 96.75
1y63_A 184 LMAJ004144AAA protein; structural genomics, protei 96.74
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 96.73
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 96.73
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.72
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 96.71
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 96.71
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 96.7
2pt5_A 168 Shikimate kinase, SK; aromatic amino acid biosynth 96.7
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 96.7
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 96.69
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.69
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 96.67
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 96.67
2cdn_A 201 Adenylate kinase; phosphoryl transfer, associative 96.67
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 96.66
2iyv_A 184 Shikimate kinase, SK; transferase, aromatic amino 96.66
4a74_A 231 DNA repair and recombination protein RADA; hydrola 96.65
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 96.65
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 96.64
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 96.64
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 96.64
1e6c_A 173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.64
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.63
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 96.63
2f1r_A 171 Molybdopterin-guanine dinucleotide biosynthesis pr 96.62
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 96.6
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 96.6
2cvh_A 220 DNA repair and recombination protein RADB; filamen 96.59
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.59
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 96.59
2pez_A 179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.58
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 96.58
2vli_A 183 Antibiotic resistance protein; transferase, tunica 96.58
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 96.57
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 96.57
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 96.57
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 96.57
1np6_A 174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.57
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 96.56
1b0u_A 262 Histidine permease; ABC transporter, transport pro 96.56
3b85_A 208 Phosphate starvation-inducible protein; PHOH2, ATP 96.55
2v54_A 204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.55
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 96.55
2grj_A 192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.54
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 96.53
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.53
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 96.53
1ji0_A 240 ABC transporter; ATP binding protein, structural g 96.53
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 96.53
1g6h_A 257 High-affinity branched-chain amino acid transport 96.52
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 96.52
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 96.5
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 96.5
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 96.5
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 96.5
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 96.48
2og2_A 359 Putative signal recognition particle receptor; nuc 96.48
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 96.48
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.47
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 96.47
1sgw_A 214 Putative ABC transporter; structural genomics, P p 96.47
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 96.46
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 96.45
1oix_A 191 RAS-related protein RAB-11A; small G protein, intr 96.45
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 96.45
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.43
2ghi_A 260 Transport protein; multidrug resistance protein, M 96.42
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 96.42
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.41
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 96.4
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 96.4
2eyu_A 261 Twitching motility protein PILT; pilus retraction 96.39
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 96.39
3ake_A 208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.38
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 96.38
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 96.37
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 96.34
2f9l_A 199 RAB11B, member RAS oncogene family; RAB11B GTPase, 96.34
2wji_A 165 Ferrous iron transport protein B homolog; membrane 96.34
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.33
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 96.33
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.32
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.3
1fzq_A 181 ADP-ribosylation factor-like protein 3; protein-GD 96.29
2xxa_A 433 Signal recognition particle protein; protein trans 96.29
2ce2_X 166 GTPase HRAS; signaling protein, guanine nucleotide 96.27
2wjg_A 188 FEOB, ferrous iron transport protein B homolog; me 96.27
4eaq_A 229 DTMP kinase, thymidylate kinase; structural genomi 96.27
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.26
2dyk_A 161 GTP-binding protein; GTPase, ribosome-binding prot 96.26
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 96.26
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 96.26
2zej_A 184 Dardarin, leucine-rich repeat kinase 2; parkinson' 96.24
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 96.24
1z2a_A 168 RAS-related protein RAB-23; RAB GTPase, vesicular 96.24
2ged_A193 SR-beta, signal recognition particle receptor beta 96.23
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 96.23
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 96.23
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 96.22
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 96.19
1j8m_F 297 SRP54, signal recognition 54 kDa protein; signalin 96.18
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 96.18
1u8z_A 168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 96.17
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 96.17
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 96.17
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.17
1c1y_A 167 RAS-related protein RAP-1A; GTP-binding proteins, 96.17
1z08_A 170 RAS-related protein RAB-21; RAB GTPase, vesicular 96.17
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.17
2qgz_A308 Helicase loader, putative primosome component; str 96.16
2nzj_A 175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 96.15
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 96.15
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 96.15
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 96.14
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.14
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 96.13
3con_A 190 GTPase NRAS; structural genomics consortium, SGC, 96.13
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 96.12
2lkc_A 178 Translation initiation factor IF-2; NMR {Geobacill 96.12
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 96.12
3t1o_A 198 Gliding protein MGLA; G domain containing protein, 96.11
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 96.11
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 96.08
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 96.08
1kao_A 167 RAP2A; GTP-binding protein, small G protein, GDP, 96.08
2erx_A 172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 96.07
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 96.07
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 96.07
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 96.06
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.05
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 96.05
2gj8_A 172 MNME, tRNA modification GTPase TRME; G-domain dime 96.04
1ek0_A 170 Protein (GTP-binding protein YPT51); vesicular tra 96.04
1z0j_A 170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 96.04
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 96.03
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 96.03
3kkq_A 183 RAS-related protein M-RAS; GTP-binding, GTPase, si 96.02
4dsu_A 189 GTPase KRAS, isoform 2B; small G-protein, signalin 96.02
1m7b_A 184 RND3/RHOE small GTP-binding protein; small GTPase, 96.01
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 96.01
1ls1_A 295 Signal recognition particle protein; FFH, SRP54, S 96.01
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 96.0
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.0
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 95.99
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 95.99
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 95.98
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 95.97
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 95.97
3q85_A 169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 95.96
1wms_A 177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 95.96
3q72_A 166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 95.95
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 95.95
1z0f_A 179 RAB14, member RAS oncogene family; RAB GTPase, ves 95.95
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 95.94
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 95.94
2fn4_A 181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 95.94
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 95.93
3t5g_A 181 GTP-binding protein RHEB; immunoglobulin-like beta 95.93
3kta_A182 Chromosome segregation protein SMC; structural mai 95.93
1g16_A 170 RAS-related protein SEC4; G protein RAB, signaling 95.93
2hxs_A 178 RAB-26, RAS-related protein RAB-28; GTPase, signal 95.92
3end_A 307 Light-independent protochlorophyllide reductase ir 95.92
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 95.91
2a9k_A 187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 95.91
1r2q_A 170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 95.91
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 95.9
1ky3_A 182 GTP-binding protein YPT7P; vesicular traffic, GTP 95.9
3tw8_B 181 RAS-related protein RAB-35; longin domain, RAB GTP 95.89
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 95.89
3ihw_A 184 Centg3; RAS, centaurin, GTPase, structural genomic 95.89
1zj6_A 187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 95.89
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 95.89
3c5c_A 187 RAS-like protein 12; GDP, GTPase, structural genom 95.88
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 95.88
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 95.88
1r8s_A 164 ADP-ribosylation factor 1; protein transport/excha 95.88
1p9r_A 418 General secretion pathway protein E; bacterial typ 95.88
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.88
1mh1_A 186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 95.87
1svi_A 195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 95.86
2bme_A 186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 95.86
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 95.85
2z43_A 324 DNA repair and recombination protein RADA; archaea 95.85
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 95.85
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 95.83
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 95.83
3pqc_A 195 Probable GTP-binding protein ENGB; rossmann fold, 95.83
3llu_A 196 RAS-related GTP-binding protein C; structural geno 95.82
2oil_A 193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 95.82
1nrj_B 218 SR-beta, signal recognition particle receptor beta 95.82
2bov_A 206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 95.81
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 95.81
1m2o_B 190 GTP-binding protein SAR1, GTP binding protein; zin 95.81
2efe_B 181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 95.81
2y8e_A 179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 95.79
3bc1_A 195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 95.79
1pui_A 210 ENGB, probable GTP-binding protein ENGB; structura 95.79
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 95.79
2fg5_A 192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 95.77
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.77
3bwd_D 182 RAC-like GTP-binding protein ARAC6; G domain, cyto 95.77
2atv_A 196 RERG, RAS-like estrogen-regulated growth inhibitor 95.76
2ewv_A 372 Twitching motility protein PILT; pilus retraction 95.76
1upt_A 171 ARL1, ADP-ribosylation factor-like protein 1; hydr 95.75
3clv_A 208 RAB5 protein, putative; malaria, GTPase, structura 95.74
3tkl_A 196 RAS-related protein RAB-1A; vesicle trafficking, p 95.74
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 95.74
2fh5_B 214 SR-beta, signal recognition particle receptor beta 95.74
1f6b_A 198 SAR1; gtpases, N-terminal helix, Mg-containing com 95.73
2iwr_A 178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 95.73
2g6b_A 180 RAS-related protein RAB-26; G-protein, GTP analogu 95.71
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 95.69
3oes_A 201 GTPase rhebl1; small GTPase, structural genomics, 95.68
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 95.67
1gwn_A 205 RHO-related GTP-binding protein RHOE; GTPase, inac 95.67
1moz_A 183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 95.67
1zbd_A 203 Rabphilin-3A; G protein, effector, RABCDR, synapti 95.67
1zd9_A 188 ADP-ribosylation factor-like 10B; transport protei 95.67
1vg8_A 207 RAS-related protein RAB-7; GTP-binding protein, pr 95.66
4gzl_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 95.66
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 95.66
1tue_A212 Replication protein E1; helicase, replication, E1E 95.65
2gf9_A 189 RAS-related protein RAB-3D; G-protein, structural 95.64
3cbq_A 195 GTP-binding protein REM 2; FLJ38964A, structural g 95.64
3reg_A 194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 95.64
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 95.62
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.62
3dz8_A 191 RAS-related protein RAB-3B; GDP, GTPase, structura 95.62
2ew1_A 201 RAS-related protein RAB-30; G-protein, GTP analogu 95.61
2a5j_A 191 RAS-related protein RAB-2B; GTPase, signal transdu 95.6
1z06_A 189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 95.6
1ksh_A 186 ARF-like protein 2; small GTPase, small GTP-bindin 95.6
2o52_A 200 RAS-related protein RAB-4B; G-protein, GDP, struct 95.59
1x3s_A 195 RAS-related protein RAB-18; GTPase, GNP, structura 95.59
2q3h_A 201 RAS homolog gene family, member U; GTPase, structu 95.59
2gf0_A 199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 95.58
2p5s_A 199 RAS and EF-hand domain containing; G-protein, RAB, 95.56
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 95.54
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 95.53
2atx_A 194 Small GTP binding protein TC10; GTPase, P-loop, al 95.52
2qu8_A 228 Putative nucleolar GTP-binding protein 1; GTPase, 95.52
4edh_A 213 DTMP kinase, thymidylate kinase; structural genomi 95.52
2j1l_A 214 RHO-related GTP-binding protein RHOD; GTPase, memb 95.5
2fv8_A 207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 95.48
3v9p_A 227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 95.48
3lv8_A 236 DTMP kinase, thymidylate kinase; structural genomi 95.48
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 95.47
2bcg_Y 206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 95.47
2b6h_A 192 ADP-ribosylation factor 5; membrane trafficking, G 95.47
4bas_A 199 ADP-ribosylation factor, putative (small GTPase, p 95.46
4tmk_A 213 Protein (thymidylate kinase); ATP:DTMP phosphotran 95.46
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 95.46
2afh_E 289 Nitrogenase iron protein 1; nitrogen fixation, iro 95.45
2il1_A 192 RAB12; G-protein, GDP, GTPase, predicted, structur 95.45
2h17_A 181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 95.43
2h92_A 219 Cytidylate kinase; rossmann fold, transferase; HET 95.42
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 95.41
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 95.41
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 95.41
2cjw_A 192 GTP-binding protein GEM; nucleotide-binding, small 95.41
2hup_A 201 RAS-related protein RAB-43; G-protein, GDP, struct 95.4
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 95.4
3q3j_B 214 RHO-related GTP-binding protein RHO6; RAS-binding 95.4
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 95.4
3cph_A 213 RAS-related protein SEC4; RAB GTPase, prenylation, 95.39
2gco_A 201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 95.39
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 95.38
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 95.37
2x77_A 189 ADP-ribosylation factor; GTP-binding protein, smal 95.37
2j0v_A 212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 95.36
2f7s_A 217 C25KG, RAS-related protein RAB-27B; G-protein, str 95.36
2h57_A 190 ADP-ribosylation factor-like protein 6; GTP, GTPas 95.35
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 95.34
2pt7_A 330 CAG-ALFA; ATPase, protein-protein complex, type IV 95.34
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 95.33
2fu5_C 183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 95.31
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 95.29
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 95.27
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 95.23
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 95.23
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 95.23
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 95.23
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 95.21
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 95.2
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 95.18
