Citrus Sinensis ID: 042636


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
VAKVHRGLGSLMDLQKLSIIEADSQVLKELMKLRQLRKLGIRPKNGNGKDVCALIANLENLESLTVLMASKDEILDLQSLSSPPQYLQRLYLTGNMKKLPDWIFKLKNVIRLGLDLSGLTEDPLRVPHALPNLLELRLGGTYNYKLFHFEAGWFPKLQILTLFDFVAVKSVIIEKGAMPDIRELGIGPFPLWSMYIFLTDHILDQIVVVMLLLTCFEFE
cccccccccccccccEEEEEEccHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHcccccccEEEEEccccccccccccccccccccEEEEEEEcccccccccccccccEEEEEcccccccccccccccccccEEEEcccccccEEEEcccccccccEEEEcccccccEEEEccccccccccEEEEcccccccccHHHHHHHHHHHEEEEEccccccc
cccccccHHHHHHHHEEEEEcccHHHHHHHHHHHHHHHcEEEEEcccHHHHHHHHHHcccccEEEEEEccccccccHHccccccHHHHEEEEcccHHHccHHHHccHccEEEEEEcccccccHHHHHHHcccHHEEEEHHcccccEEEEccccccccEEEEEcccccccEEEEEcccccccEEEEEEcccHHHcccccHHHHHHHcEEEEEEccccccc
vakvhrglgslmdlqKLSIIEADSQVLKELMKLRQLRKlgirpkngngkDVCALIANLENLESLTVLMASKDEildlqslssppqyLQRLYLTGNMKKLPDWIFKLKNVIRLgldlsgltedplrvphalpnllelrlggtynyklfhfeagwfpklqiltlfDFVAVKSVIIekgampdirelgigpfplwSMYIFLTDHILDQIVVVMLLLTCFEFE
vakvhrglgslmdlqklsIIEADSQVLKELMKLRQLRklgirpkngngkDVCALIANLENLESLTVLMASKDEILDLQSLSSPPQYLQRLYLTGNMKKLPDWIFKLKNVIRLGLDLsgltedplrvPHALPNLLELRLGGTYNYKLFHFEAGWFPKLQILTLFDFVAVKSVIiekgampdirELGIGPFPLWSMYIFLTDHILDQIVVVMLLLTCFEFE
VAKVHRGLGSLMDLQKLSIIEADSQVLKELMKLRQLRKLGIRPKNGNGKDVCALIANLENLESLTVLMASKDEILDLQSLSSPPQYLQRLYLTGNMKKLPDWIFKLKNVIRLGLDLSGLTEDPLRVPHALPNLLELRLGGTYNYKLFHFEAGWFPKLQILTLFDFVAVKSVIIEKGAMPDIRELGIGPFPLWSMYIFLTDHILDQIVVVMLLLTCFEFE
**********LMDLQKLSIIEADSQVLKELMKLRQLRKLGIRPKNGNGKDVCALIANLENLESLTVLMASKDEILDLQSLSSPPQYLQRLYLTGNMKKLPDWIFKLKNVIRLGLDLSGLTEDPLRVPHALPNLLELRLGGTYNYKLFHFEAGWFPKLQILTLFDFVAVKSVIIEKGAMPDIRELGIGPFPLWSMYIFLTDHILDQIVVVMLLLTCFE**
VAKVHRGLGSLMDLQKLSIIEADSQVLKELMKLRQLRKLGIRPKNGNGKDVCALIANLENLESLTVLMASKDEILDLQSLSSPPQYLQRLYLTGNMKKLPDWIFKLKNVIRLGLDLSGLTEDPLRVPHALPNLLELRLGGTYNYKLFHFEAGWFPKLQILTLFDFVAVKSVIIEKGAMPDIRELGIGPFPLWSMYIFLTDHILDQIVVVMLLLTCFEF*
VAKVHRGLGSLMDLQKLSIIEADSQVLKELMKLRQLRKLGIRPKNGNGKDVCALIANLENLESLTVLMASKDEILDLQSLSSPPQYLQRLYLTGNMKKLPDWIFKLKNVIRLGLDLSGLTEDPLRVPHALPNLLELRLGGTYNYKLFHFEAGWFPKLQILTLFDFVAVKSVIIEKGAMPDIRELGIGPFPLWSMYIFLTDHILDQIVVVMLLLTCFEFE
**KVHRGLGSLMDLQKLSIIEADSQVLKELMKLRQLRKLGIRPKNGNGKDVCALIANLENLESLTVLMASKDEILDLQSLSSPPQYLQRLYLTGNMKKLPDWIFKLKNVIRLGLDLSGLTEDPLRVPHALPNLLELRLGGTYNYKLFHFEAGWFPKLQILTLFDFVAVKSVIIEKGAMPDIRELGIGPFPLWSMYIFLTDHILDQIVVVMLLLTCFEFE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VAKVHRGLGSLMDLQKLSIIEADSQVLKELMKLRQLRKLGIRPKNGNGKDVCALIANLENLESLTVLMASKDEILDLQSLSSPPQYLQRLYLTGNMKKLPDWIFKLKNVIRLGLDLSGLTEDPLRVPHALPNLLELRLGGTYNYKLFHFEAGWFPKLQILTLFDFVAVKSVIIEKGAMPDIRELGIGPFPLWSMYIFLTDHILDQIVVVMLLLTCFEFE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query219 2.2.26 [Sep-21-2011]
Q39214926 Disease resistance protei yes no 0.794 0.187 0.265 4e-12
Q8W4J9908 Disease resistance protei no no 0.817 0.197 0.251 1e-05
Q8W3K3910 Putative disease resistan no no 0.821 0.197 0.281 2e-05
P59584910 Disease resistance protei no no 0.812 0.195 0.260 3e-05
P0DI181049 Probable disease resistan no no 0.730 0.152 0.259 4e-05
P0DI171049 Probable disease resistan no no 0.730 0.152 0.259 4e-05
Q9FJK8908 Probable disease resistan no no 0.817 0.197 0.256 0.0001
Q9FJB5901 Disease resistance RPP8-l no no 0.812 0.197 0.229 0.0002
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function desciption
 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 93/177 (52%), Gaps = 3/177 (1%)

Query: 11  LMDLQKLSIIEADSQVLKELMKLRQLRKLG-IRPKNGNGKDVCALIANLENLESLTVLMA 69
           L DLQ +    A+ +++K L  + QL ++  +  +  +G+D+C  +  ++ +  L++   
Sbjct: 683 LKDLQVMDCFNAEDELIKNLGCMTQLTRISLVMVRREHGRDLCDSLNKIKRIRFLSLTSI 742

Query: 70  SKDEILDLQSLSSPPQYLQRLYLTGNMKKLPDWIFKLKNVIRLGLDLSGLTEDPLRVPHA 129
            ++E L++  L +    +++L+L G ++++P W   L+N+  LGL  S L E+ +     
Sbjct: 743 DEEEPLEIDDLIATAS-IEKLFLAGKLERVPSWFNTLQNLTYLGLRGSQLQENAILSIQT 801

Query: 130 LPNLLELRLGGTYNYKLFHFEAGWFPKLQILTLFDFVAVKSVIIEKGAMPDIRELGI 186
           LP L+ L     Y      F  G F  L+IL +     +  V+IE GAM ++++L +
Sbjct: 802 LPRLVWLSFYNAYMGPRLRFAQG-FQNLKILEIVQMKHLTEVVIEDGAMFELQKLYV 857




Disease resistance (R) protein that specifically recognizes the AvrRpm1 type III effector avirulence protein from Pseudomonas syringae. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Acts via its interaction with RIN4, and probably triggers the plant resistance when RIN4 is phosphorylated by AvrRpm1. It is then degraded at the onset of the hypersensitive response.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8W4J9|RPP8_ARATH Disease resistance protein RPP8 OS=Arabidopsis thaliana GN=RPP8 PE=1 SV=2 Back     alignment and function description
>sp|Q8W3K3|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1 Back     alignment and function description
>sp|P59584|RP8HA_ARATH Disease resistance protein RPH8A OS=Arabidopsis thaliana GN=RPH8A PE=3 SV=1 Back     alignment and function description
>sp|P0DI18|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1 Back     alignment and function description
>sp|P0DI17|DRL11_ARATH Probable disease resistance protein RF9 OS=Arabidopsis thaliana GN=RF9 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJK8|RP8L4_ARATH Probable disease resistance RPP8-like protein 4 OS=Arabidopsis thaliana GN=RPP8L4 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query219
359480122 934 PREDICTED: disease resistance protein RP 0.853 0.200 0.497 1e-35
225465433 908 PREDICTED: disease resistance protein RP 0.853 0.205 0.442 4e-33
400296111 941 NBS-LRR type disease resistance protein 0.840 0.195 0.436 1e-31
105922948 1997 NBS-NBS-LRR type disease resistance prot 0.808 0.088 0.422 1e-31
224138300 974 cc-nbs-lrr resistance protein [Populus t 0.808 0.181 0.422 2e-31
351721361 934 NBS-LRR type disease resistance protein 0.817 0.191 0.433 2e-31
224071423 1006 nbs-lrr resistance protein [Populus tric 0.808 0.175 0.438 2e-31
357484815 940 Disease resistance protein RPP8 [Medicag 0.831 0.193 0.408 3e-31
147856116 1894 hypothetical protein VITISV_006820 [Viti 0.849 0.098 0.426 3e-31
255582947 935 Disease resistance protein RPM1, putativ 0.863 0.202 0.435 1e-30
>gi|359480122|ref|XP_002265617.2| PREDICTED: disease resistance protein RPM1-like [Vitis vinifera] gi|147771833|emb|CAN60254.1| hypothetical protein VITISV_025805 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 95/191 (49%), Positives = 128/191 (67%), Gaps = 4/191 (2%)

Query: 4   VHRGLGSLMDLQKLSIIEAD--SQVLKELMKLRQLRKLGI-RPKNGNGKDVCALIANLEN 60
           V  G+G L DLQKL  +E +  + V+KEL KLRQLRKLGI +    NG+ +CA I  + +
Sbjct: 668 VKEGIGCLEDLQKLCFVEGNQGTDVIKELGKLRQLRKLGITKLTRENGQPLCASIMKMNH 727

Query: 61  LESLTVLMASKDEILDLQSLSSPPQYLQRLYLTGNMKKLPDWIFKLKNVIRLGLDLSGLT 120
           L+SL++  +++DEILDLQ +S PP  L RL L G + KLPDWI KLK++++LGL  S L+
Sbjct: 728 LKSLSISSSTEDEILDLQHVSDPPPCLSRLELYGRLDKLPDWISKLKSLVKLGLWKSRLS 787

Query: 121 EDPLRVPHA-LPNLLELRLGGTYNYKLFHFEAGWFPKLQILTLFDFVAVKSVIIEKGAMP 179
            DP+ V  A LPNLLEL L  T+  +   FEA  F KL++L + D + +K V IE GA+P
Sbjct: 788 HDPMGVLGAQLPNLLELELLQTHAVEQLCFEAIGFQKLKVLRICDLIELKKVKIENGALP 847

Query: 180 DIRELGIGPFP 190
            + EL IGP P
Sbjct: 848 QVEELEIGPSP 858




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225465433|ref|XP_002265568.1| PREDICTED: disease resistance protein RPM1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|400296111|gb|AFP82245.1| NBS-LRR type disease resistance protein [Malus x domestica] Back     alignment and taxonomy information
>gi|105922948|gb|ABF81446.1| NBS-NBS-LRR type disease resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224138300|ref|XP_002326568.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|105922919|gb|ABF81444.1| NBS-LRR type disease resistance protein [Populus trichocarpa] gi|222833890|gb|EEE72367.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351721361|ref|NP_001235671.1| NBS-LRR type disease resistance protein [Glycine max] gi|223452621|gb|ACM89637.1| NBS-LRR type disease resistance protein [Glycine max] Back     alignment and taxonomy information
>gi|224071423|ref|XP_002303452.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222840884|gb|EEE78431.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357484815|ref|XP_003612695.1| Disease resistance protein RPP8 [Medicago truncatula] gi|355514030|gb|AES95653.1| Disease resistance protein RPP8 [Medicago truncatula] Back     alignment and taxonomy information
>gi|147856116|emb|CAN80288.1| hypothetical protein VITISV_006820 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255582947|ref|XP_002532244.1| Disease resistance protein RPM1, putative [Ricinus communis] gi|223528062|gb|EEF30138.1| Disease resistance protein RPM1, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query219
TAIR|locus:2077572926 RPM1 "RESISTANCE TO P. SYRINGA 0.785 0.185 0.268 3.2e-14
TAIR|locus:2176486908 RPP8 "RECOGNITION OF PERONOSPO 0.817 0.197 0.251 1.2e-06
TAIR|locus:5049561841017 AT1G58807 "AT1G58807" [Arabido 0.789 0.170 0.269 1.8e-06
TAIR|locus:28270381017 AT1G59124 "AT1G59124" [Arabido 0.789 0.170 0.269 1.8e-06
TAIR|locus:2152536908 AT5G48620 [Arabidopsis thalian 0.817 0.197 0.256 6.6e-06
TAIR|locus:5049561821049 AT1G58848 [Arabidopsis thalian 0.767 0.160 0.255 2.4e-05
TAIR|locus:28269781049 AT1G59218 [Arabidopsis thalian 0.767 0.160 0.255 2.4e-05
TAIR|locus:2169523901 AT5G35450 [Arabidopsis thalian 0.803 0.195 0.226 5.9e-05
TAIR|locus:504956186 1138 AT1G58602 [Arabidopsis thalian 0.762 0.146 0.265 0.00023
TAIR|locus:2037623899 AT1G58410 [Arabidopsis thalian 0.794 0.193 0.278 0.0003
TAIR|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 195 (73.7 bits), Expect = 3.2e-14, P = 3.2e-14
 Identities = 47/175 (26%), Positives = 92/175 (52%)

Query:    11 LMDLQKLSIIEADSQVLKELMKLRQLRKLG-IRPKNGNGKDVCALIANLENLESLTVLMA 69
             L DLQ +    A+ +++K L  + QL ++  +  +  +G+D+C  +  ++ +  L++   
Sbjct:   683 LKDLQVMDCFNAEDELIKNLGCMTQLTRISLVMVRREHGRDLCDSLNKIKRIRFLSLTSI 742

Query:    70 SKDEILDLQSLSSPPQYLQRLYLTGNMKKLPDWIFKLKNVIRLGLDLSGLTEDPLRVPHA 129
              ++E L++  L +    +++L+L G ++++P W   L+N+  LGL  S L E+ +     
Sbjct:   743 DEEEPLEIDDLIATAS-IEKLFLAGKLERVPSWFNTLQNLTYLGLRGSQLQENAILSIQT 801

Query:   130 LPNLLELRLGGTYNYKLFHFEAGWFPKLQILTLFDFVAVKSVIIEKGAMPDIREL 184
             LP L+ L     Y      F  G F  L+IL +     +  V+IE GAM ++++L
Sbjct:   802 LPRLVWLSFYNAYMGPRLRFAQG-FQNLKILEIVQMKHLTEVVIEDGAMFELQKL 855




GO:0006952 "defense response" evidence=IEA;ISS;TAS
GO:0043531 "ADP binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0005886 "plasma membrane" evidence=IDA
GO:0000166 "nucleotide binding" evidence=ISS
GO:0009626 "plant-type hypersensitive response" evidence=IDA
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037623 AT1G58410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00033829001
SubName- Full=Chromosome undetermined scaffold_70, whole genome shotgun sequence; (910 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 219
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.62
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.62
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.38
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.33
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.32
KOG0617264 consensus Ras suppressor protein (contains leucine 99.29
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.19
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.17
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.05
KOG0617264 consensus Ras suppressor protein (contains leucine 99.03
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.97
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.87
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.86
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.84
KOG0472 565 consensus Leucine-rich repeat protein [Function un 98.8
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.78
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.74
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.73
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.71
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.59
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.59
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.56
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.55
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.48
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.46
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.33
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.32
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.29
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.28
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.17
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.17
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.15
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.11
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.04
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.02
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.95
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.93
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.88
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.85
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.81
PLN03150623 hypothetical protein; Provisional 97.77
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.7
PLN03150623 hypothetical protein; Provisional 97.59
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.57
PRK15386 426 type III secretion protein GogB; Provisional 97.4
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.34
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.1
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.05
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.0
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.86
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 96.77
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.59
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.91
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.87
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.45
KOG4341483 consensus F-box protein containing LRR [General fu 95.38
KOG4341483 consensus F-box protein containing LRR [General fu 95.34
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 95.18
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 94.87
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.83
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.56
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.0
KOG1947482 consensus Leucine rich repeat proteins, some prote 93.95
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.85
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 93.47
PRK15386 426 type III secretion protein GogB; Provisional 92.88
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.81
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 92.54
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.92
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 91.24
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 90.04
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 89.53
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 86.99
smart0037026 LRR Leucine-rich repeats, outliers. 86.03
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.03
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.62  E-value=4.4e-16  Score=141.83  Aligned_cols=183  Identities=21%  Similarity=0.261  Sum_probs=81.7

Q ss_pred             cCCcccccccccccccccc--ChHhHHHHhcccccceeeeeeCCCChhHHHHH------------------------Hhc
Q 042636            4 VHRGLGSLMDLQKLSIIEA--DSQVLKELMKLRQLRKLGIRPKNGNGKDVCAL------------------------IAN   57 (219)
Q Consensus         4 lP~~l~~l~~L~~L~~~~~--~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~------------------------l~~   57 (219)
                      +|..++++++|++|++.++  ....|..++++++|++|+++. +...+.++..                        +++
T Consensus       156 ~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~-n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~  234 (968)
T PLN00113        156 IPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLAS-NQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGG  234 (968)
T ss_pred             CChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccC-CCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhc
Confidence            4455555555555555544  334444555555555555542 2222233333                        444


Q ss_pred             cCCCCeEEEEecCCCcccccccCCCcccCccEEEecc-cCC-CCChhhhcCCCccEEEEeeecCCCCCCccccCCCccce
Q 042636           58 LENLESLTVLMASKDEILDLQSLSSPPQYLQRLYLTG-NMK-KLPDWIFKLKNVIRLGLDLSGLTEDPLRVPHALPNLLE  135 (219)
Q Consensus        58 l~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~-~~~-~l~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~  135 (219)
                      +++|++|++++|......+ ..+...+ +|++|+++. .+. .+|.++..+++|+.|++++|.+.+..+..+.++++|+.
T Consensus       235 l~~L~~L~L~~n~l~~~~p-~~l~~l~-~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~  312 (968)
T PLN00113        235 LTSLNHLDLVYNNLTGPIP-SSLGNLK-NLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEI  312 (968)
T ss_pred             CCCCCEEECcCceeccccC-hhHhCCC-CCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcE
Confidence            4444444444443322111 1222233 455555544 222 24444555555555555555554433344455555555


Q ss_pred             eeec-cccCCceEEEccCCCcccceeeecccCCcceEEEcCCcccccceeeeecCC
Q 042636          136 LRLG-GTYNYKLFHFEAGWFPKLQILTLFDFVAVKSVIIEKGAMPDIRELGIGPFP  190 (219)
Q Consensus       136 L~l~-~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~p~L~~L~l~~~~  190 (219)
                      |+++ +...+ .++.....+++|+.|++.++...+.++...+.+++|+.|++.++.
T Consensus       313 L~l~~n~~~~-~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~  367 (968)
T PLN00113        313 LHLFSNNFTG-KIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNN  367 (968)
T ss_pred             EECCCCccCC-cCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCe
Confidence            5554 22221 122222345556666555443222232223344555555555543



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query219
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-04
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-04
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
 Score = 46.3 bits (109), Expect = 4e-06
 Identities = 37/162 (22%), Positives = 58/162 (35%), Gaps = 14/162 (8%)

Query: 7   GLGSLMDLQKLSIIEADSQVLKELMKLRQLRKLGIRPKNGNG-KDVCALIANLENLESLT 65
            L  L  L+ LS+       +  L+ L QL  L +     N   D    I  L  L  L 
Sbjct: 104 SLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYL---GNNKITD----ITVLSRLTKLD 156

Query: 66  VLMASKDEILDLQSLSSPPQYLQRLYLTGNMKKLPDW--IFKLKNVIRLGLDLSGLTEDP 123
            L    ++I D+  L+   + LQ LYL+ N   + D   +  LKN+  L L        P
Sbjct: 157 TLSLEDNQISDIVPLAGLTK-LQNLYLSKN--HISDLRALAGLKNLDVLELFSQECLNKP 213

Query: 124 LRVPHALPNLLELR-LGGTYNYKLFHFEAGWFPKLQILTLFD 164
           +     L     ++   G+        + G + K  +     
Sbjct: 214 INHQSNLVVPNTVKNTDGSLVTPEIISDDGDYEKPNVKWHLP 255


>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query219
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.76
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.68
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.68
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.66
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.64
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.63
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.61
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.61
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.61
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.6
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.6
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.58
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.58
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.58
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.58
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.58
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.57
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.57
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.57
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.56
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.56
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.56
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.56
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.56
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.55
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.55
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.55
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.54
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.54
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.53
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.53
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.52
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.52
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.52
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.52
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.52
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.51
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.51
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.51
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.5
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.5
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.49
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.49
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.48
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.48
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.48
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.47
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.47
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.47
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.46
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.46
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.45
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.45
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.44
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.44
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.44
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.43
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.42
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.42
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.42
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.42
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.42
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.42
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.4
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.4
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.4
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.4
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.39
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.39
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.38
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.38
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.38
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.38
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.37
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.36
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.36
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.36
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.34
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.34
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.33
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.33
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.32
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.32
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.3
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.29
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.27
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.27
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.26
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.26
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.24
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.21
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.21
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.2
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.19
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.17
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.17
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.15
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.14
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.14
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.13
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.13
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.11
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.11
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.05
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.03
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.01
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.99
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.98
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.98
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.97
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.96
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.94
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.94
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.94
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.92
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.92
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.91
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.88
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.86
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.86
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.75
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.73
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.72
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.64
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.57
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.55
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.45
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.35
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.32
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.16
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.15
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.01
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.97
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.91
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.85
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.77
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.6
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.47
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.37
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.12
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.71
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.62
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 91.51
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 91.27
4gt6_A394 Cell surface protein; leucine rich repeats, putati 86.29
4gt6_A394 Cell surface protein; leucine rich repeats, putati 85.46
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 84.46
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 84.2
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 81.66
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 80.44
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.87  E-value=3e-22  Score=160.22  Aligned_cols=201  Identities=21%  Similarity=0.179  Sum_probs=163.2

Q ss_pred             CcccCCcccccccccccccccc-ChHhHHHHhcccccceeeeeeCCCChhHHHHHHhccCCCCeEEEEecCCCcccccc-
Q 042636            1 VAKVHRGLGSLMDLQKLSIIEA-DSQVLKELMKLRQLRKLGIRPKNGNGKDVCALIANLENLESLTVLMASKDEILDLQ-   78 (219)
Q Consensus         1 i~~lP~~l~~l~~L~~L~~~~~-~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~-   78 (219)
                      +..+|++++++++|++|++.++ ...+|..++++++|++|+++.  +....++..+.++++|++|++++|......+.. 
T Consensus        93 l~~lp~~l~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~--n~l~~lp~~l~~l~~L~~L~L~~n~~~~~~p~~~  170 (328)
T 4fcg_A           93 LPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLAR--NPLRALPASIASLNRLRELSIRACPELTELPEPL  170 (328)
T ss_dssp             CSSCCSCGGGGTTCSEEEEESSCCCCCCSCGGGGTTCSEEEEES--CCCCCCCGGGGGCTTCCEEEEEEETTCCCCCSCS
T ss_pred             chhcChhhhhCCCCCEEECCCCCccchhHHHhccCCCCEEECCC--CccccCcHHHhcCcCCCEEECCCCCCccccChhH
Confidence            4578999999999999999988 447788899999999999994  333366677899999999999998765544311 


Q ss_pred             -------cCCCcccCccEEEecc-cCCCCChhhhcCCCccEEEEeeecCCCCCCccccCCCccceeeeccccCCceEEEc
Q 042636           79 -------SLSSPPQYLQRLYLTG-NMKKLPDWIFKLKNVIRLGLDLSGLTEDPLRVPHALPNLLELRLGGTYNYKLFHFE  150 (219)
Q Consensus        79 -------~~~~~~~~L~~L~l~~-~~~~l~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~  150 (219)
                             .+..++ +|++|++++ .++.+|.++..+++|+.|++++|.+...+ ..+..+++|+.|+++.+.....++..
T Consensus       171 ~~~~~~~~~~~l~-~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~N~l~~l~-~~l~~l~~L~~L~Ls~n~~~~~~p~~  248 (328)
T 4fcg_A          171 ASTDASGEHQGLV-NLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALG-PAIHHLPKLEELDLRGCTALRNYPPI  248 (328)
T ss_dssp             EEEC-CCCEEEST-TCCEEEEEEECCCCCCGGGGGCTTCCEEEEESSCCCCCC-GGGGGCTTCCEEECTTCTTCCBCCCC
T ss_pred             hhccchhhhccCC-CCCEEECcCCCcCcchHhhcCCCCCCEEEccCCCCCcCc-hhhccCCCCCEEECcCCcchhhhHHH
Confidence                   122355 999999998 78889999999999999999999998754 46889999999999943333334555


Q ss_pred             cCCCcccceeeecccCCcceEEEcCCcccccceeeeecCCCCCcchhHHhhhhhh
Q 042636          151 AGWFPKLQILTLFDFVAVKSVIIEKGAMPDIRELGIGPFPLWSMYIFLTDHILDQ  205 (219)
Q Consensus       151 ~~~~~~L~~L~l~~~~~~~~~~~~~~~~p~L~~L~l~~~~~l~~~~~~~~~l~~~  205 (219)
                      .+.+++|+.|++.++...+.++...+.+++|+.|++.+|+..+.+|.++.++.+.
T Consensus       249 ~~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~iP~~l~~L~~L  303 (328)
T 4fcg_A          249 FGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPAN  303 (328)
T ss_dssp             TTCCCCCCEEECTTCTTCCBCCTTGGGCTTCCEEECTTCTTCCCCCGGGGGSCTT
T ss_pred             hcCCCCCCEEECCCCCchhhcchhhhcCCCCCEEeCCCCCchhhccHHHhhccCc
Confidence            6678999999999888777776666789999999999999999999998887764



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 219
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-04
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 37.7 bits (86), Expect = 7e-04
 Identities = 37/137 (27%), Positives = 58/137 (42%), Gaps = 12/137 (8%)

Query: 7   GLGSLMDLQKLSIIEADSQVLKELMKLRQLRKLGIRPKNGNGKDVCALIANLENLESLTV 66
            L  L  L KL+ ++  +  +  +  L  L  L     N N  +  + I+NL+NL  LT+
Sbjct: 255 NLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTL 314

Query: 67  LMASKDEILDLQSLSSPPQYLQRLYLTGNMKKLPDWIFKLKNVIRLGLD---LSGLTEDP 123
                + I D+  +SS  + LQRL+   N       +  L N+  L      +S LT  P
Sbjct: 315 ---YFNNISDISPVSSLTK-LQRLFFANNKVSDVSSLANLTNINWLSAGHNQISDLT--P 368

Query: 124 LRVPHALPNLLELRLGG 140
           L     L  + +L L  
Sbjct: 369 L---ANLTRITQLGLND 382


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query219
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.53
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.46
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.39
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.38
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.37
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.32
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.31
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.29
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.29
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.27
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.27
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.25
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.2
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.19
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.19
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.19
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.12
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.01
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.0
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.96
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.95
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.92
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.9
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.88
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.86
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.81
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.78
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.38
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.21
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.2
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 97.96
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.95
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.73
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 97.7
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.42
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.24
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.21
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.84
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.38
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.12
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.77
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.53  E-value=3.6e-15  Score=113.79  Aligned_cols=180  Identities=16%  Similarity=0.059  Sum_probs=129.7

Q ss_pred             CcccCCcccccccccccccccc-ChHhH-HHHhcccccceeeeeeCCCChhHHHHHHhccCCCCeEEEEecCCCcccccc
Q 042636            1 VAKVHRGLGSLMDLQKLSIIEA-DSQVL-KELMKLRQLRKLGIRPKNGNGKDVCALIANLENLESLTVLMASKDEILDLQ   78 (219)
Q Consensus         1 i~~lP~~l~~l~~L~~L~~~~~-~~~~~-~~l~~l~~L~~L~l~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~   78 (219)
                      ++.+|+++.  +++++|++.++ ...++ ..+.++++|++|+++.  +....+. .++.+++|++|++++|......  .
T Consensus        22 L~~iP~~lp--~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~--N~l~~l~-~~~~l~~L~~L~Ls~N~l~~~~--~   94 (266)
T d1p9ag_          22 LTALPPDLP--KDTTILHLSENLLYTFSLATLMPYTRLTQLNLDR--AELTKLQ-VDGTLPVLGTLDLSHNQLQSLP--L   94 (266)
T ss_dssp             CSSCCSCCC--TTCCEEECTTSCCSEEEGGGGTTCTTCCEEECTT--SCCCEEE-CCSCCTTCCEEECCSSCCSSCC--C
T ss_pred             CCeeCcCcC--cCCCEEECcCCcCCCcCHHHhhcccccccccccc--ccccccc-cccccccccccccccccccccc--c
Confidence            456888775  57899999888 44444 5588999999999984  2222221 2467899999999998765432  3


Q ss_pred             cCCCcccCccEEEecc-cCCCCC-hhhhcCCCccEEEEeeecCCCCCCccccCCCccceeeec-cccCCceEEEccCCCc
Q 042636           79 SLSSPPQYLQRLYLTG-NMKKLP-DWIFKLKNVIRLGLDLSGLTEDPLRVPHALPNLLELRLG-GTYNYKLFHFEAGWFP  155 (219)
Q Consensus        79 ~~~~~~~~L~~L~l~~-~~~~l~-~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~-~~~~~~~~~~~~~~~~  155 (219)
                      .+..++ +|+.|+++. .+..++ ..+..+.+++.|++++|.+...+...+..+++++.++++ +....- .......++
T Consensus        95 ~~~~l~-~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N~l~~~-~~~~~~~l~  172 (266)
T d1p9ag_          95 LGQTLP-ALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTEL-PAGLLNGLE  172 (266)
T ss_dssp             CTTTCT-TCCEEECCSSCCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTSCCSCC-CTTTTTTCT
T ss_pred             cccccc-ccccccccccccceeeccccccccccccccccccccceeccccccccccchhccccccccccc-Ccccccccc
Confidence            344555 899999987 555544 345677899999999998888777778889999999998 433221 122245678


Q ss_pred             ccceeeecccCCcceEEEcCCcccccceeeeecCC
Q 042636          156 KLQILTLFDFVAVKSVIIEKGAMPDIRELGIGPFP  190 (219)
Q Consensus       156 ~L~~L~l~~~~~~~~~~~~~~~~p~L~~L~l~~~~  190 (219)
                      +|++|++.++. ++.++.....+++|+.|++.+++
T Consensus       173 ~L~~L~Ls~N~-L~~lp~~~~~~~~L~~L~L~~Np  206 (266)
T d1p9ag_         173 NLDTLLLQENS-LYTIPKGFFGSHLLPFAFLHGNP  206 (266)
T ss_dssp             TCCEEECCSSC-CCCCCTTTTTTCCCSEEECCSCC
T ss_pred             ccceeecccCC-CcccChhHCCCCCCCEEEecCCC
Confidence            99999999754 66665555567899999999865



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure