Citrus Sinensis ID: 042653

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
LLKNCYKSIPEDGKVIVVESMIPEVPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTLATAAGFSGISCERAIGNFWVMEFYK
cHHHHHHHcccccEEEEEEEEccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccEEEEEccccEEEEEEc
cHHHHHHHcccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHccccccEEHHHHHHHHHHcccccccEEEEEccEEEEEEEc
llkncyksipedgkVIVVESmipevpntsieskLNSHYDVLMMIqspggkertrHEFMTLATAAGFSGISCERAIGNFWVMEFYK
llkncyksipedgkvivVESMIPEVPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTLAtaagfsgisCERAIGNFWVMEFYK
LLKNCYKSIPEDGKVIVVESMIPEVPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTLATAAGFSGISCERAIGNFWVMEFYK
***********DGKVIVVESMIPEV*******KLNSHYDVLMMIQ********RHEFMTLATAAGFSGISCERAIGNFWVMEFY*
LLKNCYKSIPEDGKVIVVESMIPEVPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTLATAAGFSGISCERAIGNFWVMEFYK
LLKNCYKSIPEDGKVIVVESMIPEVPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTLATAAGFSGISCERAIGNFWVMEFYK
LLKNCYKSIPEDGKVIVVESMIPEVPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTLATAAGFSGISCERAIGNFWVMEFYK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LLKNCYKSIPEDGKVIVVESMIPEVPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTLATAAGFSGISCERAIGNFWVMEFYK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query85 2.2.26 [Sep-21-2011]
Q43239354 Caffeic acid 3-O-methyltr N/A no 1.0 0.240 0.529 4e-20
Q9FQY8359 Caffeic acid 3-O-methyltr N/A no 1.0 0.236 0.482 7e-19
O04385368 (Iso)eugenol O-methyltran N/A no 1.0 0.230 0.505 2e-18
A9X7L0364 Anthranilate N-methyltran N/A no 1.0 0.233 0.494 2e-18
Q9XGW0361 Caffeic acid 3-O-methyltr N/A no 1.0 0.235 0.470 5e-18
P28002365 Caffeic acid 3-O-methyltr N/A no 1.0 0.232 0.470 6e-18
Q8LL87350 Caffeic acid 3-O-methyltr N/A no 1.0 0.242 0.470 1e-17
Q41086364 Caffeic acid 3-O-methyltr N/A no 1.0 0.233 0.494 2e-17
Q9FK25363 Flavone 3'-O-methyltransf yes no 0.811 0.190 0.550 2e-17
P59049343 Quercetin 3-O-methyltrans N/A no 1.0 0.247 0.482 2e-17
>sp|Q43239|COMT1_ZINEL Caffeic acid 3-O-methyltransferase OS=Zinnia elegans PE=2 SV=1 Back     alignment and function desciption
 Score = 96.7 bits (239), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 45/85 (52%), Positives = 58/85 (68%)

Query: 1   LLKNCYKSIPEDGKVIVVESMIPEVPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTL 60
           +LKNCYKS+PE+GKVIV E ++PE P+T+  ++   H DV+M+  +PGGKERT  EF  L
Sbjct: 270 VLKNCYKSLPENGKVIVAECILPEAPDTTPATQNVIHIDVIMLAHNPGGKERTEKEFEAL 329

Query: 61  ATAAGFSGISCERAIGNFWVMEFYK 85
           A  AGF G +      N WVMEF K
Sbjct: 330 AKGAGFKGFNKAACALNTWVMEFCK 354
Catalyzes the conversion of caffeic acid to ferulic acid and of 5-hydroxyferulic acid to sinapic acid. The resulting products may subsequently be converted to the corresponding alcohols that are incorporated into lignins.
Zinnia elegans (taxid: 34245)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 6EC: 8
>sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 Back     alignment and function description
>sp|O04385|IEMT_CLABR (Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2 Back     alignment and function description
>sp|A9X7L0|ANMT_RUTGR Anthranilate N-methyltransferase OS=Ruta graveolens PE=1 SV=1 Back     alignment and function description
>sp|Q9XGW0|COMT1_OCIBA Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1 Back     alignment and function description
>sp|P28002|COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1 Back     alignment and function description
>sp|Q8LL87|COMT1_COFCA Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1 Back     alignment and function description
>sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1 Back     alignment and function description
>sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 Back     alignment and function description
>sp|P59049|OMT1_CHRAE Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query85
145695037 353 O-methyltransferase [Citrus sinensis x C 1.0 0.240 0.905 8e-39
284437809 377 O-methyltransferase-like protein [Prunus 1.0 0.225 0.635 2e-25
224068173 359 catechol o-methyltransferase [Populus tr 1.0 0.236 0.662 6e-24
224158666129 predicted protein [Populus trichocarpa] 1.0 0.658 0.662 9e-24
224068181 336 catechol o-methyltransferase [Populus tr 1.0 0.252 0.662 2e-23
224128073 358 catechol o-methyltransferase related [Po 1.0 0.237 0.623 2e-23
356573271 372 PREDICTED: caffeic acid 3-O-methyltransf 1.0 0.228 0.627 5e-23
388512375 377 unknown [Lotus japonicus] 1.0 0.225 0.576 3e-22
388494808 362 unknown [Medicago truncatula] 1.0 0.234 0.588 4e-22
357512657 362 Caffeic acid 3-O-methyltransferase [Medi 1.0 0.234 0.588 4e-22
>gi|145695037|gb|ABP94018.1| O-methyltransferase [Citrus sinensis x Citrus reticulata] Back     alignment and taxonomy information
 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 77/85 (90%), Positives = 79/85 (92%)

Query: 1   LLKNCYKSIPEDGKVIVVESMIPEVPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTL 60
           LLKNCYKSIPEDGKVIVVESM+PEVPNTSIESK NSH DVLMMIQSPGGKERTRHEFMTL
Sbjct: 269 LLKNCYKSIPEDGKVIVVESMLPEVPNTSIESKSNSHLDVLMMIQSPGGKERTRHEFMTL 328

Query: 61  ATAAGFSGISCERAIGNFWVMEFYK 85
           AT AGF GISCE AIG+ WVMEFYK
Sbjct: 329 ATGAGFGGISCELAIGSLWVMEFYK 353

Source: Citrus sinensis x Citrus reticulata

Species: Citrus sinensis x Citrus reticulata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|284437809|gb|ADB85561.1| O-methyltransferase-like protein [Prunus mume] Back     alignment and taxonomy information
>gi|224068173|ref|XP_002302676.1| catechol o-methyltransferase [Populus trichocarpa] gi|222844402|gb|EEE81949.1| catechol o-methyltransferase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224158666|ref|XP_002337998.1| predicted protein [Populus trichocarpa] gi|222870203|gb|EEF07334.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224068181|ref|XP_002302677.1| catechol o-methyltransferase [Populus trichocarpa] gi|222844403|gb|EEE81950.1| catechol o-methyltransferase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224128073|ref|XP_002320237.1| catechol o-methyltransferase related [Populus trichocarpa] gi|118481911|gb|ABK92890.1| unknown [Populus trichocarpa] gi|222861010|gb|EEE98552.1| catechol o-methyltransferase related [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356573271|ref|XP_003554786.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|388512375|gb|AFK44249.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388494808|gb|AFK35470.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357512657|ref|XP_003626617.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula] gi|87240860|gb|ABD32718.1| O-methyltransferase, family 2; Dimerisation [Medicago truncatula] gi|355501632|gb|AES82835.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query85
TAIR|locus:2153423363 OMT1 "AT5G54160" [Arabidopsis 0.870 0.203 0.532 5.7e-17
UNIPROTKB|Q6ZD89368 ROMT-9 "Flavone 3'-O-methyltra 1.0 0.230 0.458 2.9e-16
UNIPROTKB|P93324372 P93324 "Isoliquiritigenin 2'-O 0.964 0.220 0.5 1.1e-14
TAIR|locus:2038026352 AT1G33030 [Arabidopsis thalian 1.0 0.241 0.435 4.3e-14
TAIR|locus:2199607373 IGMT1 "indole glucosinolate O- 1.0 0.227 0.441 8.6e-14
TAIR|locus:2199597373 IGMT3 "indole glucosinolate O- 1.0 0.227 0.441 8.6e-14
TAIR|locus:2199582373 IGMT4 "indole glucosinolate O- 1.0 0.227 0.441 1.1e-13
UNIPROTKB|Q84N28360 OMT1 "Flavone O-methyltransfer 1.0 0.236 0.4 7.7e-13
TAIR|locus:2199587373 IGMT2 "indole glucosinolate O- 1.0 0.227 0.430 8.5e-13
TAIR|locus:2034016363 AT1G51990 [Arabidopsis thalian 0.988 0.231 0.411 1.3e-12
TAIR|locus:2153423 OMT1 "AT5G54160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 212 (79.7 bits), Expect = 5.7e-17, P = 5.7e-17
 Identities = 41/77 (53%), Positives = 55/77 (71%)

Query:     2 LKNCYKSIPEDGKVIVVESMIPEVPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTLA 61
             LKNCY+S+PEDGKVI+ E ++PE P++S+ +K   H D +M+  +PGGKERT  EF  LA
Sbjct:   278 LKNCYESLPEDGKVILAECILPETPDSSLSTKQVVHVDCIMLAHNPGGKERTEKEFEALA 337

Query:    62 TAAGFSGIS--CERAIG 76
              A+GF GI   C+ A G
Sbjct:   338 KASGFKGIKVVCD-AFG 353
GO:0030744 "luteolin O-methyltransferase activity" evidence=IDA
GO:0030755 "quercetin 3-O-methyltransferase activity" evidence=IDA
GO:0033799 "myricetin 3'-O-methyltransferase activity" evidence=IDA
GO:0047763 "caffeate O-methyltransferase activity" evidence=ISS;IMP
GO:0051555 "flavonol biosynthetic process" evidence=IDA
GO:0009809 "lignin biosynthetic process" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006598 "polyamine catabolic process" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009698 "phenylpropanoid metabolic process" evidence=RCA
GO:0009805 "coumarin biosynthetic process" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0016126 "sterol biosynthetic process" evidence=RCA
GO:0042398 "cellular modified amino acid biosynthetic process" evidence=RCA
GO:0005829 "cytosol" evidence=TAS
UNIPROTKB|Q6ZD89 ROMT-9 "Flavone 3'-O-methyltransferase 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P93324 P93324 "Isoliquiritigenin 2'-O-methyltransferase" [Medicago sativa (taxid:3879)] Back     alignment and assigned GO terms
TAIR|locus:2038026 AT1G33030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199607 IGMT1 "indole glucosinolate O-methyltransferase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199597 IGMT3 "indole glucosinolate O-methyltransferase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199582 IGMT4 "indole glucosinolate O-methyltransferase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q84N28 OMT1 "Flavone O-methyltransferase 1" [Triticum aestivum (taxid:4565)] Back     alignment and assigned GO terms
TAIR|locus:2199587 IGMT2 "indole glucosinolate O-methyltransferase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034016 AT1G51990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
COMT5
catechol o-methyltransferase (359 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query85
pfam00891239 pfam00891, Methyltransf_2, O-methyltransferase 3e-19
>gnl|CDD|216177 pfam00891, Methyltransf_2, O-methyltransferase Back     alignment and domain information 
 Score = 77.7 bits (192), Expect = 3e-19
 Identities = 25/62 (40%), Positives = 42/62 (67%), Gaps = 2/62 (3%)

Query: 1   LLKNCYKSIPEDGKVIVVESMIPEVPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTL 60
           +LK CY+++P  GKVIVVE ++PE P+  +E+++    D+ M++ +  GKERT  E+  L
Sbjct: 180 ILKRCYEALPPGGKVIVVEMVLPEDPDDDLETEVL-LLDLNMLVLNG-GKERTEKEWRKL 237

Query: 61  AT 62
            +
Sbjct: 238 LS 239

This family includes a range of O-methyltransferases. These enzymes utilise S-adenosyl methionine. Length = 239

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 85
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 99.7
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 99.54
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.11
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.5
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.49
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.46
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.45
PLN02233261 ubiquinone biosynthesis methyltransferase 98.32
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.32
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.31
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.27
PLN02232160 ubiquinone biosynthesis methyltransferase 98.22
PLN02490340 MPBQ/MSBQ methyltransferase 98.17
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.08
PLN02336475 phosphoethanolamine N-methyltransferase 98.06
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 97.99
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 97.97
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 97.96
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 97.94
TIGR00452314 methyltransferase, putative. Known examples to dat 97.92
PLN02244340 tocopherol O-methyltransferase 97.86
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 97.77
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 97.69
PRK08317241 hypothetical protein; Provisional 97.62
PRK04266226 fibrillarin; Provisional 97.49
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 97.39
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 97.35
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 97.25
KOG4300252 consensus Predicted methyltransferase [General fun 97.23
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 97.21
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 97.21
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 97.1
KOG2361264 consensus Predicted methyltransferase [General fun 97.06
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 96.96
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 96.95
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 96.9
PLN02336 475 phosphoethanolamine N-methyltransferase 96.78
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 96.61
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 96.46
COG4798238 Predicted methyltransferase [General function pred 96.42
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 96.07
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 95.99
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 95.94
PRK11207197 tellurite resistance protein TehB; Provisional 95.85
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 95.64
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 95.59
PTZ00146293 fibrillarin; Provisional 95.49
PRK14968188 putative methyltransferase; Provisional 95.03
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 94.91
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 94.55
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 94.38
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 94.16
PRK10258251 biotin biosynthesis protein BioC; Provisional 94.12
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 93.93
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 93.87
PRK06922677 hypothetical protein; Provisional 93.54
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 93.53
PRK12335287 tellurite resistance protein TehB; Provisional 93.31
KOG3045325 consensus Predicted RNA methylase involved in rRNA 91.87
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 91.81
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 91.27
TIGR03438301 probable methyltransferase. This model represents 90.83
PF10017127 Methyltransf_33: Histidine-specific methyltransfer 90.74
PRK05785226 hypothetical protein; Provisional 88.32
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 87.41
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 86.67
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 86.66
TIGR03438301 probable methyltransferase. This model represents 86.64
PLN02585315 magnesium protoporphyrin IX methyltransferase 86.61
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 86.2
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 85.6
PRK07402196 precorrin-6B methylase; Provisional 85.52
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 85.47
TIGR00438188 rrmJ cell division protein FtsJ. 85.4
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 85.32
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 85.3
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 85.0
PRK08558238 adenine phosphoribosyltransferase; Provisional 84.62
PRK10611287 chemotaxis methyltransferase CheR; Provisional 83.75
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 83.6
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 83.01
COG0503179 Apt Adenine/guanine phosphoribosyltransferases and 82.92
KOG1270282 consensus Methyltransferases [Coenzyme transport a 82.89
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 82.67
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 82.47
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 82.35
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 81.97
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 81.83
PLN03075296 nicotianamine synthase; Provisional 81.36
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 81.29
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 81.27
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 80.58
PRK14967223 putative methyltransferase; Provisional 80.57
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 80.56
COG4627185 Uncharacterized protein conserved in bacteria [Fun 80.37
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 80.14
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information 
Probab=99.70  E-value=3.2e-17  Score=109.63  Aligned_cols=85  Identities=42%  Similarity=0.653  Sum_probs=72.9

Q ss_pred             CHHHHHhhCCCCCEEEEEeeecCC-CCCCChhhhhHHHHHHHHhhcCCCccccCHHHHHHHHHhcCCCeeEEEecCCceE
Q 042653            1 LLKNCYKSIPEDGKVIVVESMIPE-VPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTLATAAGFSGISCERAIGNFW   79 (85)
Q Consensus         1 iL~~~~~al~pggrlli~e~~~~~-~~~~~~~~~~~~~~dl~m~~~~~~g~~rt~~e~~~ll~~aGf~~~~~~~~~~~~~   79 (85)
                      ||+||+++|+|||+|+|+|.+.|+ ....+..++....+|++|+..+++|++||.+||+.++.++||....+...+..++
T Consensus       257 iLknC~~sL~~~GkIiv~E~V~p~e~~~dd~~s~v~~~~d~lm~~~~~~Gkert~~e~q~l~~~~gF~~~~~~~~~~~~~  336 (342)
T KOG3178|consen  257 ILKNCKKSLPPGGKIIVVENVTPEEDKFDDIDSSVTRDMDLLMLTQTSGGKERTLKEFQALLPEEGFPVCMVALTAYSYS  336 (342)
T ss_pred             HHHHHHHhCCCCCEEEEEeccCCCCCCccccccceeehhHHHHHHHhccceeccHHHHHhcchhhcCceeEEEeccCccc
Confidence            699999999999999999999885 2222212334578999999888789999999999999999999999999988999


Q ss_pred             EEEEEC
Q 042653           80 VMEFYK   85 (85)
Q Consensus        80 ~ie~~~   85 (85)
                      +||++|
T Consensus       337 ~Ie~~k  342 (342)
T KOG3178|consen  337 VIEFHK  342 (342)
T ss_pred             hheeCC
Confidence            999986

>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PF10017 Methyltransf_33: Histidine-specific methyltransferase, SAM-dependent; InterPro: IPR019257 This domain is found in methyltransferases and various hypothetical proteins Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query85
3reo_A368 Monolignol O-Methyltransferase (Momt) Length = 368 1e-19
1kyw_A365 Crystal Structure Analysis Of Caffeic Acid5-Hydroxy 5e-19
3p9c_A364 Crystal Structure Of Perennial Ryegrass Lpomt1 Boun 1e-16
1fp1_D372 Crystal Structure Analysis Of Chalcone O-Methyltran 2e-15
1fpq_A372 Crystal Structure Analysis Of Selenomethionine Subs 5e-14
1zg3_A358 Crystal Structure Of The Isoflavanone 4'-O-Methyltr 1e-04
1zgj_A354 Crystal Structure Of Isoflavanone 4'-O-Methyltransf 1e-04
1zga_A357 Crystal Structure Of Isoflavanone 4'-o-methyltransf 1e-04
>pdb|3REO|A Chain A, Monolignol O-Methyltransferase (Momt) Length = 368 Back     alignment and structure 
Iteration: 1

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 43/85 (50%), Positives = 55/85 (64%)
Query: 1   LLKNCYKSIPEDGKVIVVESMIPEVPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTL 60
           LLKNCY ++P+ GKVIV E ++P  P+ SI +K+  H D LM+  +PGGKERT  EF  L
Sbjct: 282 LLKNCYAALPDHGKVIVAEYILPPSPDPSIATKVVIHTDALMLAYNPGGKERTEKEFQAL 341
Query: 61  ATAAGFSGISCERAIGNFWVMEFYK 85
           A A+GF G        N +VMEF K
Sbjct: 342 AMASGFRGFKVASCAFNTYVMEFLK 366
>pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde Length = 365 Back     alignment and structure
>pdb|3P9C|A Chain A, Crystal Structure Of Perennial Ryegrass Lpomt1 Bound To Sah Length = 364 Back     alignment and structure
>pdb|1FP1|D Chain D, Crystal Structure Analysis Of Chalcone O-Methyltransferase Length = 372 Back     alignment and structure
>pdb|1FPQ|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Chalcone O- Methyltransferase Length = 372 Back     alignment and structure
>pdb|1ZG3|A Chain A, Crystal Structure Of The Isoflavanone 4'-O-Methyltransferase Complexed With Sah And 2,7,4'-Trihydroxyisoflavanone Length = 358 Back     alignment and structure
>pdb|1ZGJ|A Chain A, Crystal Structure Of Isoflavanone 4'-O-Methyltransferase Complexed With (+)-Pisatin Length = 354 Back     alignment and structure
>pdb|1ZGA|A Chain A, Crystal Structure Of Isoflavanone 4'-o-methyltransferase Complexed With (+)-6a-hydroxymaackiain Length = 357 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query85
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 4e-33
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 7e-33
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 8e-30
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 2e-26
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 4e-26
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 4e-26
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 1e-25
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 3e-25
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 4e-25
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 1e-23
2r3s_A335 Uncharacterized protein; methyltransferase domain, 2e-23
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 5e-23
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 1e-22
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 1e-21
3dp7_A363 SAM-dependent methyltransferase; structural genomi 2e-18
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 1kyz_A* 1kyw_A* Length = 368 Back     alignment and structure
 Score =  116 bits (291), Expect = 4e-33
 Identities = 43/85 (50%), Positives = 55/85 (64%)

Query: 1   LLKNCYKSIPEDGKVIVVESMIPEVPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTL 60
           LLKNCY ++P+ GKVIV E ++P  P+ SI +K+  H D LM+  +PGGKERT  EF  L
Sbjct: 282 LLKNCYAALPDHGKVIVAEYILPPSPDPSIATKVVIHTDALMLAYNPGGKERTEKEFQAL 341

Query: 61  ATAAGFSGISCERAIGNFWVMEFYK 85
           A A+GF G        N +VMEF K
Sbjct: 342 AMASGFRGFKVASCAFNTYVMEFLK 366
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Length = 358 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Length = 334 Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Length = 369 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Length = 374 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Length = 348 Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Length = 352 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Length = 332 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Length = 335 Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Length = 352 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Length = 360 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Length = 363 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query85
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 99.88
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.79
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.77
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.68
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.65
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.65
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.64
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 99.63
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.61
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 99.58
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.54
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.5
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.49
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.48
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.45
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.41
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.67
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.58
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.54
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.45
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.41
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.4
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.34
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.34
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.34
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.26
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.24
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.24
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.24
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.22
1vl5_A260 Unknown conserved protein BH2331; putative methylt 98.22
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.2
3ocj_A305 Putative exported protein; structural genomics, PS 98.19
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.19
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.18
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.16
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.16
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.16
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.12
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.11
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.11
3f4k_A257 Putative methyltransferase; structural genomics, P 98.1
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.1
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.09
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.08
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.08
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 98.06
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.04
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.0
3lcc_A235 Putative methyl chloride transferase; halide methy 97.95
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 97.95
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 97.86
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 97.86
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 97.85
2p7i_A250 Hypothetical protein; putative methyltransferase, 97.76
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 97.75
1vlm_A219 SAM-dependent methyltransferase; possible histamin 97.74
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 97.73
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 97.71
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 97.7
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 97.69
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 97.69
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 97.63
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 97.6
3gu3_A284 Methyltransferase; alpha-beta protein, structural 97.59
2i62_A265 Nicotinamide N-methyltransferase; structural genom 97.53
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 97.52
3cc8_A230 Putative methyltransferase; structural genomics, j 97.42
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 97.41
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 97.36
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 97.35
3ege_A261 Putative methyltransferase from antibiotic biosyn 97.34
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 97.29
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 97.26
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 97.23
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 97.15
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 97.14
2kw5_A202 SLR1183 protein; structural genomics, northeast st 97.1
3giw_A277 Protein of unknown function DUF574; rossmann-fold 97.07
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 96.98
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 96.92
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 96.91
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 96.89
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 96.76
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 96.76
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 96.76
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 96.65
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 96.52
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 96.49
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 96.38
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 96.36
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 96.21
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 96.01
2b3t_A276 Protein methyltransferase HEMK; translation termin 95.99
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 95.81
3m33_A226 Uncharacterized protein; structural genomics, PSI- 95.81
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 95.68
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 95.58
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 95.49
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 95.48
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 95.22
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 95.22
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 95.12
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 94.78
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 94.59
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 94.51
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 94.5
2h00_A254 Methyltransferase 10 domain containing protein; st 94.33
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 94.12
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 93.92
3m70_A286 Tellurite resistance protein TEHB homolog; structu 93.87
3lpm_A259 Putative methyltransferase; structural genomics, p 93.69
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 93.39
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 93.38
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 93.14
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 92.91
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 92.88
2frn_A278 Hypothetical protein PH0793; structural genomics, 92.79
2b25_A336 Hypothetical protein; structural genomics, methyl 92.58
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 92.3
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 92.19
3duw_A223 OMT, O-methyltransferase, putative; alternating of 91.49
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 91.13
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 91.1
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 90.85
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 89.64
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 89.58
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 89.57
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 89.14
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 89.12
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 88.58
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 88.19
4hg2_A257 Methyltransferase type 11; structural genomics, PS 88.1
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 87.53
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 87.32
1rjd_A334 PPM1P, carboxy methyl transferase for protein phos 87.1
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 86.62
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 86.51
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 86.39
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 86.08
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 85.48
1wzn_A252 SAM-dependent methyltransferase; structural genomi 85.35
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 85.1
2qm3_A373 Predicted methyltransferase; putative methyltransf 84.81
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 84.73
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 84.39
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 84.27
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 84.04
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 83.9
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 83.63
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 83.55
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 83.21
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 82.99
1yb2_A275 Hypothetical protein TA0852; structural genomics, 82.81
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 81.13
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 81.1
2km1_A136 Protein DRE2; yeast, antiapoptotic, protein bindin 81.07
1wzn_A252 SAM-dependent methyltransferase; structural genomi 80.87
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 80.87
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 80.45
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 80.23
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 80.19
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 80.09
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
Probab=99.88  E-value=3.3e-22  Score=133.37  Aligned_cols=81  Identities=26%  Similarity=0.454  Sum_probs=73.2

Q ss_pred             CHHHHHhhCCCCCEEEEEeeecCCCCCCChhhhhHHHHHHHHhhcCCCccccCHHHHHHHHHhcCCCeeEEEecCCceEE
Q 042653            1 LLKNCYKSIPEDGKVIVVESMIPEVPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTLATAAGFSGISCERAIGNFWV   80 (85)
Q Consensus         1 iL~~~~~al~pggrlli~e~~~~~~~~~~~~~~~~~~~dl~m~~~~~~g~~rt~~e~~~ll~~aGf~~~~~~~~~~~~~~   80 (85)
                      ||++|+++|+|||+|+|+|.++++++..+.   ....+|+.|++.+ +|++||.+||++||++|||+.++++++++.+++
T Consensus       265 iL~~~~~al~pgg~lli~e~~~~~~~~~~~---~~~~~dl~ml~~~-~g~ert~~e~~~ll~~AGf~~v~v~~~~~~~~~  340 (353)
T 4a6d_A          265 LLERIYHTCKPGGGILVIESLLDEDRRGPL---LTQLYSLNMLVQT-EGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDA  340 (353)
T ss_dssp             HHHHHHHHCCTTCEEEEEECCCCTTSCCCH---HHHHHHHHHHHSS-SCCCCCHHHHHHHHHHHTCEEEEEECCSSSCEE
T ss_pred             HHHHHHhhCCCCCEEEEEEeeeCCCCCCCH---HHHHHHHHHHHhC-CCcCCCHHHHHHHHHHCCCceEEEEEcCCceEE
Confidence            689999999999999999999987765554   3468999999865 999999999999999999999999999989999


Q ss_pred             EEEEC
Q 042653           81 MEFYK   85 (85)
Q Consensus        81 ie~~~   85 (85)
                      |+++|
T Consensus       341 i~ArK  345 (353)
T 4a6d_A          341 ILARK  345 (353)
T ss_dssp             EEEEC
T ss_pred             EEEEe
Confidence            99987
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2km1_A Protein DRE2; yeast, antiapoptotic, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 85
d1fp1d2244 c.66.1.12 (D:129-372) Chalcone O-methyltransferase 5e-22
d1kyza2243 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferuli 4e-19
d1fp2a2244 c.66.1.12 (A:109-352) Isoflavone O-methyltransfera 9e-17
d1qzza2256 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase 6e-11
d1tw3a2253 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransf 2e-07
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Chalcone O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]

 Score = 83.2 bits (205), Expect = 5e-22
 Identities = 42/86 (48%), Positives = 55/86 (63%), Gaps = 2/86 (2%)

Query: 1   LLKNCYKSIPEDGKVIVVESMIPEVPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTL 60
            L NC+K++  +GKVI+VE ++PE PNTS ESKL S  D LM I   GG+ERT  ++  L
Sbjct: 160 FLSNCHKALSPNGKVIIVEFILPEEPNTSEESKLVSTLDNLMFIT-VGGRERTEKQYEKL 218

Query: 61  ATAAGFSGISCE-RAIGNFWVMEFYK 85
           +  +GFS      RA  +  VMEFYK
Sbjct: 219 SKLSGFSKFQVACRAFNSLGVMEFYK 244
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 243 Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 256 Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Length = 253 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query85
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 99.88
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 99.87
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 99.87
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.76
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.66
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.68
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 98.43
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.35
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.23
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.21
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.19
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 98.17
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.16
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.09
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 98.09
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 97.82
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 97.78
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.71
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 97.61
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 96.97
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 96.57
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 96.49
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 96.3
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 95.67
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 94.07
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 93.86
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 93.13
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 91.43
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 91.35
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 90.68
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 89.7
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 88.04
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 87.85
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 87.53
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 87.25
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 86.22
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 85.81
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 85.31
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 85.29
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 84.69
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 84.64
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 83.5
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 83.37
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 83.17
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 82.93
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 82.1
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 81.01
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 81.0
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 80.94
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Chalcone O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]

Probab=99.88  E-value=3.2e-23  Score=131.55  Aligned_cols=84  Identities=48%  Similarity=0.752  Sum_probs=73.5

Q ss_pred             CHHHHHhhCCCCCEEEEEeeecCCCCCCChhhhhHHHHHHHHhhcCCCccccCHHHHHHHHHhcCCCeeEEEec-CCceE
Q 042653            1 LLKNCYKSIPEDGKVIVVESMIPEVPNTSIESKLNSHYDVLMMIQSPGGKERTRHEFMTLATAAGFSGISCERA-IGNFW   79 (85)
Q Consensus         1 iL~~~~~al~pggrlli~e~~~~~~~~~~~~~~~~~~~dl~m~~~~~~g~~rt~~e~~~ll~~aGf~~~~~~~~-~~~~~   79 (85)
                      ||+|+++||+|||+|+|+|.++|+.+..+...+....+|++|++.+ +|++||.+||++||++|||+.+++++. .+.++
T Consensus       160 iL~~~~~aL~pgg~llI~e~v~~~~~~~~~~~~~~~~~d~~m~~~~-~g~ert~~e~~~ll~~AGF~~v~v~~~~~~~~~  238 (244)
T d1fp1d2         160 FLSNCHKALSPNGKVIIVEFILPEEPNTSEESKLVSTLDNLMFITV-GGRERTEKQYEKLSKLSGFSKFQVACRAFNSLG  238 (244)
T ss_dssp             HHHHHHHHEEEEEEEEEEEEEECSSCCSSHHHHHHHHHHHHHHHHH-SCCCEEHHHHHHHHHHTTCSEEEEEEEETTTEE
T ss_pred             HHHHHHHHcCCCcEEEEEEEEecCCCCCchHHHHHHHHHHHHHhhC-CCcCCCHHHHHHHHHHcCCCceEEEecCCCCEE
Confidence            6899999999999999999999887766554445678899998764 999999999999999999999999755 47899


Q ss_pred             EEEEEC
Q 042653           80 VMEFYK   85 (85)
Q Consensus        80 ~ie~~~   85 (85)
                      |||++|
T Consensus       239 viE~~K  244 (244)
T d1fp1d2         239 VMEFYK  244 (244)
T ss_dssp             EEEEEC
T ss_pred             EEEEeC
Confidence            999997
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure