Citrus Sinensis ID: 042599
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| 56605372 | 364 | caffeate O-methyltransferase [Picea abie | 0.822 | 0.483 | 0.364 | 6e-37 | |
| 29839361 | 350 | RecName: Full=Caffeic acid 3-O-methyltra | 0.831 | 0.508 | 0.358 | 8e-37 | |
| 116782394 | 364 | unknown [Picea sitchensis] | 0.822 | 0.483 | 0.364 | 9e-37 | |
| 22652500 | 350 | caffeic acid O-methyltransferase [Coffea | 0.831 | 0.508 | 0.354 | 2e-36 | |
| 116779753 | 365 | unknown [Picea sitchensis] | 0.822 | 0.482 | 0.357 | 3e-36 | |
| 346644467 | 364 | caffeic acid O-3-methyltransferase [Pinu | 0.822 | 0.483 | 0.353 | 1e-35 | |
| 148910620 | 365 | unknown [Picea sitchensis] | 0.822 | 0.482 | 0.355 | 2e-35 | |
| 312283309 | 364 | unnamed protein product [Thellungiella h | 0.836 | 0.491 | 0.346 | 5e-35 | |
| 225453640 | 359 | PREDICTED: quercetin 3-O-methyltransfera | 0.813 | 0.484 | 0.347 | 8e-35 | |
| 29839288 | 365 | RecName: Full=Caffeic acid 3-O-methyltra | 0.915 | 0.536 | 0.367 | 3e-34 |
| >gi|56605372|emb|CAI30878.1| caffeate O-methyltransferase [Picea abies] gi|116785470|gb|ABK23738.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
Score = 159 bits (403), Expect = 6e-37, Method: Compositional matrix adjust.
Identities = 102/280 (36%), Positives = 133/280 (47%), Gaps = 104/280 (37%)
Query: 3 LPMTMKTAIQLGVLEIM-----------------LPKNNKETPIILDRMLRLLASYSFLT 45
LPM MK AI+L VL+I+ +P N + I LDR+LR+LAS+S L+
Sbjct: 32 LPMGMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRVLASHSVLS 91
Query: 46 CNLATNIKDGSAQRLYGLASVSRYFFPNEDGVSLAPTLLIIQDKVNMDSWACKYTQHSYL 105
C++ T+ ++G A+RLYGL + +Y N+DGVSLAP +L+ QDKV MDSW
Sbjct: 92 CSVTTD-ENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMDSW---------- 140
Query: 106 CMKDALLEGFINTLNRYYLKNALLEGSVPHTKAQSGMDAFAAAAKDARMNNLFNQSMHNH 165
YYLK+A+LEGS P TKA GM+AF AKD R N +FN+ M H
Sbjct: 141 ----------------YYLKDAVLEGSQPFTKAH-GMNAFEYPAKDQRFNRVFNRGMSEH 183
Query: 166 TVV------------------------------------EHVSG---------------- 173
+ + H+SG
Sbjct: 184 STMLMNKILDTYQGFKEVQELVDVGGGVGSTLNLIVSRYPHISGINFDMPHVVTDAPHYP 243
Query: 174 -------HMFIEVPNGQALFMKWILSDWDDEECLKILKNC 206
MF VP GQA+FMKWIL DW D+ C K+LKNC
Sbjct: 244 AVKHVGGDMFDSVPTGQAIFMKWILHDWSDDHCRKLLKNC 283
|
Source: Picea abies Species: Picea abies Genus: Picea Family: Pinaceae Order: Coniferales Class: Coniferopsida Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|29839361|sp|Q8LL87.1|COMT1_COFCA RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic acid 3-O-methyltransferase gi|22652502|gb|AAN03727.1| caffeic acid O-methyltransferase [Coffea canephora] | Back alignment and taxonomy information |
|---|
| >gi|116782394|gb|ABK22490.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|22652500|gb|AAN03726.1| caffeic acid O-methyltransferase [Coffea canephora] | Back alignment and taxonomy information |
|---|
| >gi|116779753|gb|ABK21417.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|346644467|emb|CCC55423.1| caffeic acid O-3-methyltransferase [Pinus pinaster] | Back alignment and taxonomy information |
|---|
| >gi|148910620|gb|ABR18380.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|312283309|dbj|BAJ34520.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|225453640|ref|XP_002267179.1| PREDICTED: quercetin 3-O-methyltransferase 1 isoform 1 [Vitis vinifera] gi|147785074|emb|CAN75449.1| hypothetical protein VITISV_028011 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|29839288|sp|Q43046.1|COMT1_POPKI RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic acid 3-O-methyltransferase 1 gi|762870|dbj|BAA08558.1| caffeic acid O-methyltransferase [Populus kitakamiensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| TAIR|locus:2153423 | 363 | OMT1 "AT5G54160" [Arabidopsis | 0.574 | 0.338 | 0.433 | 1.4e-34 | |
| UNIPROTKB|Q6ZD89 | 368 | ROMT-9 "Flavone 3'-O-methyltra | 0.434 | 0.252 | 0.457 | 1.1e-30 | |
| TAIR|locus:2015223 | 381 | AT1G63140 [Arabidopsis thalian | 0.177 | 0.099 | 0.736 | 3.4e-30 | |
| TAIR|locus:2204695 | 381 | AT1G77530 [Arabidopsis thalian | 0.182 | 0.102 | 0.769 | 2.4e-29 | |
| UNIPROTKB|Q84N28 | 360 | OMT1 "Flavone O-methyltransfer | 0.574 | 0.341 | 0.407 | 4.1e-29 | |
| TAIR|locus:2204680 | 381 | AT1G77520 [Arabidopsis thalian | 0.182 | 0.102 | 0.769 | 9.5e-29 | |
| TAIR|locus:2038026 | 352 | AT1G33030 [Arabidopsis thalian | 0.5 | 0.303 | 0.398 | 4.3e-27 | |
| TAIR|locus:2034016 | 363 | AT1G51990 [Arabidopsis thalian | 0.182 | 0.107 | 0.615 | 1.8e-26 | |
| TAIR|locus:2030081 | 367 | IGMT5 "indole glucosinolate O- | 0.182 | 0.106 | 0.641 | 2.5e-26 | |
| UNIPROTKB|A8QW52 | 376 | EOMT "Eugenol O-methyltransfer | 0.182 | 0.103 | 0.615 | 4.3e-26 |
| TAIR|locus:2153423 OMT1 "AT5G54160" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 231 (86.4 bits), Expect = 1.4e-34, Sum P(2) = 1.4e-34
Identities = 65/150 (43%), Positives = 87/150 (58%)
Query: 1 AVLPMTMKTAIQLGVLEIM---------------LPKNNKETPIILDRMLRLLASYSFLT 45
+VLPM +K+A++L +LEIM LP N E P++LDR+LRLL SYS LT
Sbjct: 30 SVLPMALKSALELDLLEIMAKNGSPMSPTEIASKLPTKNPEAPVMLDRILRLLTSYSVLT 89
Query: 46 CNLATNIKDGSAQRLYGLASVSRYFFPNEDGVSLAPTLLIIQDKVNMDSWACKYTQHSYL 105
C+ DG +R+YGL V +Y NEDGVS+A L+ QDKV M+SW Y H
Sbjct: 90 CSNRKLSGDG-VERIYGLGPVCKYLTKNEDGVSIAALCLMNQDKVLMESW---Y--H--- 140
Query: 106 CMKDALLEGFINTLNRYYLKNAL-LEGSVP 134
+KDA+L+G I N+ Y +A G+ P
Sbjct: 141 -LKDAILDGGI-PFNKAYGMSAFEYHGTDP 168
|
|
| UNIPROTKB|Q6ZD89 ROMT-9 "Flavone 3'-O-methyltransferase 1" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2015223 AT1G63140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2204695 AT1G77530 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q84N28 OMT1 "Flavone O-methyltransferase 1" [Triticum aestivum (taxid:4565)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2204680 AT1G77520 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2038026 AT1G33030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034016 AT1G51990 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2030081 IGMT5 "indole glucosinolate O-methyltransferase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8QW52 EOMT "Eugenol O-methyltransferase" [Sorghum bicolor (taxid:4558)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| pfam00891 | 239 | pfam00891, Methyltransf_2, O-methyltransferase | 3e-24 | |
| pfam08100 | 50 | pfam08100, Dimerisation, Dimerisation domain | 1e-07 |
| >gnl|CDD|216177 pfam00891, Methyltransf_2, O-methyltransferase | Back alignment and domain information |
|---|
Score = 95.8 bits (239), Expect = 3e-24
Identities = 49/208 (23%), Positives = 67/208 (32%), Gaps = 86/208 (41%)
Query: 58 QRLYGLASVSRYFFPNEDGVSLAPTLLIIQDKVNMDSWACKYTQHSYLCMKDALLEGFIN 117
YGL S+ ED SLAP LL+ D ++SW
Sbjct: 4 GEDYGLTPASKLLVKGEDSPSLAPLLLMYADPTLLESW---------------------- 41
Query: 118 TLNRYYLKNALLEGSVPHTKAQSGMDAFAAAAKDARMNNLFNQSMHNHT----------- 166
+LK+A+ EG P +A GM F D N +FN++M H+
Sbjct: 42 ----AHLKDAVREGGPPFERAF-GMPFFEYLGADPEFNRVFNRAMAAHSRLVMKKILETA 96
Query: 167 ---------------------------------------VVEHVSGH---------MFIE 178
V+ F
Sbjct: 97 FDFSGLSSLVDVGGGTGALAAAIVRAYPHIKGIVFDLPHVIADAPSADRVEFVGGDFFES 156
Query: 179 VPNGQALFMKWILSDWDDEECLKILKNC 206
VP A+ +KW+L DW DE+C+KILK C
Sbjct: 157 VPEADAILLKWVLHDWSDEDCVKILKRC 184
|
This family includes a range of O-methyltransferases. These enzymes utilise S-adenosyl methionine. Length = 239 |
| >gnl|CDD|219719 pfam08100, Dimerisation, Dimerisation domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| KOG3178 | 342 | consensus Hydroxyindole-O-methyltransferase and re | 99.98 | |
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 99.96 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 99.94 | |
| PF08100 | 51 | Dimerisation: Dimerisation domain; InterPro: IPR01 | 98.28 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 97.85 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 97.62 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 97.47 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 97.45 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 97.34 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 97.12 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 97.01 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 96.91 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 96.85 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 96.85 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 96.7 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 96.67 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 96.64 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 96.57 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 96.55 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 96.31 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 96.28 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 96.27 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 96.26 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 96.22 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 96.05 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 95.97 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 95.94 | |
| PF01739 | 196 | CheR: CheR methyltransferase, SAM binding domain; | 95.93 | |
| PRK10611 | 287 | chemotaxis methyltransferase CheR; Provisional | 95.75 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 95.6 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 95.57 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 95.54 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 95.46 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 95.34 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 95.28 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 95.21 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 95.09 | |
| PLN02232 | 160 | ubiquinone biosynthesis methyltransferase | 94.97 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 94.86 | |
| KOG1540 | 296 | consensus Ubiquinone biosynthesis methyltransferas | 94.8 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 94.64 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 94.54 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 94.43 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 94.29 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 94.05 | |
| PF08123 | 205 | DOT1: Histone methylation protein DOT1 ; InterPro: | 94.04 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 94.01 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 93.87 | |
| PF14947 | 77 | HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_ | 93.67 | |
| PF09339 | 52 | HTH_IclR: IclR helix-turn-helix domain; InterPro: | 93.08 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 93.06 | |
| PF05891 | 218 | Methyltransf_PK: AdoMet dependent proline di-methy | 93.05 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 92.93 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 92.47 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 92.32 | |
| COG1352 | 268 | CheR Methylase of chemotaxis methyl-accepting prot | 92.23 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 92.21 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 92.14 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 92.02 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 91.92 | |
| PLN02366 | 308 | spermidine synthase | 91.76 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 91.7 | |
| COG1414 | 246 | IclR Transcriptional regulator [Transcription] | 91.61 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 91.44 | |
| smart00346 | 91 | HTH_ICLR helix_turn_helix isocitrate lyase regulat | 91.21 | |
| TIGR02431 | 248 | pcaR_pcaU beta-ketoadipate pathway transcriptional | 90.73 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 90.71 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 90.37 | |
| smart00419 | 48 | HTH_CRP helix_turn_helix, cAMP Regulatory protein. | 90.32 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 90.29 | |
| cd00092 | 67 | HTH_CRP helix_turn_helix, cAMP Regulatory protein | 90.0 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 89.93 | |
| PRK10163 | 271 | DNA-binding transcriptional repressor AllR; Provis | 89.82 | |
| PRK15090 | 257 | DNA-binding transcriptional regulator KdgR; Provis | 89.79 | |
| PF04672 | 267 | Methyltransf_19: S-adenosyl methyltransferase; Int | 89.79 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 89.47 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 89.34 | |
| PRK11569 | 274 | transcriptional repressor IclR; Provisional | 89.12 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 89.09 | |
| PF12147 | 311 | Methyltransf_20: Putative methyltransferase; Inter | 89.08 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 89.08 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 88.77 | |
| PRK09834 | 263 | DNA-binding transcriptional activator MhpR; Provis | 88.38 | |
| PRK13256 | 226 | thiopurine S-methyltransferase; Reviewed | 87.78 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 87.68 | |
| PF03291 | 331 | Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 | 87.07 | |
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 87.06 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 85.88 | |
| PF13463 | 68 | HTH_27: Winged helix DNA-binding domain; PDB: 3GFL | 85.76 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 85.75 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 85.63 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 85.52 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 85.41 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 85.09 | |
| smart00529 | 96 | HTH_DTXR Helix-turn-helix diphteria tox regulatory | 85.01 | |
| PF06080 | 204 | DUF938: Protein of unknown function (DUF938); Inte | 84.81 | |
| PF01978 | 68 | TrmB: Sugar-specific transcriptional regulator Trm | 84.69 | |
| PF02082 | 83 | Rrf2: Transcriptional regulator; InterPro: IPR0009 | 84.6 | |
| COG3315 | 297 | O-Methyltransferase involved in polyketide biosynt | 83.82 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 83.57 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 82.92 | |
| smart00550 | 68 | Zalpha Z-DNA-binding domain in adenosine deaminase | 82.57 | |
| PF14394 | 171 | DUF4423: Domain of unknown function (DUF4423) | 82.35 | |
| PF13601 | 80 | HTH_34: Winged helix DNA-binding domain; PDB: 1UB9 | 82.14 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 81.61 | |
| COG3432 | 95 | Predicted transcriptional regulator [Transcription | 80.69 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 80.68 | |
| KOG1975 | 389 | consensus mRNA cap methyltransferase [RNA processi | 80.57 | |
| TIGR03439 | 319 | methyl_EasF probable methyltransferase domain, Eas | 80.47 | |
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 80.16 |
| >KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.98 E-value=8.3e-32 Score=225.53 Aligned_cols=205 Identities=36% Similarity=0.648 Sum_probs=159.6
Q ss_pred hhhHHHHHHHHhCchhHH-----------cCC--CCCCChhhHHHHHHHHhcCcceeeecccccCCCccccceecchhcc
Q 042599 2 VLPMTMKTAIQLGVLEIM-----------LPK--NNKETPIILDRMLRLLASYSFLTCNLATNIKDGSAQRLYGLASVSR 68 (214)
Q Consensus 2 ~~~~~L~~a~~lgifd~L-----------LA~--~~~~~~~~l~rlLr~L~~~gl~~~~~~~~~~~g~~~~~y~~t~~s~ 68 (214)
..+++|++|+||||||+| ++. +.+.++..+.|+||.|++.+++++... + .. .|+++|+++
T Consensus 18 ~~~~~lk~A~eL~v~d~l~~~~~p~~ia~~l~~~~~~~~p~ll~r~lr~L~s~~i~k~~~~-----~-~~-~Y~~~~~~~ 90 (342)
T KOG3178|consen 18 ALPMVLKAACELGVFDILANAGSPSEIASLLPTPKNPEAPVLLDRILRLLVSYSILKCRLV-----G-GE-VYSATPVCK 90 (342)
T ss_pred hhHHHHHHHHHcChHHHHHhCCCHHHHHHhccCCCCCCChhHHHHHHHHHHHhhhceeeee-----c-ce-eeeccchhh
Confidence 468999999999999999 223 556899999999999999999998631 1 13 899999999
Q ss_pred ccCCCCCCCchhhHHhhhhchhhhhhhc--------------c--cCCcchhhhcchhhHhhHHhhhhhcc--HHHHHh-
Q 042599 69 YFFPNEDGVSLAPTLLIIQDKVNMDSWA--------------C--KYTQHSYLCMKDALLEGFINTLNRYY--LKNALL- 129 (214)
Q Consensus 69 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~--------------~--~~~~~~~~~~~p~~~~~f~~~m~~~~--~~~~~~- 129 (214)
.+..++.+.|+++++....++.....|. + +...|+|...++...+.|+++|.+.. +...+.
T Consensus 91 ~~l~~~~~~S~a~~~~~~~~~v~~~~w~~l~dai~eg~~~~~~~~G~~l~~~~~~~~~~~~~~~~sm~~l~~~~~~~il~ 170 (342)
T KOG3178|consen 91 YFLKDSGGGSLAPLVLLNTSKVIMNTWQFLKDAILEGGDAFATAHGMMLGGYGGADERFSKDFNGSMSFLSTLVMKKILE 170 (342)
T ss_pred hheecCCCCchhHHHHHhcccchhhhHHHHHHHHHhcccCCccccchhhhhhcccccccHHHHHHHHHHHHHHHHHhhhh
Confidence 8875554568888887655555554442 1 23578888888888888999986511 111121
Q ss_pred --cC---CCceEEccC--CccHHHHHHhCCC-------chHHHHhhccCCCceEEecCCCCcccCccceeeeehhccCCC
Q 042599 130 --EG---SVPHTKAQS--GMDAFAAAAKDAR-------MNNLFNQSMHNHTVVEHVSGHMFIEVPNGQALFMKWILSDWD 195 (214)
Q Consensus 130 --~g---~~~~~dvgG--G~~~~~~~~~~P~-------l~~v~~~~~~~~~rv~~~~gDff~~~P~~d~y~l~~ILHdw~ 195 (214)
+| ....+|+|| |...-.++.++|. ++.++..+....+.|+++.||||...|+||+|+|+||||||+
T Consensus 171 ~~~Gf~~v~~avDvGgGiG~v~k~ll~~fp~ik~infdlp~v~~~a~~~~~gV~~v~gdmfq~~P~~daI~mkWiLhdwt 250 (342)
T KOG3178|consen 171 VYTGFKGVNVAVDVGGGIGRVLKNLLSKYPHIKGINFDLPFVLAAAPYLAPGVEHVAGDMFQDTPKGDAIWMKWILHDWT 250 (342)
T ss_pred hhcccccCceEEEcCCcHhHHHHHHHHhCCCCceeecCHHHHHhhhhhhcCCcceecccccccCCCcCeEEEEeecccCC
Confidence 23 456899998 6677777778874 467777666542679999999997799999999999999999
Q ss_pred hHHHHHHHHHhHHhcCCC
Q 042599 196 DEECLKILKNCCVQCNTG 213 (214)
Q Consensus 196 d~~~~~IL~~~~~Al~pg 213 (214)
|++|++||+||+++|+||
T Consensus 251 DedcvkiLknC~~sL~~~ 268 (342)
T KOG3178|consen 251 DEDCVKILKNCKKSLPPG 268 (342)
T ss_pred hHHHHHHHHHHHHhCCCC
Confidence 999999999999999997
|
|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >PF08100 Dimerisation: Dimerisation domain; InterPro: IPR012967 This domain is found at the N terminus of a variety of plant O-methyltransferases | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK10611 chemotaxis methyltransferase CheR; Provisional | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02232 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PF14947 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_A | Back alignment and domain information |
|---|
| >PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG1414 IclR Transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation | Back alignment and domain information |
|---|
| >TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >PRK10163 DNA-binding transcriptional repressor AllR; Provisional | Back alignment and domain information |
|---|
| >PRK15090 DNA-binding transcriptional regulator KdgR; Provisional | Back alignment and domain information |
|---|
| >PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11569 transcriptional repressor IclR; Provisional | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PRK09834 DNA-binding transcriptional activator MhpR; Provisional | Back alignment and domain information |
|---|
| >PRK13256 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element | Back alignment and domain information |
|---|
| >PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis | Back alignment and domain information |
|---|
| >PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp | Back alignment and domain information |
|---|
| >COG3315 O-Methyltransferase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases | Back alignment and domain information |
|---|
| >PF14394 DUF4423: Domain of unknown function (DUF4423) | Back alignment and domain information |
|---|
| >PF13601 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9_A | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >COG3432 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03439 methyl_EasF probable methyltransferase domain, EasF family | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 214 | ||||
| 3reo_A | 368 | Monolignol O-Methyltransferase (Momt) Length = 368 | 9e-34 | ||
| 1kyw_A | 365 | Crystal Structure Analysis Of Caffeic Acid5-Hydroxy | 3e-30 | ||
| 3p9c_A | 364 | Crystal Structure Of Perennial Ryegrass Lpomt1 Boun | 9e-30 | ||
| 1fp1_D | 372 | Crystal Structure Analysis Of Chalcone O-Methyltran | 9e-11 | ||
| 1fp1_D | 372 | Crystal Structure Analysis Of Chalcone O-Methyltran | 5e-07 | ||
| 1zg3_A | 358 | Crystal Structure Of The Isoflavanone 4'-O-Methyltr | 1e-06 | ||
| 1zga_A | 357 | Crystal Structure Of Isoflavanone 4'-o-methyltransf | 1e-06 | ||
| 1zgj_A | 354 | Crystal Structure Of Isoflavanone 4'-O-Methyltransf | 1e-06 | ||
| 2qyo_A | 357 | Crystal Structure Of Isoflavone O-Methyltransferase | 1e-06 | ||
| 1fp2_A | 352 | Crystal Structure Analysis Of Isoflavone O-Methyltr | 1e-06 | ||
| 1fpq_A | 372 | Crystal Structure Analysis Of Selenomethionine Subs | 5e-06 | ||
| 1fpx_A | 352 | Crystal Structure Analysis Of Selenomethionine Subs | 7e-06 |
| >pdb|3REO|A Chain A, Monolignol O-Methyltransferase (Momt) Length = 368 | Back alignment and structure |
|
| >pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde Length = 365 | Back alignment and structure |
| >pdb|3P9C|A Chain A, Crystal Structure Of Perennial Ryegrass Lpomt1 Bound To Sah Length = 364 | Back alignment and structure |
| >pdb|1FP1|D Chain D, Crystal Structure Analysis Of Chalcone O-Methyltransferase Length = 372 | Back alignment and structure |
| >pdb|1FP1|D Chain D, Crystal Structure Analysis Of Chalcone O-Methyltransferase Length = 372 | Back alignment and structure |
| >pdb|1ZG3|A Chain A, Crystal Structure Of The Isoflavanone 4'-O-Methyltransferase Complexed With Sah And 2,7,4'-Trihydroxyisoflavanone Length = 358 | Back alignment and structure |
| >pdb|1ZGA|A Chain A, Crystal Structure Of Isoflavanone 4'-o-methyltransferase Complexed With (+)-6a-hydroxymaackiain Length = 357 | Back alignment and structure |
| >pdb|1ZGJ|A Chain A, Crystal Structure Of Isoflavanone 4'-O-Methyltransferase Complexed With (+)-Pisatin Length = 354 | Back alignment and structure |
| >pdb|2QYO|A Chain A, Crystal Structure Of Isoflavone O-Methyltransferase Homolog In Complex With Biochanin A And Sah Length = 357 | Back alignment and structure |
| >pdb|1FP2|A Chain A, Crystal Structure Analysis Of Isoflavone O-Methyltransferase Length = 352 | Back alignment and structure |
| >pdb|1FPQ|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Chalcone O- Methyltransferase Length = 372 | Back alignment and structure |
| >pdb|1FPX|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Isoflavone O-Methyltransferase Length = 352 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 1e-32 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 2e-30 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 3e-28 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 9e-16 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 1e-25 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 9e-16 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 5e-25 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 1e-15 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 2e-20 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 2e-19 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 4e-16 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 3e-19 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 1e-14 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 1e-18 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 3e-14 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 2e-18 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 1e-14 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 9e-18 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 2e-14 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 5e-17 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 7e-15 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 1e-12 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 4e-08 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 4e-12 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 2e-08 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 3e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 |
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Length = 352 | Back alignment and structure |
|---|
Score = 119 bits (301), Expect = 1e-32
Identities = 48/278 (17%), Positives = 82/278 (29%), Gaps = 107/278 (38%)
Query: 2 VLPMTMKTAIQLGVLEIMLP--------------KNNKETPIILDRMLRLLASYSFLTCN 47
+ M++K A+++ + I+ + + R++R LA F
Sbjct: 28 IDSMSLKWAVEMNIPNIIQNHGKPISLSNLVSILQVPSSKIGNVRRLMRYLAHNGFFEI- 86
Query: 48 LATNIKDGSAQRLYGLASVSRYFFPNEDGVSLAPTLLIIQDKVNMDSWACKYTQHSYLCM 107
+ Y L S D LAP + + D S+
Sbjct: 87 ------ITKEEESYALTVASELLVRGSDL-CLAPMVECVLDPTLSGSY------------ 127
Query: 108 KDALLEGFINTLNRYYLKNALLEGSVPHTKAQSGMDAFAAAAKDARMNNLFNQSMHNHT- 166
+ LK + E + G + K+ N FN +M + +
Sbjct: 128 --------------HELKKWIYEEDLTLFGVTLGSGFWDFLDKNPEYNTSFNDAMASDSK 173
Query: 167 -------------------------------------------------VVEHVSGH--- 174
VVE++SG
Sbjct: 174 LINLALRDCDFVFDGLESIVDVGGGTGTTAKIICETFPKLKCIVFDRPQVVENLSGSNNL 233
Query: 175 ------MFIEVPNGQALFMKWILSDWDDEECLKILKNC 206
MF +PN A+ +K+IL +W D++CL+ILK C
Sbjct: 234 TYVGGDMFTSIPNADAVLLKYILHNWTDKDCLRILKKC 271
|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Length = 358 | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 1kyz_A* 1kyw_A* Length = 368 | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 1kyz_A* 1kyw_A* Length = 368 | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Length = 335 | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Length = 348 | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Length = 348 | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Length = 369 | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Length = 369 | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Length = 374 | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Length = 374 | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Length = 360 | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Length = 360 | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Length = 334 | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Length = 334 | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Length = 332 | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Length = 332 | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Length = 352 | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Length = 363 | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Length = 363 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 100.0 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 100.0 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 99.97 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 99.97 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 99.97 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 99.96 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 99.96 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 99.96 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 99.95 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 99.95 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 99.95 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 99.93 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 99.93 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 99.93 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 99.93 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 99.93 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 98.26 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 98.0 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 97.79 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 97.79 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 97.75 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 97.68 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 97.67 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 97.66 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 97.4 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 97.38 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 97.34 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 97.31 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 97.3 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 97.29 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 97.26 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 97.23 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 97.23 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 97.19 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 97.17 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 97.15 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 97.09 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 96.98 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 96.94 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 96.92 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 96.89 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 96.85 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 96.85 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 96.85 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 96.84 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 96.82 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 96.75 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 96.72 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 96.71 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 96.7 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 96.63 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 96.59 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 96.59 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 96.56 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 96.46 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 96.45 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 96.45 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 96.44 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 96.43 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 96.4 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 96.39 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 96.38 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 96.32 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 96.29 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 96.25 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 96.24 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 96.24 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 96.23 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 96.23 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 96.2 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 96.12 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 96.11 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 96.11 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 96.08 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 96.0 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 95.95 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 95.92 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 95.9 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 95.85 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 95.81 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 95.71 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 95.7 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 95.6 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 95.53 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 95.36 | |
| 3giw_A | 277 | Protein of unknown function DUF574; rossmann-fold | 95.35 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 95.24 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 95.24 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 95.01 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 94.94 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 94.91 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 94.9 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 94.82 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 94.8 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 94.78 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 94.48 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 94.36 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 94.36 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 94.34 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 94.29 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 94.08 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 94.06 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 94.04 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 94.01 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 93.93 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 93.77 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 93.75 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 93.73 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 93.66 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 93.65 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 93.6 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 92.91 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 92.74 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 92.73 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 92.63 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 92.54 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 92.45 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 92.19 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 92.19 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 91.94 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 91.64 | |
| 1r7j_A | 95 | Conserved hypothetical protein SSO10A; winged heli | 91.15 | |
| 3b73_A | 111 | PHIH1 repressor-like protein; winged-helix-turn-he | 91.12 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 91.09 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 91.01 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 90.89 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 90.48 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 90.14 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 89.89 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 89.87 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 89.82 | |
| 3mq0_A | 275 | Transcriptional repressor of the blcabc operon; he | 89.61 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 89.58 | |
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 89.57 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 89.56 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 89.41 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 89.31 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 89.12 | |
| 1y0u_A | 96 | Arsenical resistance operon repressor, putative; s | 89.1 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 89.09 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 88.9 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 88.85 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 88.82 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 88.67 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 88.46 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 88.4 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 88.28 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 88.26 | |
| 3r4k_A | 260 | Transcriptional regulator, ICLR family; DNA/RNA-bi | 88.2 | |
| 2xrn_A | 241 | HTH-type transcriptional regulator TTGV; DNA-bindi | 88.13 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 87.9 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 87.81 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 87.8 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 87.79 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 87.74 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 87.71 | |
| 1tbx_A | 99 | ORF F-93, hypothetical 11.0 kDa protein; sulfolobu | 87.64 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 87.57 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 87.57 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 87.56 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 87.55 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 87.45 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 87.44 | |
| 1ub9_A | 100 | Hypothetical protein PH1061; helix-turn-helix moti | 87.24 | |
| 2ld4_A | 176 | Anamorsin; methyltransferase-like fold, alpha/beta | 87.17 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 86.75 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 86.75 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 86.56 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 86.55 | |
| 3f6o_A | 118 | Probable transcriptional regulator, ARSR family pr | 86.33 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 86.24 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 86.13 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 86.13 | |
| 2g7u_A | 257 | Transcriptional regulator; ICLR family, structural | 86.11 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 85.99 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 85.59 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 85.56 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 85.53 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 85.53 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 85.44 | |
| 2uyo_A | 310 | Hypothetical protein ML2640; putative methyltransf | 85.44 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 85.39 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 85.35 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 85.33 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 85.0 | |
| 2vn2_A | 128 | DNAD, chromosome replication initiation protein; D | 84.97 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 84.93 | |
| 2ia2_A | 265 | Putative transcriptional regulator; SAD, PSI-2, st | 84.92 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 84.48 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 84.32 | |
| 3df8_A | 111 | Possible HXLR family transcriptional factor; APC89 | 84.13 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 84.1 | |
| 4a5n_A | 131 | Uncharacterized HTH-type transcriptional regulato; | 83.87 | |
| 3cuo_A | 99 | Uncharacterized HTH-type transcriptional regulato; | 83.87 | |
| 2v79_A | 135 | DNA replication protein DNAD; primosome, DNA-bindi | 83.42 | |
| 1mkm_A | 249 | ICLR transcriptional regulator; structural genomic | 83.32 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 83.17 | |
| 2oqg_A | 114 | Possible transcriptional regulator, ARSR family P; | 82.97 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 82.93 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 82.52 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 82.45 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 82.43 | |
| 3f6v_A | 151 | Possible transcriptional regulator, ARSR family pr | 82.35 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 82.34 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 82.31 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 82.26 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 82.25 | |
| 3jth_A | 98 | Transcription activator HLYU; transcription factor | 82.25 | |
| 1u2w_A | 122 | CADC repressor, cadmium efflux system accessory pr | 82.12 | |
| 2hzt_A | 107 | Putative HTH-type transcriptional regulator YTCD; | 81.93 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 81.04 | |
| 1xmk_A | 79 | Double-stranded RNA-specific adenosine deaminase; | 80.82 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 80.76 | |
| 2o0y_A | 260 | Transcriptional regulator; ICLR-family, structural | 80.53 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 80.18 |
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-35 Score=254.39 Aligned_cols=205 Identities=13% Similarity=0.244 Sum_probs=158.8
Q ss_pred hhhHHHHHHHHhCchhHH-----------cCCCCCCChhhHHHHHHHHhcCcceeeecccccCCCccccceecchhcccc
Q 042599 2 VLPMTMKTAIQLGVLEIM-----------LPKNNKETPIILDRMLRLLASYSFLTCNLATNIKDGSAQRLYGLASVSRYF 70 (214)
Q Consensus 2 ~~~~~L~~a~~lgifd~L-----------LA~~~~~~~~~l~rlLr~L~~~gl~~~~~~~~~~~g~~~~~y~~t~~s~~l 70 (214)
+.+++|++|++|||||+| ||+++|++++.++|+||+|++.|+|++..+. .+++|++|++|+.+
T Consensus 20 ~~s~~L~aa~eLglfd~L~~~~~p~t~~eLA~~~g~~~~~l~rlLr~L~~~gll~~~~~~------~~~~y~~t~~s~~~ 93 (353)
T 4a6d_A 20 MVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRG------GKAFYRNTELSSDY 93 (353)
T ss_dssp HHHHHHHHHHHHTHHHHHHHSSSCBCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEEEET------TEEEEEECHHHHHH
T ss_pred HHHHHHHHHHHcCHHHHHhcCCCCCCHHHHHHhhCcCHHHHHHHHHHHHHCCCEEEeccC------ccceeeCCHHHHHH
Confidence 678999999999999999 8899999999999999999999999875321 15789999999864
Q ss_pred -CCCCCCCchhhHHhhhhch-----------------hhhhhhc-ccCCcchhhhcchhhHhhHHhhhhhcc--HHHHHh
Q 042599 71 -FPNEDGVSLAPTLLIIQDK-----------------VNMDSWA-CKYTQHSYLCMKDALLEGFINTLNRYY--LKNALL 129 (214)
Q Consensus 71 -~~~~~~~~~~~~~~~~~~~-----------------~~~~~~~-~~~~~~~~~~~~p~~~~~f~~~m~~~~--~~~~~~ 129 (214)
..+++ .++++++.+.... .+...++ +..++|+++.++|+..+.|+.+|.... ....+.
T Consensus 94 l~~~~~-~~~~~~~~~~~~~~~~~~~~L~~~vr~g~~~~~~~~g~~~~~~~~~~~~~~~~~~~f~~aM~~~~~~~~~~~~ 172 (353)
T 4a6d_A 94 LTTVSP-TSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVL 172 (353)
T ss_dssp HSTTST-TCCHHHHHHHHHTHHHHHTTHHHHHHHTSCCHHHHHSCCCSSHHHHHTSSHHHHHHHHHHHHTTHHHHHHHHH
T ss_pred hhcCCc-hHHHHHHHHhCHHHHHHHHHHHHHHhcCCChhHHhcCCChHHHHHHHhhCHHHHHHHHHHHHHHHHHHHHHHH
Confidence 55554 5666665542211 1122222 234689999999999999999996521 112222
Q ss_pred -----cCCCceEEccC--CccHHHHHHhCCCc-------hHHHHhhcc-----CCCceEEecCCCCcc-cCccceeeeeh
Q 042599 130 -----EGSVPHTKAQS--GMDAFAAAAKDARM-------NNLFNQSMH-----NHTVVEHVSGHMFIE-VPNGQALFMKW 189 (214)
Q Consensus 130 -----~g~~~~~dvgG--G~~~~~~~~~~P~l-------~~v~~~~~~-----~~~rv~~~~gDff~~-~P~~d~y~l~~ 189 (214)
.+...++|||| |..+.++++++|++ +.+++.+.. ..+||++++||||++ .|.+|+|++++
T Consensus 173 ~~~~~~~~~~v~DvGgG~G~~~~~l~~~~p~~~~~~~dlp~v~~~a~~~~~~~~~~rv~~~~gD~~~~~~~~~D~~~~~~ 252 (353)
T 4a6d_A 173 TAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFQEEEQIDFQEGDFFKDPLPEADLYILAR 252 (353)
T ss_dssp HSSCGGGCSEEEEETCTTSHHHHHHHHHCSSCEEEEEECHHHHHHHHHHSCC--CCSEEEEESCTTTSCCCCCSEEEEES
T ss_pred HhcCcccCCeEEeeCCCCCHHHHHHHHhCCCceeEeccCHHHHHHHHHhhhhcccCceeeecCccccCCCCCceEEEeee
Confidence 23356899998 77788999999976 566665542 257999999999965 45689999999
Q ss_pred hccCCChHHHHHHHHHhHHhcCCC
Q 042599 190 ILSDWDDEECLKILKNCCVQCNTG 213 (214)
Q Consensus 190 ILHdw~d~~~~~IL~~~~~Al~pg 213 (214)
|||||+|++|++||++|+++|+||
T Consensus 253 vlh~~~d~~~~~iL~~~~~al~pg 276 (353)
T 4a6d_A 253 VLHDWADGKCSHLLERIYHTCKPG 276 (353)
T ss_dssp SGGGSCHHHHHHHHHHHHHHCCTT
T ss_pred ecccCCHHHHHHHHHHHHhhCCCC
Confidence 999999999999999999999998
|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A | Back alignment and structure |
|---|
| >3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} | Back alignment and structure |
|---|
| >2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2g7u_A Transcriptional regulator; ICLR family, structural genomics, PSI, protein structure initiative, midwest center for struc genomics; 2.30A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >2ia2_A Putative transcriptional regulator; SAD, PSI-2, structural genomics, structure initiative, midwest center for structural genomic transcription; 2.10A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3df8_A Possible HXLR family transcriptional factor; APC89000, structural genomics, midwest center for structural genomics, MCSG; 1.65A {Thermoplasma volcanium} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >4a5n_A Uncharacterized HTH-type transcriptional regulato; activator, DNA binding, MARR-like; 1.81A {Bacillus subtilis} PDB: 4a5m_A | Back alignment and structure |
|---|
| >3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A | Back alignment and structure |
|---|
| >2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 214 | ||||
| d1kyza1 | 107 | a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic | 1e-20 | |
| d1fp1d1 | 110 | a.4.5.29 (D:19-128) Chalcone O-methyltransferase { | 4e-20 | |
| d1kyza2 | 243 | c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferuli | 3e-10 | |
| d1fp2a2 | 244 | c.66.1.12 (A:109-352) Isoflavone O-methyltransfera | 3e-09 | |
| d1fp1d2 | 244 | c.66.1.12 (D:129-372) Chalcone O-methyltransferase | 5e-08 | |
| d1fp1d2 | 244 | c.66.1.12 (D:129-372) Chalcone O-methyltransferase | 9e-06 | |
| d1fp2a1 | 101 | a.4.5.29 (A:8-108) Isoflavone O-methyltransferase | 8e-06 | |
| d1qzza2 | 256 | c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase | 0.001 | |
| d1tw3a2 | 253 | c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransf | 0.002 |
| >d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 107 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: "Winged helix" DNA-binding domain family: Plant O-methyltransferase, N-terminal domain domain: Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase species: Alfalfa (Medicago sativa) [TaxId: 3879]
Score = 81.0 bits (200), Expect = 1e-20
Identities = 41/91 (45%), Positives = 57/91 (62%), Gaps = 18/91 (19%)
Query: 1 AVLPMTMKTAIQLGVLEIM-----------------LPKNNKETPIILDRMLRLLASYSF 43
+VLPM +K+A++L +LEI+ LP N + P++LDRMLRLLA Y
Sbjct: 18 SVLPMILKSALELDLLEIIAKAGPGAQISPIEIASQLPTTNPDAPVMLDRMLRLLACYII 77
Query: 44 LTCNLATNIKDGSAQRLYGLASVSRYFFPNE 74
LTC++ T +DG QRLYGLA+V++Y NE
Sbjct: 78 LTCSVRT-QQDGKVQRLYGLATVAKYLVKNE 107
|
| >d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 110 | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 243 | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 | Back information, alignment and structure |
|---|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 | Back information, alignment and structure |
|---|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 | Back information, alignment and structure |
|---|
| >d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 101 | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 256 | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Length = 253 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 99.95 | |
| d1fp1d2 | 244 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 99.94 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 99.93 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 99.8 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 99.74 | |
| d1tw3a1 | 85 | Carminomycin 4-O-methyltransferase {Streptomyces p | 99.54 | |
| d1kyza1 | 107 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 99.46 | |
| d1fp2a1 | 101 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 99.46 | |
| d1fp1d1 | 110 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 99.41 | |
| d1qzza1 | 92 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 99.39 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 97.78 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 97.77 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 97.48 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 97.46 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 97.28 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 97.24 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 97.16 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 97.04 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 96.79 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 96.54 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 96.43 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 96.42 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 96.11 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 96.1 | |
| d1mkma1 | 75 | Transcriptional regulator IclR, N-terminal domain | 96.03 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 95.97 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 95.91 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 95.89 | |
| d1af7a2 | 193 | Chemotaxis receptor methyltransferase CheR, C-term | 95.82 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 95.8 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 95.62 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 95.53 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 95.45 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 95.4 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 94.29 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 93.38 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 91.06 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 90.43 | |
| d1r7ja_ | 90 | Sso10a (SSO10449) {Archaeon Sulfolobus solfataricu | 90.43 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 90.07 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 89.59 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 89.33 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 89.07 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 87.62 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 86.89 | |
| d1ub9a_ | 100 | Hypothetical protein PH1061 {Archaeon Pyrococcus h | 86.83 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 86.79 | |
| d1lvaa3 | 64 | C-terminal fragment of elongation factor SelB {Moo | 86.41 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 85.91 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 85.57 | |
| d1z05a1 | 71 | Transcriptional regulator VC2007 N-terminal domain | 85.44 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 84.94 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 84.51 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 83.84 | |
| d1xd7a_ | 127 | Hypothetical protein ywnA {Bacillus subtilis [TaxI | 82.57 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 80.99 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 80.56 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 80.03 |
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Plant O-methyltransferase, C-terminal domain domain: Isoflavone O-methyltransferase species: Alfalfa (Medicago sativa) [TaxId: 3879]
Probab=99.95 E-value=4.1e-28 Score=196.25 Aligned_cols=115 Identities=22% Similarity=0.401 Sum_probs=96.6
Q ss_pred cCCcchhhhcchhhHhhHHhhhhhcc--HHHHH------hcCCCceEEccC--CccHHHHHHhCCCc-------hHHHHh
Q 042599 98 KYTQHSYLCMKDALLEGFINTLNRYY--LKNAL------LEGSVPHTKAQS--GMDAFAAAAKDARM-------NNLFNQ 160 (214)
Q Consensus 98 ~~~~~~~~~~~p~~~~~f~~~m~~~~--~~~~~------~~g~~~~~dvgG--G~~~~~~~~~~P~l-------~~v~~~ 160 (214)
+.++|+|+.++|+..+.|+.+|.... ....+ -+|...++|||| |..+.++++++|++ +.+++.
T Consensus 39 G~~~~e~l~~~pe~~~~F~~aM~~~s~~~~~~~~~~~~~~~~~~~vvDvGGG~G~~~~~l~~~~P~l~~~v~Dlp~vi~~ 118 (244)
T d1fp2a2 39 GSGFWDFLDKNPEYNTSFNDAMASDSKLINLALRDCDFVFDGLESIVDVGGGTGTTAKIICETFPKLKCIVFDRPQVVEN 118 (244)
T ss_dssp SSCHHHHHHHCHHHHHHHHHHHHHTHHHHHHHHHTCHHHHTTCSEEEEETCTTSHHHHHHHHHCTTCEEEEEECHHHHTT
T ss_pred CCCHHHHHHhCHHHHHHHHHHhhhhhhhhhhhHhhhcccccCceEEEEecCCccHHHHHHHHhCCCCeEEEecCHHHHHh
Confidence 56899999999999999999997621 11222 135567999998 77788999999976 566665
Q ss_pred hccCCCceEEecCCCCcccCccceeeeehhccCCChHHHHHHHHHhHHhcCCC
Q 042599 161 SMHNHTVVEHVSGHMFIEVPNGQALFMKWILSDWDDEECLKILKNCCVQCNTG 213 (214)
Q Consensus 161 ~~~~~~rv~~~~gDff~~~P~~d~y~l~~ILHdw~d~~~~~IL~~~~~Al~pg 213 (214)
+.. .+||++++||||+++|.+|+|+|++|||||+|++|++||+||++||+||
T Consensus 119 ~~~-~~rv~~~~gD~f~~~p~aD~~~l~~vLHdw~d~~~~~iL~~~~~al~pg 170 (244)
T d1fp2a2 119 LSG-SNNLTYVGGDMFTSIPNADAVLLKYILHNWTDKDCLRILKKCKEAVTND 170 (244)
T ss_dssp CCC-BTTEEEEECCTTTCCCCCSEEEEESCGGGSCHHHHHHHHHHHHHHHSGG
T ss_pred Ccc-cCceEEEecCcccCCCCCcEEEEEeecccCChHHHHHHHHHHHHHcCcc
Confidence 543 5799999999999999899999999999999999999999999999996
|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xd7a_ a.4.5.55 (A:) Hypothetical protein ywnA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|