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 95.17
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 95.14
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 95.13
1u0j_A 267 DNA replication protein; AAA+ protein, P-loop atpa 95.12
3t5d_A 274 Septin-7; GTP-binding protein, cytoskeleton, signa 95.12
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 95.1
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 95.09
3ld9_A 223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 95.09
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 95.08
3ch4_B 202 Pmkase, phosphomevalonate kinase; parallel beta-sh 95.06
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 95.06
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 95.06
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 95.05
2g3y_A 211 GTP-binding protein GEM; small GTPase, GDP, inacti 95.04
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 95.04
4dhe_A 223 Probable GTP-binding protein ENGB; melioidosis, RA 95.03
3cpj_B 223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 95.02
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 94.98
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 94.97
3io5_A 333 Recombination and repair protein; storage dimer, i 94.95
3ea0_A 245 ATPase, para family; alpha-beta-alpha sandwich, st 94.93
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 94.93
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 94.91
4hlc_A 205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 94.9
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 94.89
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 94.88
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 94.87
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 94.87
2qtf_A 364 Protein HFLX, GTP-binding protein; beta-alpha-barr 94.85
1u94_A 356 RECA protein, recombinase A; homologous recombinat 94.84
2qmh_A 205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 94.83
2r6a_A 454 DNAB helicase, replicative helicase; replication, 94.81
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 94.8
4dkx_A 216 RAS-related protein RAB-6A; GTP binding fold, memb 94.8
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 94.79
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 94.79
3k9g_A 267 PF-32 protein; ssgcid, SBRI, decode biostructures, 94.78
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 94.77
2yc2_C 208 IFT27, small RAB-related GTPase; transport protein 94.68
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 94.68
3fdi_A 201 Uncharacterized protein; cytidylate kinase like pr 94.64
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 94.6
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 94.57
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 94.55
3q9l_A 260 Septum site-determining protein MIND; ATPase, bact 94.48
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.48
3tmk_A 216 Thymidylate kinase; phosphotransferase; HET: T5A; 94.47
2e87_A 357 Hypothetical protein PH1320; GTP-binding, GTPase, 94.47
2orw_A 184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 94.47
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosph 94.44
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 94.43
4djt_A 218 GTP-binding nuclear protein GSP1; structural genom 94.43
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 94.42
3fkq_A 373 NTRC-like two-domain protein; RER070207001320, str 94.42
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 94.41
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 94.4
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 94.39
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 94.38
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 94.38
3th5_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 93.4
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 94.36
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 94.34
2r8r_A 228 Sensor protein; KDPD, PFAM02702, MCSG, structural 94.33
2gks_A 546 Bifunctional SAT/APS kinase; transferase, sulfuryl 94.33
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 94.3
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 94.29
3ez2_A 398 Plasmid partition protein A; type IA, DNA binding, 94.29
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 94.21
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 94.18
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 94.17
3gj0_A 221 GTP-binding nuclear protein RAN; G protein, GDP, a 94.16
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 94.08
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.08
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 94.06
1g3q_A 237 MIND ATPase, cell division inhibitor; alpha-beta-a 94.04
2o5v_A 359 DNA replication and repair protein RECF; ABC ATPas 94.03
1xp8_A 366 RECA protein, recombinase A; recombination, radior 94.0
3qks_A 203 DNA double-strand break repair RAD50 ATPase; RECA- 93.96
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 93.91
1qhl_A 227 Protein (cell division protein MUKB); SMC, chromos 93.82
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 93.82
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 93.81
2ph1_A 262 Nucleotide-binding protein; alpha-beta protein, st 93.79
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 93.79
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 93.77
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 93.76
2xj4_A 286 MIPZ; replication, cell division, ATPase, WACA; 1. 93.76
3hdt_A 223 Putative kinase; structura genomics, PSI-2, protei 93.73
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
Probab=99.73  E-value=3.9e-17  Score=118.33  Aligned_cols=85  Identities=16%  Similarity=0.152  Sum_probs=77.2

Q ss_pred             chHHHHHHHHHHHHhhccccCchhHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhhccCCCCccchHHHHHHHHHHHHHH
Q 042580            3 INFRLFSERLRRLIEGEEGTLPDATKEQFQNLYTEIEIVTSLLSNYENDMFQILFQSLGGEEEFVFSEVQGILKEMKDFV   82 (241)
Q Consensus         3 avv~~~~~kl~~~l~~~~~~~~~~~~~~~~~L~~~l~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~v~~Wl~~vr~~~   82 (241)
                      |+++++++||.+++.+| +.++.+++++++.|+++|+.|++||.+++.+..+.       .+    +.++.|+.+||+++
T Consensus         1 a~v~~ll~KL~~ll~~E-~~l~~gv~~~i~~Lk~eL~~m~a~L~da~~~~~~~-------~d----~~vk~W~~~vrdla   68 (115)
T 3qfl_A            1 AAISNLIPKLGELLTEE-FKLHKGVKKNIEDLGKELESMNAALIKIGEVPREQ-------LD----SQDKLWADEVRELS   68 (115)
T ss_dssp             CTTCSHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCGGG-------CC----HHHHHHHHHHHHHH
T ss_pred             CcHHHHHHHHHHHHHHH-HHHHhchHHHHHHHHHHHHHHHHHHHHHHHhcccc-------CC----HHHHHHHHHHHHHH
Confidence            67889999999999999 99999999999999999999999999998762133       67    89999999999999


Q ss_pred             HhhHHHHHHHHHHHhhh
Q 042580           83 HESEKVIYTFMISRITQ   99 (241)
Q Consensus        83 ~~~ed~ld~~~~~~~~~   99 (241)
                      ||+||+||+|.++....
T Consensus        69 YD~ED~iD~f~~~~~~~   85 (115)
T 3qfl_A           69 YVIEDVVDKFLVQVDGI   85 (115)
T ss_dssp             HHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHhccc
Confidence            99999999999987653



>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 241
d2a5yb3 277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 1e-06
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 46.0 bits (108), Expect = 1e-06
 Identities = 12/85 (14%), Positives = 29/85 (34%), Gaps = 5/85 (5%)

Query: 158 KKRNIMGLEDEIEELLDLLI-VGEPSLFIVAIVGNSGFDKTNFAGEAYNNN--YAKNYFD 214
           K+      E  ++ ++  L  + +   F + + G +G  K+  A +A + +       +D
Sbjct: 18  KQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYD 77

Query: 215 CRAWV--GCEYYLHKVLDSIIKSVM 237
              W+                  +M
Sbjct: 78  SIVWLKDSGTAPKSTFDLFTDILLM 102


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query241
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.65
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.54
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.25
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 98.07
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.06
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 97.95
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 97.92
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 97.91
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.91
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 97.9
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.89
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 97.88
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 97.85
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 97.84
d1rz3a_ 198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.82
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 97.78
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 97.75
d1np6a_ 170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.74
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.69
d2bdta1 176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.62
d1kaga_ 169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.59
d1m8pa3 183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.57
d1rkba_ 173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.5
d1x6va3 195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.48
d1xjca_ 165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.46
d1qf9a_ 194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.44
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.44
d1y63a_ 174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.41
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 97.41
d1knqa_ 171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.37
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.37
d1qhxa_ 178 Chloramphenicol phosphotransferase {Streptomyces v 97.35
d1zp6a1 176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.34
d1viaa_ 161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.31
d2iyva1 165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.29
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 97.28
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 97.27
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 97.25
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.25
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.24
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 97.23
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 97.18
d1uf9a_ 191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 97.11
d1e6ca_ 170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.09
d2vp4a1 197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 97.08
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 97.05
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.99
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 96.98
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 96.97
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 96.93
d1znwa1 182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.88
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.86
d1ak2a1 190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.84
d1ls1a2 207 GTPase domain of the signal sequence recognition p 96.78
d1zaka1 189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.78
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 96.77
d1m7ga_ 208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.76
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.75
d2ak3a1 189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.75
d1okkd2 207 GTPase domain of the signal recognition particle r 96.71
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 96.71
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.71
d1sgwa_ 200 Putative ABC transporter PF0895 {Pyrococcus furios 96.69
d1upta_ 169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.68
d1g2912 240 Maltose transport protein MalK, N-terminal domain 96.67
d2awna2 232 Maltose transport protein MalK, N-terminal domain 96.67
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.66
d2qy9a2 211 GTPase domain of the signal recognition particle r 96.66
d1kgda_ 178 Guanylate kinase-like domain of Cask {Human (Homo 96.65
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.64
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.61
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 96.6
d1vmaa2 213 GTPase domain of the signal recognition particle r 96.6
d1r8sa_ 160 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.59
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 96.59
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 96.58
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 96.58
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 96.58
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 96.56
d1j8yf2 211 GTPase domain of the signal sequence recognition p 96.55
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 96.55
d1f6ba_ 186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 96.54
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 96.54
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 96.53
d1svia_ 195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.53
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 96.52
d1moza_ 182 ADP-ribosylation factor {Baker's yeast (Saccharomy 96.52
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 96.51
d1akya1 180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.51
d1nn5a_ 209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 96.47
d1s96a_ 205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.46
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.46
d1z2aa1 164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 96.45
d1wf3a1 178 GTPase Era, N-terminal domain {Thermus thermophilu 96.44
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 96.43
d1egaa1 179 GTPase Era, N-terminal domain {Escherichia coli [T 96.41
d1fzqa_ 176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.4
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 96.39
d1z06a1 165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 96.39
d1z0ja1 167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 96.34
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 96.32
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.32
d2erxa1 171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.32
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 96.31
d1ksha_ 165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.31
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 96.31
d1zj6a1 177 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.29
d2ew1a1 171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 96.25
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 96.24
d1ky3a_ 175 Rab-related protein ypt7p {Baker's yeast (Saccharo 96.24
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 96.24
d1vhta_ 208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 96.23
d2a5ja1 173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 96.21
d1yzqa1 164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 96.19
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.19
d1mkya1 171 Probable GTPase Der, N-terminal and middle domains 96.19
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 96.17
d1z0fa1 166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 96.15
d3raba_ 169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 96.15
d2atva1 168 Ras-like estrogen-regulated growth inhibitor, RERG 96.14
d1g16a_ 166 Rab-related protein Sec4 {Baker's yeast (Saccharom 96.13
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 96.12
d2f7sa1 186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 96.12
d2bcgy1 194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 96.11
d2erya1 171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.1
d1ctqa_ 166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 96.1
d1z08a1 167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 96.09
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 96.08
d1xtqa1 167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 96.08
d2gjsa1 168 Rad {Human (Homo sapiens) [TaxId: 9606]} 96.08
d1jjva_ 205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 96.07
d1r2qa_ 170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 96.06
d2bmea1 174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 96.06
d1kaoa_ 167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 96.06
d2qtvb1 166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.02
d2fn4a1 173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 96.01
d2f9la1 175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 95.99
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 95.99
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 95.99
d1c1ya_ 167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 95.97
d1nrjb_ 209 Signal recognition particle receptor beta-subunit 95.95
d1u8za_ 168 Ras-related protein RalA {Cotton-top tamarin (Sagu 95.87
d2atxa1 185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 95.86
d1vg8a_ 184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 95.83
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 95.83
d1tmka_ 214 Thymidylate kinase {Baker's yeast (Saccharomyces c 95.81
d4tmka_ 210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.81
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 95.8
d1x3sa1 177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 95.79
d1ek0a_ 170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 95.78
d1kmqa_ 177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 95.78
d1wmsa_ 174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 95.76
d1a5ta2 207 delta prime subunit of DNA polymerase III, N-domai 95.74
d1x1ra1 169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 95.74
d1zd9a1 164 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.73
d1mkya2 186 Probable GTPase Der, N-terminal and middle domains 95.73
d2g6ba1 170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 95.67
d1g3qa_ 237 Cell division regulator MinD {Archaeon Pyrococcus 95.67
d2gj8a1 161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.67
d1m7ba_ 179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 95.66
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 95.65
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 95.65
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 95.59
d1mh1a_ 183 Rac {Human (Homo sapiens) [TaxId: 9606]} 95.56
d1i2ma_ 170 Ran {Human (Homo sapiens) [TaxId: 9606]} 95.53
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.52
d1svsa1 195 Transducin (alpha subunit) {Rat (Rattus norvegicus 95.52
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 95.48
d1puia_ 188 Probable GTPase EngB {Escherichia coli [TaxId: 562 95.46
d2ngra_ 191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 95.42
d2g3ya1 172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 95.37
d1e0sa_ 173 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.36
d2bmja1 175 Centaurin gamma 1, G domain {Human (Homo sapiens) 95.32
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 95.31
d1zcba2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 95.24
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 95.24
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 95.2
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 95.18
d2bcjq2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 94.99
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.95
d1xzpa2 160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 94.94
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.94
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 94.93
d2fu5c1 173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 94.91
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.89
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 94.83
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 94.71
d1g7sa4 227 Initiation factor IF2/eIF5b, N-terminal (G) domain 94.64
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 94.58
d1wb1a4 179 Elongation factor SelB, N-terminal domain {Methano 94.56
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.53
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 94.42
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 94.24
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 94.19
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 94.18
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.06
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.8
d2gnoa2 198 gamma subunit of DNA polymerase III, N-domain {The 93.8
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 93.62
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 93.44
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 93.25
d2c78a3 204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 93.2
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 93.15
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 93.08
d1qhla_ 222 Cell division protein MukB {Escherichia coli [TaxI 92.79
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 92.66
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 92.6
d1xpua3 289 Transcription termination factor Rho, ATPase domai 92.53
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 92.49
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 92.46
d1tuea_205 Replication protein E1 helicase domain {Human papi 92.36
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 92.3
d1kkma_ 176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.11
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 92.06
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 91.88
d1u0ja_ 267 Rep 40 protein helicase domain {Adeno-associated v 91.86
d1knxa2 177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 91.79
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 91.51
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 91.21
d1kk1a3 195 Initiation factor eIF2 gamma subunit, N-terminal ( 90.83
d1d2ea3 196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 90.72
d1hyqa_ 232 Cell division regulator MinD {Archaeon Archaeoglob 90.32
d1jnya3 224 Elongation factor eEF-1alpha, N-terminal (G) domai 89.79
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 89.51
d2qn6a3 205 Initiation factor eIF2 gamma subunit, N-terminal ( 89.32
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 88.88
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 88.54
d1zunb3 222 Sulfate adenylate transferase subunit cysN/C, EF-T 88.42
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 87.46
d1r5ba3 245 Eukaryotic peptide chain release factor ERF2, G do 87.26
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 87.01
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 86.51
d1f60a3 239 Elongation factor eEF-1alpha, N-terminal (G) domai 85.55
d1o5za2 296 Folylpolyglutamate synthetase {Thermotoga maritima 81.13
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 80.62
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.65  E-value=2.7e-16  Score=129.30  Aligned_cols=77  Identities=14%  Similarity=0.093  Sum_probs=64.7

Q ss_pred             ccCCcccchHHHHHHHHHHhc-CCCCeEEEEEEcCCCccHHHHHHHHHhccc--cccCCCeeEEEe--CCCCHHHHHHHH
Q 042580          158 KKRNIMGLEDEIEELLDLLIV-GEPSLFIVAIVGNSGFDKTNFAGEAYNNNY--AKNYFDCRAWVG--CEYYLHKVLDSI  232 (241)
Q Consensus       158 ~~~~~vG~~~~~~~l~~~L~~-~~~~~~vI~IvG~gGvGKTTLak~v~~~~~--v~~~F~~~~wV~--~~~~~~~il~~I  232 (241)
                      .+..++||+.++++|+++|.. .+...++|+|+||||+||||||+++|++..  ++.+|++++||+  +.++...+...+
T Consensus        18 ~~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~   97 (277)
T d2a5yb3          18 KQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFT   97 (277)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHH
T ss_pred             CCCceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHHHH
Confidence            455688999999999999965 455689999999999999999999998744  677899999999  778877776655


Q ss_pred             HH
Q 042580          233 IK  234 (241)
Q Consensus       233 l~  234 (241)
                      ..
T Consensus        98 ~~   99 (277)
T d2a5yb3          98 DI   99 (277)
T ss_dssp             HH
T ss_pred             HH
Confidence            44



>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure