Citrus Sinensis ID: 042585
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 286 | ||||||
| 449476923 | 469 | PREDICTED: putative F-box/FBD/LRR-repeat | 0.807 | 0.492 | 0.340 | 2e-28 | |
| 449458247 | 469 | PREDICTED: putative F-box/FBD/LRR-repeat | 0.807 | 0.492 | 0.340 | 2e-28 | |
| 224124628 | 524 | f-box family protein [Populus trichocarp | 0.832 | 0.454 | 0.279 | 3e-15 | |
| 297825453 | 464 | hypothetical protein ARALYDRAFT_901029 [ | 0.646 | 0.398 | 0.281 | 8e-11 | |
| 357495939 | 519 | FBD-associated F-box protein [Medicago t | 0.793 | 0.437 | 0.250 | 1e-10 | |
| 255553895 | 516 | hypothetical protein RCOM_1176360 [Ricin | 0.790 | 0.437 | 0.261 | 1e-10 | |
| 255563415 | 501 | conserved hypothetical protein [Ricinus | 0.727 | 0.415 | 0.272 | 5e-10 | |
| 147810265 | 310 | hypothetical protein VITISV_027852 [Viti | 0.685 | 0.632 | 0.274 | 8e-10 | |
| 225447425 | 513 | PREDICTED: putative F-box/FBD/LRR-repeat | 0.723 | 0.403 | 0.263 | 9e-10 | |
| 225442254 | 520 | PREDICTED: putative F-box protein At3g44 | 0.699 | 0.384 | 0.274 | 9e-10 |
| >gi|449476923|ref|XP_004154877.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78840-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 132 bits (332), Expect = 2e-28, Method: Compositional matrix adjust.
Identities = 106/311 (34%), Positives = 148/311 (47%), Gaps = 80/311 (25%)
Query: 14 VDRISALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWHTFPDLEIDKVKFLGPSK---- 69
+D IS LP PILQ I+SFL KQ++Q ++SK W+ W TFP E DK F SK
Sbjct: 1 MDLISELPDPILQHILSFLSIKQIIQTTILSKRWIHLWLTFPSFEFDKNFFHIESKLQNK 60
Query: 70 -------------------KLTVKT-YGSEAALNFANRCISYAIERNVEELE----VEHL 105
K + T + ++ +R I Y +E V+ELE VE+
Sbjct: 61 RFHLINFVEQTLKQLKCLRKFKLHTDFPEPNSMVVVDRWIDYVLESGVQELEIVVTVENG 120
Query: 106 RRLDTWNSLPQMVLRSKSIKVLTLQNYKL-ESLGNDDVKLLSLRKLHLSDVYADDQVMNN 164
+R + LPQ V ++S+ VLT+ + KL SL D KLLS++ + L V+A+D+ +
Sbjct: 121 KRYN----LPQRVFANQSLTVLTVGDCKLCPSL--DGYKLLSMKSVSLLGVFAEDETVKR 174
Query: 165 LFAQSPLLQHL-------------------------------EF-VRYNNL--------- 183
L + P +QH+ EF + NL
Sbjct: 175 LVSNCPFIQHIKLDSCLGLRNLWLCETNELITMEVQNNSGLYEFGTKAMNLQAFEFRGQF 234
Query: 184 ----VNVSSCKNLKHLDLCDGSYTDEWLNSQISGLPLLEQLHISLCNNIESITISSLRLK 239
+N+SSCKNLK L L + TD+W N S PLLE L +S C+ +ES+ ISS LK
Sbjct: 235 QPCCINISSCKNLKTLKLSMVAITDDWFNRCFSEFPLLEILALSYCHMLESLRISSSHLK 294
Query: 240 KLIINTCESNT 250
K I+ CES T
Sbjct: 295 KFILCGCESVT 305
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449458247|ref|XP_004146859.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78840-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224124628|ref|XP_002319379.1| f-box family protein [Populus trichocarpa] gi|222857755|gb|EEE95302.1| f-box family protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297825453|ref|XP_002880609.1| hypothetical protein ARALYDRAFT_901029 [Arabidopsis lyrata subsp. lyrata] gi|297326448|gb|EFH56868.1| hypothetical protein ARALYDRAFT_901029 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|357495939|ref|XP_003618258.1| FBD-associated F-box protein [Medicago truncatula] gi|355493273|gb|AES74476.1| FBD-associated F-box protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255553895|ref|XP_002517988.1| hypothetical protein RCOM_1176360 [Ricinus communis] gi|223542970|gb|EEF44506.1| hypothetical protein RCOM_1176360 [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255563415|ref|XP_002522710.1| conserved hypothetical protein [Ricinus communis] gi|223538060|gb|EEF39672.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147810265|emb|CAN71448.1| hypothetical protein VITISV_027852 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225447425|ref|XP_002276216.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At4g03220-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225442254|ref|XP_002275641.1| PREDICTED: putative F-box protein At3g44060 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 286 | ||||||
| TAIR|locus:2081880 | 455 | AT3G51530 "AT3G51530" [Arabido | 0.430 | 0.270 | 0.321 | 1.3e-07 | |
| TAIR|locus:2136834 | 419 | AT4G26340 "AT4G26340" [Arabido | 0.227 | 0.155 | 0.369 | 4.8e-07 | |
| TAIR|locus:2092737 | 456 | AT3G18150 "AT3G18150" [Arabido | 0.811 | 0.508 | 0.250 | 7e-07 | |
| TAIR|locus:2126911 | 453 | AT4G00160 "AT4G00160" [Arabido | 0.199 | 0.125 | 0.438 | 1.2e-06 | |
| TAIR|locus:1005716372 | 441 | AT4G00315 "AT4G00315" [Arabido | 0.164 | 0.106 | 0.382 | 1.8e-06 | |
| TAIR|locus:2037578 | 458 | AT1G78750 "AT1G78750" [Arabido | 0.419 | 0.262 | 0.281 | 2.6e-06 | |
| TAIR|locus:2151231 | 458 | AT5G02910 "AT5G02910" [Arabido | 0.639 | 0.399 | 0.246 | 3.4e-06 | |
| TAIR|locus:2055993 | 448 | AT2G04230 "AT2G04230" [Arabido | 0.167 | 0.107 | 0.395 | 6.1e-06 | |
| TAIR|locus:2101791 | 488 | AT3G60790 "AT3G60790" [Arabido | 0.846 | 0.495 | 0.269 | 8.4e-06 | |
| TAIR|locus:5019474764 | 306 | AT3G26922 "AT3G26922" [Arabido | 0.167 | 0.156 | 0.458 | 1.2e-05 |
| TAIR|locus:2081880 AT3G51530 "AT3G51530" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 97 (39.2 bits), Expect = 1.3e-07, Sum P(2) = 1.3e-07
Identities = 45/140 (32%), Positives = 63/140 (45%)
Query: 142 VKLLSLRKLHL-SDVYADDQVMNNLFAQSPLLQHLEFVR---YNNLVN-VSSCKNLKHLD 196
V + SLR LHL S VY D+ +NLFA P L+HL R ++ +VN + +LK L
Sbjct: 170 VSMKSLRTLHLLSVVYKGDESGHNLFASCPNLEHLVLRRGFFFDAVVNFIIDAPSLKTLL 229
Query: 197 LCDGSYTDEWLNSQISGLPLLEQLHIS--------LCNNIESITISSLRLKKLIINTCES 248
L D E + P L+ L I L N+ + +++R I+N
Sbjct: 230 LSDPFSARESSRGYVIKAPSLKYLGIESVEGFEYFLIENVTELVEANIRNVSKIVN---E 286
Query: 249 NTIFSFGSIALFSLALRKPL 268
N + S S SL L PL
Sbjct: 287 NILGSLKSAKRLSLDL-SPL 305
|
|
| TAIR|locus:2136834 AT4G26340 "AT4G26340" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2092737 AT3G18150 "AT3G18150" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2126911 AT4G00160 "AT4G00160" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1005716372 AT4G00315 "AT4G00315" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2037578 AT1G78750 "AT1G78750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151231 AT5G02910 "AT5G02910" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2055993 AT2G04230 "AT2G04230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2101791 AT3G60790 "AT3G60790" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:5019474764 AT3G26922 "AT3G26922" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.89 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.71 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 98.99 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.86 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.79 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.57 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.55 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 98.51 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 98.5 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.47 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.46 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.43 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.3 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.27 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.23 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.22 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.2 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.12 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.12 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.02 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.96 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.68 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.4 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.37 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 97.26 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.13 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.12 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 97.02 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.95 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 96.84 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.8 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.76 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 96.76 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 96.76 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 96.67 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 96.42 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 96.41 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.41 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.3 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 96.2 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 96.18 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 96.17 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.17 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.14 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.08 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 95.91 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.83 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 95.74 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 95.73 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 95.71 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 95.57 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 95.31 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 95.3 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 95.19 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.16 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 94.74 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 94.36 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 94.14 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 93.92 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 93.34 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 93.31 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 93.0 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 92.35 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 92.15 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 91.35 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 91.27 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 90.76 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 90.71 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 88.95 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 88.82 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 87.04 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 85.79 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 85.71 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 85.58 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 84.94 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 83.39 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 82.42 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 82.03 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 81.85 |
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.89 E-value=2.5e-24 Score=178.30 Aligned_cols=253 Identities=18% Similarity=0.196 Sum_probs=183.2
Q ss_pred CCCCCHHHHHHHHccCChhhHHHhhhhhhhhHhhhccCC---ceEeecCCCCCcchhhhHHHHHHHHHHH----------
Q 042585 17 ISALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWHTFP---DLEIDKVKFLGPSKKLTVKTYGSEAALN---------- 83 (286)
Q Consensus 17 i~~LPdeil~~Ils~L~~~d~~~~~~vskrW~~lw~~~~---~l~~~~~~~~~~~~~~~~~~~~~~~l~~---------- 83 (286)
++.|||||+..|||.|+.|++.+.+.|||||.++-+.-. .++...+...+ +..-+.+.+
T Consensus 98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~lDl~~r~i~p--------~~l~~l~~rgV~v~Rlar~ 169 (419)
T KOG2120|consen 98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQTLDLTGRNIHP--------DVLGRLLSRGVIVFRLARS 169 (419)
T ss_pred cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceeeeccCCCccCh--------hHHHHHHhCCeEEEEcchh
Confidence 789999999999999999999999999999998644433 23444433332 111111111
Q ss_pred hHh--HHHHH--HHhCCceEEEEEeccCCCcccCCCcchhccCCccEEEEeceeecc-CCcCcccCCCccEEEcceee-e
Q 042585 84 FAN--RCISY--AIERNVEELEVEHLRRLDTWNSLPQMVLRSKSIKVLTLQNYKLES-LGNDDVKLLSLRKLHLSDVY-A 157 (286)
Q Consensus 84 ~~~--~~~~~--~~~~~l~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~~~~-~~~~~~~~~~L~~L~L~~~~-~ 157 (286)
+++ +...+ .....++.++++... .+...+.-.+..|.+|+.|.|.|..++. ...-.+.-.+|+.|+|+.|. +
T Consensus 170 ~~~~prlae~~~~frsRlq~lDLS~s~--it~stl~~iLs~C~kLk~lSlEg~~LdD~I~~~iAkN~~L~~lnlsm~sG~ 247 (419)
T KOG2120|consen 170 FMDQPRLAEHFSPFRSRLQHLDLSNSV--ITVSTLHGILSQCSKLKNLSLEGLRLDDPIVNTIAKNSNLVRLNLSMCSGF 247 (419)
T ss_pred hhcCchhhhhhhhhhhhhHHhhcchhh--eeHHHHHHHHHHHHhhhhccccccccCcHHHHHHhccccceeecccccccc
Confidence 111 11111 123457888887211 2455666678899999999999998855 11233456889999999999 9
Q ss_pred ChHHHHHHHhcCCCcceEEeeeccccce---eec---ccCCceEEecCcc--cChhhHHHHHhcCCCccEEecccccCcc
Q 042585 158 DDQVMNNLFAQSPLLQHLEFVRYNNLVN---VSS---CKNLKHLDLCDGS--YTDEWLNSQISGLPLLEQLHISLCNNIE 229 (286)
Q Consensus 158 ~~~~l~~l~~~cp~Le~L~l~~c~~~~~---~~~---~~~L~~L~l~~~~--~~~~~l~~~~~~~p~L~~L~l~~c~~~~ 229 (286)
+.++++.+..+|..|.+|++++|.-... +.+ .++|+.|+++++. +.+..+..+...||+|.+|++++|-.++
T Consensus 248 t~n~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise~l~~LNlsG~rrnl~~sh~~tL~~rcp~l~~LDLSD~v~l~ 327 (419)
T KOG2120|consen 248 TENALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISETLTQLNLSGYRRNLQKSHLSTLVRRCPNLVHLDLSDSVMLK 327 (419)
T ss_pred chhHHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhchhhhhhhhhhhHhhhhhhHHHHHHHhCCceeeeccccccccC
Confidence 9999999999999999999999965421 112 8999999999873 6667888999999999999999997776
Q ss_pred cccc----ccccccEEEeecccCCccccc-cccceeeeccCCCCCcchHHHHHHH
Q 042585 230 SITI----SSLRLKKLIINTCESNTIFSF-GSIALFSLALRKPLGLASREAQDFL 279 (286)
Q Consensus 230 ~~~i----~~p~L~~L~ls~c~~~~~~~~-~~~~l~s~~~~~~~~~~~~~~~~~l 279 (286)
+--+ .-+.|++|.++.|+.+....+ .--+.-++.+.+.||..++.+-+++
T Consensus 328 ~~~~~~~~kf~~L~~lSlsRCY~i~p~~~~~l~s~psl~yLdv~g~vsdt~mel~ 382 (419)
T KOG2120|consen 328 NDCFQEFFKFNYLQHLSLSRCYDIIPETLLELNSKPSLVYLDVFGCVSDTTMELL 382 (419)
T ss_pred chHHHHHHhcchheeeehhhhcCCChHHeeeeccCcceEEEEeccccCchHHHHH
Confidence 6322 248999999999998876543 3333456677788898888665544
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 286 | |||
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-12 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-04 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 5e-06 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-04 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 7e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 9e-06 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 6e-05 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 8e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-04 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 2e-04 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 5e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 8e-04 |
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
Score = 66.5 bits (162), Expect = 2e-12
Identities = 36/268 (13%), Positives = 78/268 (29%), Gaps = 48/268 (17%)
Query: 15 DRISALPQPILQLIMSFLPFKQVVQICM-VSKVWLQAWHTFPDLEIDKVKFLGPSKKLTV 73
+ P+ +L+ + SF+ + V K W + +K+ +
Sbjct: 4 RIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIE-------------RWCRRKVFI 50
Query: 74 KTYGSEAALNFANRCISYAIERNVEELEVEHLRRLDTWNSLPQMVLRSKSIKVLTLQNYK 133
+ + R V +E++ +N +P + + +
Sbjct: 51 GNCYAVSPATVIRRF------PKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSS- 103
Query: 134 LESLGNDDVKLLSLRKLHLSDVYADDQVMNNLFAQSPLLQHLEFVRYNNLVN------VS 187
L ++ L + D + + + L +
Sbjct: 104 ----------YTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAA 153
Query: 188 SCKNLKHLDLCD---GSYTDEWLNSQISGLPLLEQLHISLCNN------IESITISSLRL 238
+C+NLK LDL + + WL+ L L+IS + +E + L
Sbjct: 154 TCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNL 213
Query: 239 KKLIINTCESNTIFSFGSIALFSLALRK 266
K L +N ++ + L +
Sbjct: 214 KSLKLNRAVPLE--KLATLLQRAPQLEE 239
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.89 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.83 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.78 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.22 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.19 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.1 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.09 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.07 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.05 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 99.02 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.98 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.94 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.93 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.9 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.88 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.87 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.83 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.82 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.82 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.8 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.79 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.78 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.76 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.75 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.74 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.74 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.73 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.72 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.72 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.71 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.7 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.69 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.65 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.65 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.65 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.65 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.64 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.63 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.62 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.62 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.61 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.6 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.59 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.59 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.59 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.58 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.58 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.58 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.58 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.57 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.57 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.56 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.56 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.55 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.55 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.54 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.54 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.53 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.53 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.52 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.52 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.52 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.5 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.49 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.49 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.49 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.49 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.48 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.48 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.48 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.47 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.46 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.45 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.44 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.44 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.43 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.41 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.41 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.41 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.41 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.4 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.4 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.4 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.39 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.39 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.39 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.37 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.37 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.37 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.36 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.36 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.36 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.35 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.34 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.34 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.32 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.3 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.3 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.3 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.3 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.3 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.3 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.3 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.29 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.28 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.28 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.27 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.26 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.26 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.26 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.25 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.25 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.24 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.23 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.22 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.2 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.2 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.18 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.15 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.14 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.13 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.09 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.09 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 98.06 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.06 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.05 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.05 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.04 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.99 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.96 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.95 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.95 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.94 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.9 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.89 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.89 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.89 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.79 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.79 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.71 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.7 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.7 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.67 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.65 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.63 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.46 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.09 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.08 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.06 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.02 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 96.9 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 96.66 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.59 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 96.53 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.45 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.44 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.25 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 95.69 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 95.49 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 94.93 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 94.52 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 92.59 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 92.27 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 91.76 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 90.77 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 89.4 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 86.24 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Probab=99.89 E-value=4.3e-23 Score=180.65 Aligned_cols=231 Identities=15% Similarity=0.182 Sum_probs=152.7
Q ss_pred CcccCCCCCHHHHHHHHccCChhhHHHhhhhhhhhHhhhcc---CCceEeecCCCCCcchhhhHHHHHHHHHHHh-----
Q 042585 13 NVDRISALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWHT---FPDLEIDKVKFLGPSKKLTVKTYGSEAALNF----- 84 (286)
Q Consensus 13 ~~d~i~~LPdeil~~Ils~L~~~d~~~~~~vskrW~~lw~~---~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~----- 84 (286)
+...|++||||++.+||+||+.+|+++++.|||+|+++... ...+++....+.. ..+.+.....
T Consensus 5 ~~~~~~~LP~eil~~If~~L~~~d~~~~~~vc~~W~~~~~~~~~~~~l~l~~~~~~~--------~~~~~~~~~~l~~L~ 76 (336)
T 2ast_B 5 PGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHP--------DVTGRLLSQGVIAFR 76 (336)
T ss_dssp --CCSSSSCHHHHHHHHTTSCHHHHHHTTSSCHHHHHHHTCSTTSSEEECTTCBCCH--------HHHHHHHHTTCSEEE
T ss_pred ccCChhhCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCchhheeeccccccCCH--------HHHHhhhhccceEEE
Confidence 45568999999999999999999999999999999998543 2234544332221 1121111000
Q ss_pred -----HhH-HHHHHHhCCceEEEEEeccCCCcccCCCcchhccCCccEEEEeceeecc-CCcCcccCCCccEEEcceee-
Q 042585 85 -----ANR-CISYAIERNVEELEVEHLRRLDTWNSLPQMVLRSKSIKVLTLQNYKLES-LGNDDVKLLSLRKLHLSDVY- 156 (286)
Q Consensus 85 -----~~~-~~~~~~~~~l~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~~~~-~~~~~~~~~~L~~L~L~~~~- 156 (286)
+.. +.......++++|+++... .....++..+..+++|++|++++|.+.. .......+++|++|+|++|.
T Consensus 77 l~~n~l~~~~~~~~~~~~L~~L~L~~~~--l~~~~~~~~~~~~~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~L~~~~~ 154 (336)
T 2ast_B 77 CPRSFMDQPLAEHFSPFRVQHMDLSNSV--IEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSG 154 (336)
T ss_dssp CTTCEECSCCCSCCCCBCCCEEECTTCE--ECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBS
T ss_pred cCCccccccchhhccCCCCCEEEccCCC--cCHHHHHHHHhhCCCCCEEeCcCcccCHHHHHHHhcCCCCCEEECCCCCC
Confidence 000 0000001455666665111 0112255566778888888888887632 21234458999999999996
Q ss_pred eChHHHHHHHhcCCCcceEEeeeccccce------eeccc-CCceEEecCc--ccChhhHHHHHhcCCCccEEecccccC
Q 042585 157 ADDQVMNNLFAQSPLLQHLEFVRYNNLVN------VSSCK-NLKHLDLCDG--SYTDEWLNSQISGLPLLEQLHISLCNN 227 (286)
Q Consensus 157 ~~~~~l~~l~~~cp~Le~L~l~~c~~~~~------~~~~~-~L~~L~l~~~--~~~~~~l~~~~~~~p~L~~L~l~~c~~ 227 (286)
+++.++..++..||+|++|++++|....+ +..++ +|++|++.+| .+++..+......+|+|++|++++|..
T Consensus 155 l~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~ 234 (336)
T 2ast_B 155 FSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVM 234 (336)
T ss_dssp CCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTT
T ss_pred CCHHHHHHHHhcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeCCCCCc
Confidence 88888888888899999999998833322 22278 9999999987 567666667777899999999999875
Q ss_pred cccccc----ccccccEEEeecccCCcccc
Q 042585 228 IESITI----SSLRLKKLIINTCESNTIFS 253 (286)
Q Consensus 228 ~~~~~i----~~p~L~~L~ls~c~~~~~~~ 253 (286)
+++..+ ..++|+.|++++|...+...
T Consensus 235 l~~~~~~~l~~l~~L~~L~l~~~~~~~~~~ 264 (336)
T 2ast_B 235 LKNDCFQEFFQLNYLQHLSLSRCYDIIPET 264 (336)
T ss_dssp CCGGGGGGGGGCTTCCEEECTTCTTCCGGG
T ss_pred CCHHHHHHHhCCCCCCEeeCCCCCCCCHHH
Confidence 544322 24889999999987666553
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 286 | ||||
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 6e-05 | |
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 0.001 |
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: F-box/WD repeat-containing protein 7, FBXW7 species: Human (Homo sapiens) [TaxId: 9606]
Score = 39.3 bits (91), Expect = 6e-05
Identities = 12/48 (25%), Positives = 21/48 (43%)
Query: 5 MCRLKKNHNVDRISALPQPILQLIMSFLPFKQVVQICMVSKVWLQAWH 52
M ++ D IS LP+ + ++SFL K ++Q + W
Sbjct: 7 MQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAE 54
|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.69 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.41 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.25 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.92 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.89 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.75 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.71 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.6 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.59 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.56 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.53 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.49 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.48 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.43 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.4 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.38 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.35 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.31 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.3 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.27 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.21 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.17 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.11 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.09 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.06 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.06 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.89 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 97.81 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.79 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.79 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.69 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.67 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.64 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.63 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.55 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 97.43 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.4 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.29 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.07 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 96.89 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 96.78 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.7 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.56 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.26 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.19 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 94.86 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.69 E-value=8.7e-18 Score=141.93 Aligned_cols=161 Identities=16% Similarity=0.203 Sum_probs=127.4
Q ss_pred CCceEEEEEeccCCCcccCCCcchhccCCccEEEEeceeecc-CCcCcccCCCccEEEcceee-eChHHHHHHHhcCCCc
Q 042585 95 RNVEELEVEHLRRLDTWNSLPQMVLRSKSIKVLTLQNYKLES-LGNDDVKLLSLRKLHLSDVY-ADDQVMNNLFAQSPLL 172 (286)
Q Consensus 95 ~~l~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~~~~-~~~~~~~~~~L~~L~L~~~~-~~~~~l~~l~~~cp~L 172 (286)
.+++++++++.. .....++..+..|++|++|+|++|.+.. .......+++|++|+|++|. +++.++..++.+||+|
T Consensus 46 ~~L~~LdLs~~~--i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L 123 (284)
T d2astb2 46 FRVQHMDLSNSV--IEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRL 123 (284)
T ss_dssp BCCCEEECTTCE--ECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHHHHHCTTC
T ss_pred CCCCEEECCCCc--cCHHHHHHHHHhCCCcccccccccCCCcHHHHHHhcCCCCcCccccccccccccccchhhHHHHhc
Confidence 467888887221 1233344556789999999999998733 22334568999999999998 9999999999999999
Q ss_pred ceEEeeeccccce------eec-ccCCceEEecCc--ccChhhHHHHHhcCCCccEEecccccCccccccc----ccccc
Q 042585 173 QHLEFVRYNNLVN------VSS-CKNLKHLDLCDG--SYTDEWLNSQISGLPLLEQLHISLCNNIESITIS----SLRLK 239 (286)
Q Consensus 173 e~L~l~~c~~~~~------~~~-~~~L~~L~l~~~--~~~~~~l~~~~~~~p~L~~L~l~~c~~~~~~~i~----~p~L~ 239 (286)
++|++++|....+ +.. +++|++|++.++ .+++.++..+..+||+|++|++++|..+++..+. .|+|+
T Consensus 124 ~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~~~~L~ 203 (284)
T d2astb2 124 DELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQ 203 (284)
T ss_dssp CEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCTTCC
T ss_pred cccccccccccccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhcccCcCC
Confidence 9999999976522 111 689999999976 4778888888899999999999999888766544 48999
Q ss_pred EEEeecccCCcccccccc
Q 042585 240 KLIINTCESNTIFSFGSI 257 (286)
Q Consensus 240 ~L~ls~c~~~~~~~~~~~ 257 (286)
+|++++|..+++.++..+
T Consensus 204 ~L~L~~C~~i~~~~l~~L 221 (284)
T d2astb2 204 HLSLSRCYDIIPETLLEL 221 (284)
T ss_dssp EEECTTCTTCCGGGGGGG
T ss_pred EEECCCCCCCChHHHHHH
Confidence 999999999988766554
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|