Citrus Sinensis ID: 042585


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
SLYEMCRLKKNHNVDRISALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWHTFPDLEIDKVKFLGPSKKLTVKTYGSEAALNFANRCISYAIERNVEELEVEHLRRLDTWNSLPQMVLRSKSIKVLTLQNYKLESLGNDDVKLLSLRKLHLSDVYADDQVMNNLFAQSPLLQHLEFVRYNNLVNVSSCKNLKHLDLCDGSYTDEWLNSQISGLPLLEQLHISLCNNIESITISSLRLKKLIINTCESNTIFSFGSIALFSLALRKPLGLASREAQDFLATFGKVV
cHHHHHHHcccccccccccccHHHHHHHHccccHHHHHHHHHHHcccccccccccEEEEEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccEEEcccEEEEEEEccccccccccccccccccEEEEEEEEEcHHHHHHHHHccccccEEEEEEEEccccEEEcccccEEEEEEEEEccccccEEEcccccEEEEEEEEccccEEEEEccccccEEEEEEEEcccEEEEccccEEEEEEEccccccHHHHHHHHHHHcccc
ccHHHHHHHccccccHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccEcccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEcccccccccccccccEEEEccEEEEEEEEEEEcccccccccccccHcEEEcccccccHHHHHHHHccccHHHHEEEEEccccEEccccccccEEEcccccccHHHHHHHHcccccHEEEEEEEcccccEEEEcccccEEEEEEccccccccccccccHEEEEccccccHHHHHHHHHHHHccccc
slyemcrlkknhnvdrisalpqPILQLIMSFLPFKQVVQICMVSKVWLQawhtfpdleidkvkflgpskkltvktygSEAALNFANRCISYAIERNVEELEVEHLRRldtwnslpqmvLRSKSIKVLTLQNykleslgnddvKLLSLRKLhlsdvyaddqvmnnlfaqspllqhlefvrynnlvnvsscknlkhldlcdgsytdewlnsqisglpLLEQLHISLCNNIESITISSLRLKKLIINTcesntifsfgsIALFSLALRKPLGLASREAQDFLATFGKVV
slyemcrlkknhnvdrisALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWHTFPDLEIDKVKFLGPSKKLTVKTYGSEAALNFANRCISYAIERNVEELEVEHLRrldtwnslpqmvLRSKSIKVLTLQNykleslgnddVKLLSLRKLHLSDVYADDQVMNNLFAQSPLLQHLEFVRYNNLVNVSSCKNLKHLDLCDGSYTDEWLNSQISGLPLLEQLHISLCNNIESITISSLRLKKLIINTCESNTIFSFGSIALFSLALRKPLGLASREAQDFLATFGKVV
SLYEMCRLKKNHNVDRISALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWHTFPDLEIDKVKFLGPSKKLTVKTYGSEAALNFANRCISYAIernveelevehlrrlDTWNSLPQMVLRSKSIKVLTLQNYKLESLGNDDVKLLSLRKLHLSDVYADDQVMNNLFAQSPLLQHLEFVRYNNLVNVSSCKNLKHLDLCDGSYTDEWLNSQISGLPLLEQLHISLCNNIESITISSLRLKKLIINTCESNTIFSFGSIALFSLALRKPLGLASREAQDFLATFGKVV
*****CRLKKNHNVDRISALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWHTFPDLEIDKVKFLGPSKKLTVKTYGSEAALNFANRCISYAIERNVEELEVEHLRRLDTWNSLPQMVLRSKSIKVLTLQNYKLESLGNDDVKLLSLRKLHLSDVYADDQVMNNLFAQSPLLQHLEFVRYNNLVNVSSCKNLKHLDLCDGSYTDEWLNSQISGLPLLEQLHISLCNNIESITISSLRLKKLIINTCESNTIFSFGSIALFSLALRKPLGLASREAQDFLAT*****
******************ALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWHTFPDLEIDKVKFLGPSKKLTVKTYGSEAALNFANRCISYAIERNVEELEVEHLRRLDTWNSLPQMVLRSKSIKVLTLQNYKLESLGNDDVKLLSLRKLHLSDVYADDQVMNNLFAQSPLLQHLEFVRYNNLVNVSSCKNLKHLDLCDGSYTDEWLNSQISGLPLLEQLHISLCNNIESITISSLRLKKLIINTCESNTIFSFGSIALFSLALRKPLGLASREAQDFLATFGKVV
SLYEMCRLKKNHNVDRISALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWHTFPDLEIDKVKFLGPSKKLTVKTYGSEAALNFANRCISYAIERNVEELEVEHLRRLDTWNSLPQMVLRSKSIKVLTLQNYKLESLGNDDVKLLSLRKLHLSDVYADDQVMNNLFAQSPLLQHLEFVRYNNLVNVSSCKNLKHLDLCDGSYTDEWLNSQISGLPLLEQLHISLCNNIESITISSLRLKKLIINTCESNTIFSFGSIALFSLALRKPLGLASREAQDFLATFGKVV
SLYEMCRLKKNHNVDRISALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWHTFPDLEIDKVKFLGPSKKLTVKTYGSEAALNFANRCISYAIERNVEELEVEHLRRLDTWNSLPQMVLRSKSIKVLTLQNYKLESLGNDDVKLLSLRKLHLSDVYADDQVMNNLFAQSPLLQHLEFVRYNNLVNVSSCKNLKHLDLCDGSYTDEWLNSQISGLPLLEQLHISLCNNIESITISSLRLKKLIINTCESNTIFSFGSIALFSLALRKPLGLASREAQDFLATFGKVV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLYEMCRLKKNHNVDRISALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWHTFPDLEIDKVKFLGPSKKLTVKTYGSEAALNFANRCISYAIERNVEELEVEHLRRLDTWNSLPQMVLRSKSIKVLTLQNYKLESLGNDDVKLLSLRKLHLSDVYADDQVMNNLFAQSPLLQHLEFVRYNNLVNVSSCKNLKHLDLCDGSYTDEWLNSQISGLPLLEQLHISLCNNIESITISSLRLKKLIINTCESNTIFSFGSIALFSLALRKPLGLASREAQDFLATFGKVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query286 2.2.26 [Sep-21-2011]
Q9LV26 456 Putative F-box/LRR-repeat yes no 0.597 0.375 0.282 3e-10
Q9LXJ7 416 FBD-associated F-box prot no no 0.737 0.507 0.282 7e-09
Q8H1R7419 F-box/FBD/LRR-repeat prot no no 0.835 0.570 0.268 9e-09
Q9LYZ2 469 Putative F-box/LRR-repeat no no 0.674 0.411 0.275 2e-08
Q9FM94 421 FBD-associated F-box prot no no 0.800 0.543 0.241 9e-08
Q501E9 455 F-box/FBD/LRR-repeat prot no no 0.720 0.452 0.277 6e-07
Q9LJF8306 F-box/LRR-repeat protein no no 0.741 0.692 0.28 7e-07
Q8LF09 453 F-box/FBD/LRR-repeat prot no no 0.678 0.428 0.269 7e-07
Q9C7M1 422 Putative FBD-associated F no no 0.758 0.514 0.270 7e-07
Q9LYZ4 458 F-box/LRR-repeat protein no no 0.517 0.323 0.262 2e-06
>sp|Q9LV26|FBL45_ARATH Putative F-box/LRR-repeat protein At3g18150 OS=Arabidopsis thaliana GN=At3g18150 PE=4 SV=2 Back     alignment and function desciption
 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 89/209 (42%), Gaps = 38/209 (18%)

Query: 7   RLKKNHNVDRISALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWHTFPDLEIDKVKFLG 66
           R K    VD IS+LP  ILQ I+SF+P K  +   ++SK W   W   P L  +  +   
Sbjct: 23  RRKIKEAVDSISSLPDVILQHILSFIPTKLAITTSLLSKRWRHVWCDTPSLSFNDYRLEA 82

Query: 67  PSKKLTVKTYGSEAALNFA------------NRCISYAIERNVEELEVEHLRRLDTWNSL 114
           P    T+  Y +   + F                I +A+ RNV+ L       LD WN +
Sbjct: 83  PFIDETLTRYTASKMMRFHLHTSLINNVPHLESWIKFAMSRNVDHLS------LDLWNQV 136

Query: 115 ------PQMVLRSKSIKVLTLQNYKLESLGNDDVKLLSLRKLHLSDVYADDQVMNNLFAQ 168
                 P     + S+K LT+    L+   +D +  + L+KL+LS     D+ M N+   
Sbjct: 137 ANKFKFPDFFHINSSLKQLTVV---LD--FSDTMIAICLKKLYLSTCLLSDESMANILFG 191

Query: 169 SPLLQHLEFVRYNNLVNVSSCKNLKHLDL 197
            P+L+ L          +  C  L+ LDL
Sbjct: 192 CPILESL---------TLDHCGGLRVLDL 211





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LXJ7|FBD11_ARATH FBD-associated F-box protein At3g52670 OS=Arabidopsis thaliana GN=At3g52670 PE=1 SV=2 Back     alignment and function description
>sp|Q8H1R7|FDL27_ARATH F-box/FBD/LRR-repeat protein At4g26340 OS=Arabidopsis thaliana GN=At4g26340 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYZ2|FBL80_ARATH Putative F-box/LRR-repeat protein At5g02930 OS=Arabidopsis thaliana GN=At5g02930 PE=4 SV=1 Back     alignment and function description
>sp|Q9FM94|FBD21_ARATH FBD-associated F-box protein At5g56370 OS=Arabidopsis thaliana GN=At5g56370 PE=2 SV=1 Back     alignment and function description
>sp|Q501E9|FDL20_ARATH F-box/FBD/LRR-repeat protein At3g51530 OS=Arabidopsis thaliana GN=At3g51530 PE=2 SV=1 Back     alignment and function description
>sp|Q9LJF8|FBL47_ARATH F-box/LRR-repeat protein At3g26922 OS=Arabidopsis thaliana GN=At3g26922 PE=2 SV=2 Back     alignment and function description
>sp|Q8LF09|FDL23_ARATH F-box/FBD/LRR-repeat protein At4g00160 OS=Arabidopsis thaliana GN=At4g00160 PE=2 SV=2 Back     alignment and function description
>sp|Q9C7M1|FBD2_ARATH Putative FBD-associated F-box protein At1g55030 OS=Arabidopsis thaliana GN=At1g55030 PE=4 SV=1 Back     alignment and function description
>sp|Q9LYZ4|FBL79_ARATH F-box/LRR-repeat protein At5g02910 OS=Arabidopsis thaliana GN=At5g02910 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
449476923 469 PREDICTED: putative F-box/FBD/LRR-repeat 0.807 0.492 0.340 2e-28
449458247 469 PREDICTED: putative F-box/FBD/LRR-repeat 0.807 0.492 0.340 2e-28
224124628 524 f-box family protein [Populus trichocarp 0.832 0.454 0.279 3e-15
297825453 464 hypothetical protein ARALYDRAFT_901029 [ 0.646 0.398 0.281 8e-11
357495939 519 FBD-associated F-box protein [Medicago t 0.793 0.437 0.250 1e-10
255553895 516 hypothetical protein RCOM_1176360 [Ricin 0.790 0.437 0.261 1e-10
255563415 501 conserved hypothetical protein [Ricinus 0.727 0.415 0.272 5e-10
147810265310 hypothetical protein VITISV_027852 [Viti 0.685 0.632 0.274 8e-10
225447425 513 PREDICTED: putative F-box/FBD/LRR-repeat 0.723 0.403 0.263 9e-10
225442254 520 PREDICTED: putative F-box protein At3g44 0.699 0.384 0.274 9e-10
>gi|449476923|ref|XP_004154877.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78840-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  132 bits (332), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 148/311 (47%), Gaps = 80/311 (25%)

Query: 14  VDRISALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWHTFPDLEIDKVKFLGPSK---- 69
           +D IS LP PILQ I+SFL  KQ++Q  ++SK W+  W TFP  E DK  F   SK    
Sbjct: 1   MDLISELPDPILQHILSFLSIKQIIQTTILSKRWIHLWLTFPSFEFDKNFFHIESKLQNK 60

Query: 70  -------------------KLTVKT-YGSEAALNFANRCISYAIERNVEELE----VEHL 105
                              K  + T +    ++   +R I Y +E  V+ELE    VE+ 
Sbjct: 61  RFHLINFVEQTLKQLKCLRKFKLHTDFPEPNSMVVVDRWIDYVLESGVQELEIVVTVENG 120

Query: 106 RRLDTWNSLPQMVLRSKSIKVLTLQNYKL-ESLGNDDVKLLSLRKLHLSDVYADDQVMNN 164
           +R +    LPQ V  ++S+ VLT+ + KL  SL  D  KLLS++ + L  V+A+D+ +  
Sbjct: 121 KRYN----LPQRVFANQSLTVLTVGDCKLCPSL--DGYKLLSMKSVSLLGVFAEDETVKR 174

Query: 165 LFAQSPLLQHL-------------------------------EF-VRYNNL--------- 183
           L +  P +QH+                               EF  +  NL         
Sbjct: 175 LVSNCPFIQHIKLDSCLGLRNLWLCETNELITMEVQNNSGLYEFGTKAMNLQAFEFRGQF 234

Query: 184 ----VNVSSCKNLKHLDLCDGSYTDEWLNSQISGLPLLEQLHISLCNNIESITISSLRLK 239
               +N+SSCKNLK L L   + TD+W N   S  PLLE L +S C+ +ES+ ISS  LK
Sbjct: 235 QPCCINISSCKNLKTLKLSMVAITDDWFNRCFSEFPLLEILALSYCHMLESLRISSSHLK 294

Query: 240 KLIINTCESNT 250
           K I+  CES T
Sbjct: 295 KFILCGCESVT 305




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449458247|ref|XP_004146859.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78840-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224124628|ref|XP_002319379.1| f-box family protein [Populus trichocarpa] gi|222857755|gb|EEE95302.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297825453|ref|XP_002880609.1| hypothetical protein ARALYDRAFT_901029 [Arabidopsis lyrata subsp. lyrata] gi|297326448|gb|EFH56868.1| hypothetical protein ARALYDRAFT_901029 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357495939|ref|XP_003618258.1| FBD-associated F-box protein [Medicago truncatula] gi|355493273|gb|AES74476.1| FBD-associated F-box protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255553895|ref|XP_002517988.1| hypothetical protein RCOM_1176360 [Ricinus communis] gi|223542970|gb|EEF44506.1| hypothetical protein RCOM_1176360 [Ricinus communis] Back     alignment and taxonomy information
>gi|255563415|ref|XP_002522710.1| conserved hypothetical protein [Ricinus communis] gi|223538060|gb|EEF39672.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|147810265|emb|CAN71448.1| hypothetical protein VITISV_027852 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225447425|ref|XP_002276216.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At4g03220-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442254|ref|XP_002275641.1| PREDICTED: putative F-box protein At3g44060 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
TAIR|locus:2081880 455 AT3G51530 "AT3G51530" [Arabido 0.430 0.270 0.321 1.3e-07
TAIR|locus:2136834 419 AT4G26340 "AT4G26340" [Arabido 0.227 0.155 0.369 4.8e-07
TAIR|locus:2092737 456 AT3G18150 "AT3G18150" [Arabido 0.811 0.508 0.250 7e-07
TAIR|locus:2126911 453 AT4G00160 "AT4G00160" [Arabido 0.199 0.125 0.438 1.2e-06
TAIR|locus:1005716372 441 AT4G00315 "AT4G00315" [Arabido 0.164 0.106 0.382 1.8e-06
TAIR|locus:2037578 458 AT1G78750 "AT1G78750" [Arabido 0.419 0.262 0.281 2.6e-06
TAIR|locus:2151231 458 AT5G02910 "AT5G02910" [Arabido 0.639 0.399 0.246 3.4e-06
TAIR|locus:2055993 448 AT2G04230 "AT2G04230" [Arabido 0.167 0.107 0.395 6.1e-06
TAIR|locus:2101791 488 AT3G60790 "AT3G60790" [Arabido 0.846 0.495 0.269 8.4e-06
TAIR|locus:5019474764306 AT3G26922 "AT3G26922" [Arabido 0.167 0.156 0.458 1.2e-05
TAIR|locus:2081880 AT3G51530 "AT3G51530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 97 (39.2 bits), Expect = 1.3e-07, Sum P(2) = 1.3e-07
 Identities = 45/140 (32%), Positives = 63/140 (45%)

Query:   142 VKLLSLRKLHL-SDVYADDQVMNNLFAQSPLLQHLEFVR---YNNLVN-VSSCKNLKHLD 196
             V + SLR LHL S VY  D+  +NLFA  P L+HL   R   ++ +VN +    +LK L 
Sbjct:   170 VSMKSLRTLHLLSVVYKGDESGHNLFASCPNLEHLVLRRGFFFDAVVNFIIDAPSLKTLL 229

Query:   197 LCDGSYTDEWLNSQISGLPLLEQLHIS--------LCNNIESITISSLRLKKLIINTCES 248
             L D     E     +   P L+ L I         L  N+  +  +++R    I+N    
Sbjct:   230 LSDPFSARESSRGYVIKAPSLKYLGIESVEGFEYFLIENVTELVEANIRNVSKIVN---E 286

Query:   249 NTIFSFGSIALFSLALRKPL 268
             N + S  S    SL L  PL
Sbjct:   287 NILGSLKSAKRLSLDL-SPL 305


GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
TAIR|locus:2136834 AT4G26340 "AT4G26340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092737 AT3G18150 "AT3G18150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126911 AT4G00160 "AT4G00160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716372 AT4G00315 "AT4G00315" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037578 AT1G78750 "AT1G78750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151231 AT5G02910 "AT5G02910" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055993 AT2G04230 "AT2G04230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101791 AT3G60790 "AT3G60790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:5019474764 AT3G26922 "AT3G26922" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 286
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.89
KOG4341 483 consensus F-box protein containing LRR [General fu 99.71
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.99
KOG4341 483 consensus F-box protein containing LRR [General fu 98.86
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.79
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.57
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.55
KOG1947 482 consensus Leucine rich repeat proteins, some prote 98.51
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.5
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.47
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.46
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.43
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.3
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.27
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.23
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.22
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.2
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.12
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.12
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.02
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.68
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.4
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.37
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.26
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.13
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.12
KOG0617264 consensus Ras suppressor protein (contains leucine 97.02
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 96.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.8
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.76
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 96.76
KOG0281 499 consensus Beta-TrCP (transducin repeats containing 96.76
PRK15386 426 type III secretion protein GogB; Provisional 96.67
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.42
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 96.41
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.41
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.3
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 96.2
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 96.18
KOG0617264 consensus Ras suppressor protein (contains leucine 96.17
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.17
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.14
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.08
PLN03150623 hypothetical protein; Provisional 95.91
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.83
KOG1259490 consensus Nischarin, modulator of integrin alpha5 95.74
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.73
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 95.71
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 95.57
KOG2997366 consensus F-box protein FBX9 [General function pre 95.31
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.3
PLN03150623 hypothetical protein; Provisional 95.19
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.16
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 94.74
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 94.36
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.14
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 93.92
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 93.34
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.31
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 93.0
PF13013109 F-box-like_2: F-box-like domain 92.35
KOG1259490 consensus Nischarin, modulator of integrin alpha5 92.15
KOG2123 388 consensus Uncharacterized conserved protein [Funct 91.35
KOG0274 537 consensus Cdc4 and related F-box and WD-40 protein 91.27
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 90.76
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 90.71
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 88.95
KOG0472565 consensus Leucine-rich repeat protein [Function un 88.82
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 87.04
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 85.79
PRK15386 426 type III secretion protein GogB; Provisional 85.71
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 85.58
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 84.94
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 83.39
KOG4237 498 consensus Extracellular matrix protein slit, conta 82.42
KOG0472565 consensus Leucine-rich repeat protein [Function un 82.03
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 81.85
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.89  E-value=2.5e-24  Score=178.30  Aligned_cols=253  Identities=18%  Similarity=0.196  Sum_probs=183.2

Q ss_pred             CCCCCHHHHHHHHccCChhhHHHhhhhhhhhHhhhccCC---ceEeecCCCCCcchhhhHHHHHHHHHHH----------
Q 042585           17 ISALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWHTFP---DLEIDKVKFLGPSKKLTVKTYGSEAALN----------   83 (286)
Q Consensus        17 i~~LPdeil~~Ils~L~~~d~~~~~~vskrW~~lw~~~~---~l~~~~~~~~~~~~~~~~~~~~~~~l~~----------   83 (286)
                      ++.|||||+..|||.|+.|++.+.+.|||||.++-+.-.   .++...+...+        +..-+.+.+          
T Consensus        98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~lDl~~r~i~p--------~~l~~l~~rgV~v~Rlar~  169 (419)
T KOG2120|consen   98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQTLDLTGRNIHP--------DVLGRLLSRGVIVFRLARS  169 (419)
T ss_pred             cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceeeeccCCCccCh--------hHHHHHHhCCeEEEEcchh
Confidence            789999999999999999999999999999998644433   23444433332        111111111          


Q ss_pred             hHh--HHHHH--HHhCCceEEEEEeccCCCcccCCCcchhccCCccEEEEeceeecc-CCcCcccCCCccEEEcceee-e
Q 042585           84 FAN--RCISY--AIERNVEELEVEHLRRLDTWNSLPQMVLRSKSIKVLTLQNYKLES-LGNDDVKLLSLRKLHLSDVY-A  157 (286)
Q Consensus        84 ~~~--~~~~~--~~~~~l~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~~~~-~~~~~~~~~~L~~L~L~~~~-~  157 (286)
                      +++  +...+  .....++.++++...  .+...+.-.+..|.+|+.|.|.|..++. ...-.+.-.+|+.|+|+.|. +
T Consensus       170 ~~~~prlae~~~~frsRlq~lDLS~s~--it~stl~~iLs~C~kLk~lSlEg~~LdD~I~~~iAkN~~L~~lnlsm~sG~  247 (419)
T KOG2120|consen  170 FMDQPRLAEHFSPFRSRLQHLDLSNSV--ITVSTLHGILSQCSKLKNLSLEGLRLDDPIVNTIAKNSNLVRLNLSMCSGF  247 (419)
T ss_pred             hhcCchhhhhhhhhhhhhHHhhcchhh--eeHHHHHHHHHHHHhhhhccccccccCcHHHHHHhccccceeecccccccc
Confidence            111  11111  123457888887211  2455666678899999999999998855 11233456889999999999 9


Q ss_pred             ChHHHHHHHhcCCCcceEEeeeccccce---eec---ccCCceEEecCcc--cChhhHHHHHhcCCCccEEecccccCcc
Q 042585          158 DDQVMNNLFAQSPLLQHLEFVRYNNLVN---VSS---CKNLKHLDLCDGS--YTDEWLNSQISGLPLLEQLHISLCNNIE  229 (286)
Q Consensus       158 ~~~~l~~l~~~cp~Le~L~l~~c~~~~~---~~~---~~~L~~L~l~~~~--~~~~~l~~~~~~~p~L~~L~l~~c~~~~  229 (286)
                      +.++++.+..+|..|.+|++++|.-...   +.+   .++|+.|+++++.  +.+..+..+...||+|.+|++++|-.++
T Consensus       248 t~n~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise~l~~LNlsG~rrnl~~sh~~tL~~rcp~l~~LDLSD~v~l~  327 (419)
T KOG2120|consen  248 TENALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISETLTQLNLSGYRRNLQKSHLSTLVRRCPNLVHLDLSDSVMLK  327 (419)
T ss_pred             chhHHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhchhhhhhhhhhhHhhhhhhHHHHHHHhCCceeeeccccccccC
Confidence            9999999999999999999999965421   112   8999999999873  6667888999999999999999997776


Q ss_pred             cccc----ccccccEEEeecccCCccccc-cccceeeeccCCCCCcchHHHHHHH
Q 042585          230 SITI----SSLRLKKLIINTCESNTIFSF-GSIALFSLALRKPLGLASREAQDFL  279 (286)
Q Consensus       230 ~~~i----~~p~L~~L~ls~c~~~~~~~~-~~~~l~s~~~~~~~~~~~~~~~~~l  279 (286)
                      +--+    .-+.|++|.++.|+.+....+ .--+.-++.+.+.||..++.+-+++
T Consensus       328 ~~~~~~~~kf~~L~~lSlsRCY~i~p~~~~~l~s~psl~yLdv~g~vsdt~mel~  382 (419)
T KOG2120|consen  328 NDCFQEFFKFNYLQHLSLSRCYDIIPETLLELNSKPSLVYLDVFGCVSDTTMELL  382 (419)
T ss_pred             chHHHHHHhcchheeeehhhhcCCChHHeeeeccCcceEEEEeccccCchHHHHH
Confidence            6322    248999999999998876543 3333456677788898888665544



>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-12
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-04
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 5e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-04
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
 Score = 66.5 bits (162), Expect = 2e-12
 Identities = 36/268 (13%), Positives = 78/268 (29%), Gaps = 48/268 (17%)

Query: 15  DRISALPQPILQLIMSFLPFKQVVQICM-VSKVWLQAWHTFPDLEIDKVKFLGPSKKLTV 73
               + P+ +L+ + SF+   +       V K W +                   +K+ +
Sbjct: 4   RIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIE-------------RWCRRKVFI 50

Query: 74  KTYGSEAALNFANRCISYAIERNVEELEVEHLRRLDTWNSLPQMVLRSKSIKVLTLQNYK 133
               + +      R         V  +E++       +N +P          +  + +  
Sbjct: 51  GNCYAVSPATVIRRF------PKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSS- 103

Query: 134 LESLGNDDVKLLSLRKLHLSDVYADDQVMNNLFAQSPLLQHLEFVRYNNLVN------VS 187
                        L ++ L  +   D  +  +       + L                 +
Sbjct: 104 ----------YTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAA 153

Query: 188 SCKNLKHLDLCD---GSYTDEWLNSQISGLPLLEQLHISLCNN------IESITISSLRL 238
           +C+NLK LDL +      +  WL+        L  L+IS   +      +E +      L
Sbjct: 154 TCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNL 213

Query: 239 KKLIINTCESNTIFSFGSIALFSLALRK 266
           K L +N           ++   +  L +
Sbjct: 214 KSLKLNRAVPLE--KLATLLQRAPQLEE 239


>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.22
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.1
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.07
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.05
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 99.02
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.98
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.94
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.93
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.88
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.83
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.82
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.82
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.79
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.78
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.76
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.74
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.74
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.72
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.7
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.65
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.65
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.65
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.65
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.64
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.63
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.62
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.61
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.6
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.59
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.59
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.59
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.58
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.58
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.58
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.58
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.57
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.57
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.56
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.55
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.54
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.54
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.53
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.53
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.52
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.52
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.52
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.5
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.49
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.49
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.49
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 98.48
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.48
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.48
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.47
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.46
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.45
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.44
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.44
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.43
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.41
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.41
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.41
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.41
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.4
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.4
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.4
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.39
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.39
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.39
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.37
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.37
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.37
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.36
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.36
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.36
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.35
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.34
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.32
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.3
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.3
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.3
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.3
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.3
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.3
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.3
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.29
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.28
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.27
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.26
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.26
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.26
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.25
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.25
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.23
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.2
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.2
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.18
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.13
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.09
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 98.06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.06
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 98.05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.05
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.99
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.96
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.95
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.95
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.94
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.9
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.89
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 97.89
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.89
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 97.79
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.79
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.7
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.7
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.67
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.63
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 97.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.06
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.02
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.9
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.66
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.53
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 96.45
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 96.44
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 96.25
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.69
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.49
4gt6_A394 Cell surface protein; leucine rich repeats, putati 94.93
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 94.52
4gt6_A394 Cell surface protein; leucine rich repeats, putati 92.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 92.27
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 91.76
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 90.77
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 89.4
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 86.24
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
Probab=99.89  E-value=4.3e-23  Score=180.65  Aligned_cols=231  Identities=15%  Similarity=0.182  Sum_probs=152.7

Q ss_pred             CcccCCCCCHHHHHHHHccCChhhHHHhhhhhhhhHhhhcc---CCceEeecCCCCCcchhhhHHHHHHHHHHHh-----
Q 042585           13 NVDRISALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWHT---FPDLEIDKVKFLGPSKKLTVKTYGSEAALNF-----   84 (286)
Q Consensus        13 ~~d~i~~LPdeil~~Ils~L~~~d~~~~~~vskrW~~lw~~---~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~-----   84 (286)
                      +...|++||||++.+||+||+.+|+++++.|||+|+++...   ...+++....+..        ..+.+.....     
T Consensus         5 ~~~~~~~LP~eil~~If~~L~~~d~~~~~~vc~~W~~~~~~~~~~~~l~l~~~~~~~--------~~~~~~~~~~l~~L~   76 (336)
T 2ast_B            5 PGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHP--------DVTGRLLSQGVIAFR   76 (336)
T ss_dssp             --CCSSSSCHHHHHHHHTTSCHHHHHHTTSSCHHHHHHHTCSTTSSEEECTTCBCCH--------HHHHHHHHTTCSEEE
T ss_pred             ccCChhhCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCchhheeeccccccCCH--------HHHHhhhhccceEEE
Confidence            45568999999999999999999999999999999998543   2234544332221        1121111000     


Q ss_pred             -----HhH-HHHHHHhCCceEEEEEeccCCCcccCCCcchhccCCccEEEEeceeecc-CCcCcccCCCccEEEcceee-
Q 042585           85 -----ANR-CISYAIERNVEELEVEHLRRLDTWNSLPQMVLRSKSIKVLTLQNYKLES-LGNDDVKLLSLRKLHLSDVY-  156 (286)
Q Consensus        85 -----~~~-~~~~~~~~~l~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~~~~-~~~~~~~~~~L~~L~L~~~~-  156 (286)
                           +.. +.......++++|+++...  .....++..+..+++|++|++++|.+.. .......+++|++|+|++|. 
T Consensus        77 l~~n~l~~~~~~~~~~~~L~~L~L~~~~--l~~~~~~~~~~~~~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~L~~~~~  154 (336)
T 2ast_B           77 CPRSFMDQPLAEHFSPFRVQHMDLSNSV--IEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSG  154 (336)
T ss_dssp             CTTCEECSCCCSCCCCBCCCEEECTTCE--ECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBS
T ss_pred             cCCccccccchhhccCCCCCEEEccCCC--cCHHHHHHHHhhCCCCCEEeCcCcccCHHHHHHHhcCCCCCEEECCCCCC
Confidence                 000 0000001455666665111  0112255566778888888888887632 21234458999999999996 


Q ss_pred             eChHHHHHHHhcCCCcceEEeeeccccce------eeccc-CCceEEecCc--ccChhhHHHHHhcCCCccEEecccccC
Q 042585          157 ADDQVMNNLFAQSPLLQHLEFVRYNNLVN------VSSCK-NLKHLDLCDG--SYTDEWLNSQISGLPLLEQLHISLCNN  227 (286)
Q Consensus       157 ~~~~~l~~l~~~cp~Le~L~l~~c~~~~~------~~~~~-~L~~L~l~~~--~~~~~~l~~~~~~~p~L~~L~l~~c~~  227 (286)
                      +++.++..++..||+|++|++++|....+      +..++ +|++|++.+|  .+++..+......+|+|++|++++|..
T Consensus       155 l~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~  234 (336)
T 2ast_B          155 FSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVM  234 (336)
T ss_dssp             CCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTT
T ss_pred             CCHHHHHHHHhcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeCCCCCc
Confidence            88888888888899999999998833322      22278 9999999987  567666667777899999999999875


Q ss_pred             cccccc----ccccccEEEeecccCCcccc
Q 042585          228 IESITI----SSLRLKKLIINTCESNTIFS  253 (286)
Q Consensus       228 ~~~~~i----~~p~L~~L~ls~c~~~~~~~  253 (286)
                      +++..+    ..++|+.|++++|...+...
T Consensus       235 l~~~~~~~l~~l~~L~~L~l~~~~~~~~~~  264 (336)
T 2ast_B          235 LKNDCFQEFFQLNYLQHLSLSRCYDIIPET  264 (336)
T ss_dssp             CCGGGGGGGGGCTTCCEEECTTCTTCCGGG
T ss_pred             CCHHHHHHHhCCCCCCEeeCCCCCCCCHHH
Confidence            544322    24889999999987666553



>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 286
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 6e-05
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 0.001
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: F-box/WD repeat-containing protein 7, FBXW7
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 39.3 bits (91), Expect = 6e-05
 Identities = 12/48 (25%), Positives = 21/48 (43%)

Query: 5  MCRLKKNHNVDRISALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWH 52
          M  ++     D IS LP+ +   ++SFL  K ++Q     + W     
Sbjct: 7  MQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAE 54


>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.69
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.41
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.25
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.92
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.89
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.71
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.6
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.59
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.56
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.53
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.49
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.48
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.43
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.35
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.31
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.3
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.27
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.21
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.17
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.11
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.09
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.06
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.06
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.89
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.81
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 97.79
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.79
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.69
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.64
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 97.63
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.55
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.43
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.4
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.29
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.07
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 96.89
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 96.78
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.7
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.56
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.26
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.19
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 94.86
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.69  E-value=8.7e-18  Score=141.93  Aligned_cols=161  Identities=16%  Similarity=0.203  Sum_probs=127.4

Q ss_pred             CCceEEEEEeccCCCcccCCCcchhccCCccEEEEeceeecc-CCcCcccCCCccEEEcceee-eChHHHHHHHhcCCCc
Q 042585           95 RNVEELEVEHLRRLDTWNSLPQMVLRSKSIKVLTLQNYKLES-LGNDDVKLLSLRKLHLSDVY-ADDQVMNNLFAQSPLL  172 (286)
Q Consensus        95 ~~l~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~~~~-~~~~~~~~~~L~~L~L~~~~-~~~~~l~~l~~~cp~L  172 (286)
                      .+++++++++..  .....++..+..|++|++|+|++|.+.. .......+++|++|+|++|. +++.++..++.+||+|
T Consensus        46 ~~L~~LdLs~~~--i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L  123 (284)
T d2astb2          46 FRVQHMDLSNSV--IEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRL  123 (284)
T ss_dssp             BCCCEEECTTCE--ECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHHHHHCTTC
T ss_pred             CCCCEEECCCCc--cCHHHHHHHHHhCCCcccccccccCCCcHHHHHHhcCCCCcCccccccccccccccchhhHHHHhc
Confidence            467888887221  1233344556789999999999998733 22334568999999999998 9999999999999999


Q ss_pred             ceEEeeeccccce------eec-ccCCceEEecCc--ccChhhHHHHHhcCCCccEEecccccCccccccc----ccccc
Q 042585          173 QHLEFVRYNNLVN------VSS-CKNLKHLDLCDG--SYTDEWLNSQISGLPLLEQLHISLCNNIESITIS----SLRLK  239 (286)
Q Consensus       173 e~L~l~~c~~~~~------~~~-~~~L~~L~l~~~--~~~~~~l~~~~~~~p~L~~L~l~~c~~~~~~~i~----~p~L~  239 (286)
                      ++|++++|....+      +.. +++|++|++.++  .+++.++..+..+||+|++|++++|..+++..+.    .|+|+
T Consensus       124 ~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~~~~L~  203 (284)
T d2astb2         124 DELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQ  203 (284)
T ss_dssp             CEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCTTCC
T ss_pred             cccccccccccccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhcccCcCC
Confidence            9999999976522      111 689999999976  4778888888899999999999999888766544    48999


Q ss_pred             EEEeecccCCcccccccc
Q 042585          240 KLIINTCESNTIFSFGSI  257 (286)
Q Consensus       240 ~L~ls~c~~~~~~~~~~~  257 (286)
                      +|++++|..+++.++..+
T Consensus       204 ~L~L~~C~~i~~~~l~~L  221 (284)
T d2astb2         204 HLSLSRCYDIIPETLLEL  221 (284)
T ss_dssp             EEECTTCTTCCGGGGGGG
T ss_pred             EEECCCCCCCChHHHHHH
Confidence            999999999988766554



>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure