Citrus Sinensis ID: 042690


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260------
SGCLILNLEADPSQYENRVFGSFSHIYSLKKPCGGSFSTVYTGVLAPGDKTNIGVKKLDKVVHVAHHKNLVCLLGYHIEQECRLLVYKFMHNRSISSLLYECLRPTWQQRMQDCIRDCWRTRALACRILLHDYFTVETSDLGLAKLLMINQTQTLTGMRETKGYLPPEWFRNMPVTVKVDVYSFGVMLLEIISCRCVERQGSDPKTLEKPVMIAIQFVKEKPPLRPSLRIVALMLQSILEVPSPPCSFAFAIRIGSSAISQVCVCK
ccccccccccccccEEHHHHHHHHccccccccccccccEEEEEEEccccccEEEEEEccHHHHHccccccccEEEEEccccEEEEEEEccccccHHHHHcccccccHHHHHHHHHccEEEEcccccccccccccccccccccccccccccccEEEEEcccccccccHHcccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccccccccEEEcccccccccEEEc
cccEEEEccccccEEcHHHHHHHHccccHHcccccccccEEccccccccHEEEHHHHHHHHHHHHHHHHHHHHHEEEcccccEEEEEEEcccccHHHHHcccccccHHHHHHHccccEEEEcccHccEEEcccccccHcHccHHEEccccccEEEEEEEEccccccHHHHHccccccccHHHHHHEEEEEEHcccccccccccHHHHHHHHHHHHHHHHccHcccccHHHHHHHHccccccccccccccEEEcccccccccccccc
sgclilnleadpsqyenrvfGSFSHIyslkkpcggsfstvytgvlapgdktnigvkklDKVVHVAHHKNLVCLLGYHIEQECRLLVYKFMHNRSISSLLYECLRPTWQQRMQDCIRDCWRTRALACRILLHdyftvetsDLGLAKLLMINQTQTltgmretkgylppewfrnmpvtvkVDVYSFGVMLLEIISCRcverqgsdpktlekPVMIAIQFvkekpplrpsLRIVALMLQSIlevpsppcsfAFAIRIGSSAISQVCVCK
sgclilnleadpsqyeNRVFGSFSHIYSLKKPCGGSFSTVYTGVLAPGDKTNIGVKKLDKVVHVAHHKNLVCLLGYHIEQECRLLVYKFMHNRSISSLLYECLRPTWQQRMQDCIRDCWRTRALACRILLHDYFTVETSDLGLAKLLMINQTQTLTGMRETKgylppewfrnmPVTVKVDVYSFGVMLLEIISCRCVErqgsdpktlekPVMIAIQFvkekpplrpSLRIVALMLQSILEVPSPPCSFAFAIRIGSSAISQVCVCK
SGCLILNLEADPSQYENRVFGSFSHIYSLKKPCGGSFSTVYTGVLAPGDKTNIGVKKLDKVVHVAHHKNLVCLLGYHIEQECRLLVYKFMHNRSISSLLYECLRPTWQQRMQDCIRDCWRTRALACRILLHDYFTVETSDLGLAKLLMINQTQTLTGMRETKGYLPPEWFRNMPVTVKVDVYSFGVMLLEIISCRCVERQGSDPKTLEKPVMIAIQFVKEKPPLRPSLRIVALMLQSILEVPSPPCSFAFAIRIGSSAISQVCVCK
**CLILNLEADPSQYENRVFGSFSHIYSLKKPCGGSFSTVYTGVLAPGDKTNIGVKKLDKVVHVAHHKNLVCLLGYHIEQECRLLVYKFMHNRSISSLLYECLRPTWQQRMQDCIRDCWRTRALACRILLHDYFTVETSDLGLAKLLMINQTQTLTGMRETKGYLPPEWFRNMPVTVKVDVYSFGVMLLEIISCRCVERQG***KTLEKPVMIAIQFVKEKPPLRPSLRIVALMLQSILEVPSPPCSFAFAIRIGSSAISQVCVC*
*******LEADPSQYENRVFGSFSHIYSLKKPCGGSFSTVYTGVLAPGDKTNIGVKKLDKVVHVAHHKNLVCLLGYHIEQECRLLVYKFMHNRSISSLLYECLRPTWQQRMQDCIRDCWRTRALACRILLHDYFTVETSDLGLAKLLMINQTQTLTGMRETKGYLPPEWFRNMPVTVKVDVYSFGVMLLEIISCRCVE****DPKTLEKPVMIAIQFVKEKPPLRPSLRIVALMLQSILEVPS*********************C*
SGCLILNLEADPSQYENRVFGSFSHIYSLKKPCGGSFSTVYTGVLAPGDKTNIGVKKLDKVVHVAHHKNLVCLLGYHIEQECRLLVYKFMHNRSISSLLYECLRPTWQQRMQDCIRDCWRTRALACRILLHDYFTVETSDLGLAKLLMINQTQTLTGMRETKGYLPPEWFRNMPVTVKVDVYSFGVMLLEIISCRCVERQGSDPKTLEKPVMIAIQFVKEKPPLRPSLRIVALMLQSILEVPSPPCSFAFAIRIGSSAISQVCVCK
*GCLILNLEADPSQYENRVFGSFSHIYSLKKPCGGSFSTVYTGVLAPGDKTNIGVKKLDKVVHVAHHKNLVCLLGYHIEQECRLLVYKFMHNRSISSLLYECLRPTWQQRMQDCIRDCWRTRALACRILLHDYFTVETSDLGLAKLLMINQTQTLTGMRETKGYLPPEWFRNMPVTVKVDVYSFGVMLLEIISCRCVERQGSDPKTLEKPVMIAIQFVKEKPPLRPSLRIVALMLQSILEVPSPPCSFAFAI**************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SGCLILNLEADPSQYENRVFGSFSHIYSLKKPCGGSFSTVYTGVLAPGDKTNIGVKKLDKVVHVAHHKNLVCLLGYHIEQECRLLVYKFMHNRSISSLLYECLRPTWQQRMQDCIRDCWRTRALACRILLHDYFTVETSDLGLAKLLMINQTQTLTGMRETKGYLPPEWFRNMPVTVKVDVYSFGVMLLEIISCRCVERQGSDPKTLEKPVMIAIQFVKEKPPLRPSLRIVALMLQSILEVPSPPCSFAFAIRIGSSAISQVCVCK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query266 2.2.26 [Sep-21-2011]
Q39202832 G-type lectin S-receptor- yes no 0.793 0.253 0.370 7e-40
Q9XID3829 G-type lectin S-receptor- no no 0.804 0.258 0.305 1e-26
Q9FLV4872 G-type lectin S-receptor- no no 0.597 0.182 0.357 9e-24
Q8RWZ5821 G-type lectin S-receptor- no no 0.943 0.305 0.271 3e-23
O64477828 G-type lectin S-receptor- no no 0.785 0.252 0.301 2e-22
O65238872 G-type lectin S-receptor- no no 0.770 0.235 0.295 1e-21
Q3E9X6690 Cysteine-rich receptor-li no no 0.838 0.323 0.293 2e-21
O65468676 Cysteine-rich receptor-li no no 0.890 0.350 0.289 2e-20
Q8L7G3659 Cysteine-rich receptor-li no no 0.860 0.347 0.289 2e-20
Q9C5S9674 Cysteine-rich receptor-li no no 0.890 0.351 0.289 3e-20
>sp|Q39202|RLK1_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 OS=Arabidopsis thaliana GN=RLK1 PE=2 SV=2 Back     alignment and function desciption
 Score =  164 bits (415), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 100/270 (37%), Positives = 146/270 (54%), Gaps = 59/270 (21%)

Query: 35  GSFSTVYTGVL--APGDKTNIGVKKLD--------------KVVHVAHHKNLVCLLGYHI 78
           G+F  VY G L  A G +  + VKKLD              KV+   HHKNLV L+G+  
Sbjct: 540 GAFGIVYKGYLEVAGGSEVTVAVKKLDRLDLDNEKEFKNEVKVIGQIHHKNLVRLIGFCN 599

Query: 79  EQECRLLVYKFMHNRSISSLLYECLRPTWQQRM--------------QDCIRDCWRTRAL 124
           E + +++VY+F+   ++++ L+   RP+W+ R               ++C          
Sbjct: 600 EGQSQMIVYEFLPQGTLANFLFRRPRPSWEDRKNIAVAIARGILYLHEECSEQIIHCDIK 659

Query: 125 ACRILLHDYFTVETSDLGLAKLLMINQTQTLTGMRETKGYLPPEWFRNMPVTVKVDVYSF 184
              ILL +Y+T   SD GLAKLL++NQT TLT +R TKGY+ PEWFRN P+T KVDVYS+
Sbjct: 660 PQNILLDEYYTPRISDFGLAKLLLMNQTYTLTNIRGTKGYVAPEWFRNSPITSKVDVYSY 719

Query: 185 GVMLLEIISCR-CVE---------------RQG-------------SDPKTLEKPVMIAI 215
           GVMLLEI+ C+  V+               RQG             +D +T+E+ V IAI
Sbjct: 720 GVMLLEIVCCKKAVDLEDNVILINWAYDCFRQGRLEDLTEDDSEAMNDMETVERYVKIAI 779

Query: 216 QFVKEKPPLRPSLRIVALMLQSILEVPSPP 245
             ++E+  +RP++R V  ML+ +++V  PP
Sbjct: 780 WCIQEEHGMRPNMRNVTQMLEGVIQVFDPP 809





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9XID3|Y1343_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300 OS=Arabidopsis thaliana GN=At1g34300 PE=1 SV=1 Back     alignment and function description
>sp|Q9FLV4|Y5248_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080 OS=Arabidopsis thaliana GN=At5g24080 PE=2 SV=1 Back     alignment and function description
>sp|Q8RWZ5|SD25_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5 OS=Arabidopsis thaliana GN=SD25 PE=1 SV=1 Back     alignment and function description
>sp|O64477|Y2913_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130 OS=Arabidopsis thaliana GN=At2g19130 PE=2 SV=1 Back     alignment and function description
>sp|O65238|Y5537_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At5g35370 OS=Arabidopsis thaliana GN=At5g35370 PE=2 SV=2 Back     alignment and function description
>sp|Q3E9X6|CRK21_ARATH Cysteine-rich receptor-like protein kinase 21 OS=Arabidopsis thaliana GN=CRK21 PE=2 SV=1 Back     alignment and function description
>sp|O65468|CRK8_ARATH Cysteine-rich receptor-like protein kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=2 Back     alignment and function description
>sp|Q8L7G3|CRK7_ARATH Cysteine-rich receptor-like protein kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=2 SV=1 Back     alignment and function description
>sp|Q9C5S9|CRK6_ARATH Cysteine-rich receptor-like protein kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query266
255542171 822 BRASSINOSTEROID INSENSITIVE 1-associated 0.778 0.251 0.473 7e-50
224143655 417 predicted protein [Populus trichocarpa] 0.812 0.517 0.417 1e-46
359487487 808 PREDICTED: G-type lectin S-receptor-like 0.800 0.263 0.422 1e-45
224120872 704 predicted protein [Populus trichocarpa] 0.812 0.306 0.4 5e-44
224073224 699 predicted protein [Populus trichocarpa] 0.898 0.341 0.374 8e-44
224143661 691 predicted protein [Populus trichocarpa] 0.812 0.312 0.394 9e-44
359487480 793 PREDICTED: G-type lectin S-receptor-like 0.812 0.272 0.412 2e-43
356555135 815 PREDICTED: G-type lectin S-receptor-like 0.793 0.258 0.394 3e-43
356503089 807 PREDICTED: G-type lectin S-receptor-like 0.793 0.261 0.394 3e-43
356528738 816 PREDICTED: G-type lectin S-receptor-like 0.819 0.267 0.385 4e-43
>gi|255542171|ref|XP_002512149.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] gi|223548693|gb|EEF50183.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  203 bits (516), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 150/266 (56%), Gaps = 59/266 (22%)

Query: 35  GSFSTVYTGVLAPGDKTNIGVKKLDKVVHVA--------------HHKNLVCLLGYHIEQ 80
           G+F TVY G+L    +  I VKKL+K+V                 HHKNLV LLGY  E 
Sbjct: 525 GAFGTVYKGLLPSSTRNYIAVKKLEKMVQEGQKEFLSEVNTIGQTHHKNLVQLLGYCYEG 584

Query: 81  ECRLLVYKFMHNRSISSLLYECLRPTWQQRMQ--------------DCIRDCWRTRALAC 126
           E RLLVY+FM N S+SS L+   R  WQQR+Q              +C +          
Sbjct: 585 EGRLLVYEFMQNGSLSSFLFGSPRLNWQQRVQIASGIARGLMYLHEECSKQIIHCDIKPQ 644

Query: 127 RILLHDYFTVETSDLGLAKLLMINQTQTLTGMRETKGYLPPEWFRNMPVTVKVDVYSFGV 186
            ILL D FT + SD GLAKLL+ NQT+TLTG+R TKGY+ PEWFRN PV+VKVDVYSFGV
Sbjct: 645 NILLDDTFTAKISDFGLAKLLINNQTRTLTGIRGTKGYVAPEWFRNTPVSVKVDVYSFGV 704

Query: 187 MLLEIISC-RCVE-----------------RQG-------------SDPKTLEKPVMIAI 215
           MLLEII C RCVE                  QG             SD K LEK VM+A+
Sbjct: 705 MLLEIICCRRCVEFEMEKEAILADWAYECYHQGKVETLVLNDQEARSDLKKLEKFVMVAL 764

Query: 216 QFVKEKPPLRPSLRIVALMLQSILEV 241
             V+++P LRPS+R V LML+ ILEV
Sbjct: 765 WCVQDEPLLRPSMRTVTLMLEGILEV 790




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224143655|ref|XP_002336065.1| predicted protein [Populus trichocarpa] gi|222869873|gb|EEF07004.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359487487|ref|XP_002269067.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224120872|ref|XP_002330847.1| predicted protein [Populus trichocarpa] gi|222872669|gb|EEF09800.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073224|ref|XP_002304031.1| predicted protein [Populus trichocarpa] gi|222841463|gb|EEE79010.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224143661|ref|XP_002336066.1| predicted protein [Populus trichocarpa] gi|222869874|gb|EEF07005.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359487480|ref|XP_002268890.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356555135|ref|XP_003545892.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1-like [Glycine max] Back     alignment and taxonomy information
>gi|356503089|ref|XP_003520344.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1-like [Glycine max] Back     alignment and taxonomy information
>gi|356528738|ref|XP_003532956.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query266
TAIR|locus:2182603872 AT5G35370 [Arabidopsis thalian 0.522 0.159 0.364 3.2e-23
TAIR|locus:2026155829 AT1G34300 [Arabidopsis thalian 0.308 0.098 0.430 6.2e-23
TAIR|locus:2116525821 SD2-5 "S-domain-2 5" [Arabidop 0.293 0.095 0.481 4.4e-17
TAIR|locus:2121706690 CRK21 "cysteine-rich RLK (RECE 0.255 0.098 0.463 5.8e-17
TAIR|locus:2141762665 CRK26 "cysteine-rich RLK (RECE 0.349 0.139 0.345 1.2e-16
TAIR|locus:2059103828 AT2G19130 [Arabidopsis thalian 0.398 0.128 0.385 4e-16
TAIR|locus:2019180399 AT1G74490 [Arabidopsis thalian 0.582 0.388 0.377 8.4e-16
TAIR|locus:2121651676 CRK8 "cysteine-rich RLK (RECEP 0.372 0.146 0.336 2e-15
TAIR|locus:2027559492 AT1G56720 [Arabidopsis thalian 0.255 0.138 0.455 2.4e-15
UNIPROTKB|Q40234321 Pto "Pto disease resistance pr 0.484 0.401 0.358 2.7e-15
TAIR|locus:2182603 AT5G35370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 217 (81.4 bits), Expect = 3.2e-23, Sum P(3) = 3.2e-23
 Identities = 58/159 (36%), Positives = 84/159 (52%)

Query:    67 HKNLVCLLGYHIEQECRLLVYKFMHNRSISSLLYECLRPT--WQQRMQDCI--------- 115
             H NLV L G+       LLVY++M++ S+   L+    P   WQ+R    +         
Sbjct:   568 HTNLVKLRGFCARGRQLLLVYEYMNHGSLEKTLFSGNGPVLEWQERFDIALGTARGLAYL 627

Query:   116 -RDCWRTRALAC-----RILLHDYFTVETSDLGLAKLLMINQTQTLTGMRETKGYLPPEW 169
                C + + + C      ILLHD+F  + SD GL+KLL   ++   T MR T+GYL PEW
Sbjct:   628 HSGCDQ-KIIHCDVKPENILLHDHFQPKISDFGLSKLLNQEESSLFTTMRGTRGYLAPEW 686

Query:   170 FRNMPVTVKVDVYSFGVMLLEIISCR--CVERQGSDPKT 206
               N  ++ K DVYS+G++LLE++S R  C  R  S+  T
Sbjct:   687 ITNAAISEKADVYSYGMVLLELVSGRKNCSFRSRSNSVT 725


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0030246 "carbohydrate binding" evidence=IEA;ISS
TAIR|locus:2026155 AT1G34300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116525 SD2-5 "S-domain-2 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121706 CRK21 "cysteine-rich RLK (RECEPTOR-like protein kinase) 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141762 CRK26 "cysteine-rich RLK (RECEPTOR-like protein kinase) 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059103 AT2G19130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019180 AT1G74490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121651 CRK8 "cysteine-rich RLK (RECEPTOR-like protein kinase) 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027559 AT1G56720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40234 Pto "Pto disease resistance protein" [Solanum pimpinellifolium (taxid:4084)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.10930002
hypothetical protein (417 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query266
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 4e-16
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 2e-14
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 2e-13
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 5e-13
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-12
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 2e-11
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 1e-09
pfam00069260 pfam00069, Pkinase, Protein kinase domain 1e-08
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 8e-08
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 1e-07
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 5e-07
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 1e-06
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 1e-06
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 1e-06
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 2e-06
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 2e-06
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 3e-06
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 5e-06
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 6e-06
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 8e-06
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 2e-05
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 3e-05
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 3e-05
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 3e-05
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 5e-05
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 6e-05
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 9e-05
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 9e-05
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-04
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 1e-04
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 1e-04
cd05089297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 2e-04
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 3e-04
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 4e-04
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 4e-04
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 5e-04
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 5e-04
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-04
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 5e-04
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 6e-04
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 6e-04
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 6e-04
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 7e-04
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 8e-04
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 0.001
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 0.001
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 0.001
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 0.001
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 0.002
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 0.002
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 0.003
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 0.003
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 0.003
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 0.004
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 0.004
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 0.004
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
 Score = 74.6 bits (184), Expect = 4e-16
 Identities = 42/194 (21%), Positives = 69/194 (35%), Gaps = 35/194 (18%)

Query: 35  GSFSTVYTGVLAPGDKTNIGVKKLDKVVHVA---------------HHKNLVCLLGYHIE 79
           G F TVY           + +K + K    +               +H N+V L G   +
Sbjct: 4   GGFGTVYLARD-KKTGKKVAIKIIKKEDSSSLLEELLREIEILKKLNHPNIVKLYGVFED 62

Query: 80  QECRLLVYKFMHNRSISSLLYECLRPTWQQRMQDCIRDCWRTRALAC------------- 126
           +    LV ++    S+  LL E      +  +   +        L               
Sbjct: 63  ENHLYLVMEYCEGGSLKDLLKENEGKLSEDEILRILLQI--LEGLEYLHSNGIIHRDLKP 120

Query: 127 -RILLH-DYFTVETSDLGLAKLLMINQTQTLTGMRETKGYLPPE-WFRNMPVTVKVDVYS 183
             ILL  D   V+ +D GL+KLL  +    L  +  T  Y+ PE        + K D++S
Sbjct: 121 ENILLDSDNGKVKLADFGLSKLL-TSDKSLLKTIVGTPAYMAPEVLLGKGYYSEKSDIWS 179

Query: 184 FGVMLLEIISCRCV 197
            GV+L E+   + +
Sbjct: 180 LGVILYELPELKDL 193


Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which one kinase activates a second kinase, which in turn, may act on other kinases; this sequential action transmits a signal from the cell surface to target proteins, which results in cellular responses. The PK family is one of the largest known protein families with more than 100 homologous yeast enzymes and 550 human proteins. A fraction of PK family members are pseudokinases that lack crucial residues for catalytic activity. The mutiplicity of kinases allows for specific regulation according to substrate, tissue distribution, and cellular localization. PKs regulate many cellular processes including proliferation, division, differentiation, motility, survival, metabolism, cell-cycle progression, cytoskeletal rearrangement, immunity, and neuronal functions. Many kinases are implicated in the development of various human diseases including different types of cancer. Length = 215

>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 266
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0595 429 consensus Serine/threonine-protein kinase involved 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0197468 consensus Tyrosine kinases [Signal transduction me 100.0
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG4721 904 consensus Serine/threonine protein kinase, contain 100.0
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0661 538 consensus MAPK related serine/threonine protein ki 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 100.0
KOG0201 467 consensus Serine/threonine protein kinase [Signal 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
KOG0582 516 consensus Ste20-like serine/threonine protein kina 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
KOG1026774 consensus Nerve growth factor receptor TRKA and re 100.0
KOG0589 426 consensus Serine/threonine protein kinase [General 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG1187361 consensus Serine/threonine protein kinase [Signal 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0663419 consensus Protein kinase PITSLRE and related kinas 100.0
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
PHA02988283 hypothetical protein; Provisional 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 100.0
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 100.0
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 100.0
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 100.0
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
KOG0611 668 consensus Predicted serine/threonine protein kinas 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 100.0
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
KOG0660359 consensus Mitogen-activated protein kinase [Signal 100.0
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 100.0
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
KOG1989 738 consensus ARK protein kinase family [Signal transd 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
KOG0596677 consensus Dual specificity; serine/threonine and t 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 100.0
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 100.0
PTZ00267 478 NIMA-related protein kinase; Provisional 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 100.0
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
KOG0694694 consensus Serine/threonine protein kinase [Signal 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 100.0
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 100.0
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 100.0
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 100.0
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 100.0
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 100.0
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 100.0
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 100.0
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 100.0
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 100.0
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 100.0
PTZ00283 496 serine/threonine protein kinase; Provisional 100.0
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 100.0
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 100.0
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 100.0
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 100.0
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 100.0
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 100.0
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 100.0
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 100.0
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 100.0
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 100.0
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 100.0
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 100.0
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 100.0
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 100.0
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 100.0
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 100.0
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 100.0
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 100.0
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 100.0
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 100.0
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 100.0
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 100.0
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 100.0
KOG0577 948 consensus Serine/threonine protein kinase [Signal 100.0
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 100.0
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 100.0
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 100.0
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 100.0
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 100.0
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 100.0
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 100.0
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 100.0
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 100.0
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 100.0
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 100.0
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 100.0
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 100.0
PHA03209357 serine/threonine kinase US3; Provisional 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 100.0
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 100.0
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 100.0
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 100.0
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 100.0
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 100.0
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 100.0
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 100.0
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 100.0
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 100.0
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 100.0
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 100.0
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 100.0
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 100.0
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 100.0
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 100.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 100.0
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 100.0
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 100.0
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 100.0
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 100.0
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 100.0
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 100.0
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 100.0
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 100.0
PHA03207392 serine/threonine kinase US3; Provisional 100.0
PHA03211461 serine/threonine kinase US3; Provisional 100.0
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 100.0
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 100.0
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 100.0
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 100.0
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 100.0
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 100.0
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 100.0
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 100.0
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 100.0
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 100.0
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 100.0
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 100.0
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 100.0
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 100.0
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 100.0
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 100.0
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 100.0
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 100.0
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 100.0
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 100.0
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 100.0
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 100.0
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 100.0
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 100.0
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 100.0
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 100.0
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 100.0
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 100.0
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 100.0
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 100.0
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 100.0
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 100.0
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 100.0
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 100.0
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 100.0
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 100.0
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 100.0
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 100.0
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 100.0
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 100.0
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 100.0
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 100.0
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 100.0
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 100.0
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 100.0
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 100.0
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 100.0
PTZ00266 1021 NIMA-related protein kinase; Provisional 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 100.0
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 100.0
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 100.0
KOG4717 864 consensus Serine/threonine protein kinase [Signal 100.0
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 100.0
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 100.0
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 100.0
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 100.0
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.98
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.98
PHA03210501 serine/threonine kinase US3; Provisional 99.98
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.98
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.98
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.98
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.98
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.98
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.98
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.98
PLN00009294 cyclin-dependent kinase A; Provisional 99.98
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.98
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.98
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.98
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.98
PTZ00284467 protein kinase; Provisional 99.98
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.98
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.98
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.98
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.98
KOG0586 596 consensus Serine/threonine protein kinase [General 99.98
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.98
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.98
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.98
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.98
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.98
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.98
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.97
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.97
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.97
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 99.97
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.97
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.97
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.97
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.97
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.97
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.97
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.97
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.97
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.97
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.97
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.97
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.97
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.97
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.97
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.97
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.97
KOG0584 632 consensus Serine/threonine protein kinase [General 99.97
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.97
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.97
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.97
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.97
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.97
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.97
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.97
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.97
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.97
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.97
PHA02882294 putative serine/threonine kinase; Provisional 99.97
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.97
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.97
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.97
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.97
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.97
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.97
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.97
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.97
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.97
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.97
KOG0610459 consensus Putative serine/threonine protein kinase 99.97
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.97
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.97
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 99.97
KOG3653534 consensus Transforming growth factor beta/activin 99.97
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.97
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.97
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.97
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.97
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.97
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.97
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.97
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.97
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.97
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.97
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.97
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.97
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.97
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.97
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.97
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.97
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.97
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.97
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.97
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.97
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.97
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.97
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.97
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.97
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.97
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.96
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.96
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.96
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 99.96
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.96
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.96
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.96
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.96
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.96
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.96
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.96
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.96
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.96
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.96
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.96
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.96
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.96
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.96
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.96
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.96
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.95
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 99.95
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.95
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.94
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.94
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.94
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.94
KOG1152772 consensus Signal transduction serine/threonine kin 99.94
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.94
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.93
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.93
PLN03224507 probable serine/threonine protein kinase; Provisio 99.93
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.93
KOG1027 903 consensus Serine/threonine protein kinase and endo 99.93
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.93
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.93
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.93
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.93
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 99.91
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.91
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.91
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.9
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.89
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.89
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.87
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.87
PLN00181 793 protein SPA1-RELATED; Provisional 99.86
KOG1167418 consensus Serine/threonine protein kinase of the C 99.86
PRK09188365 serine/threonine protein kinase; Provisional 99.78
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.71
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.71
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 99.68
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.68
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.68
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.66
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.65
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.6
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 99.6
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.59
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.57
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.55
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.55
PRK12274218 serine/threonine protein kinase; Provisional 99.51
PRK14879211 serine/threonine protein kinase; Provisional 99.49
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.49
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.48
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.48
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.42
PRK10345210 hypothetical protein; Provisional 99.37
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.37
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.3
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.26
smart00090237 RIO RIO-like kinase. 99.21
KOG1243 690 consensus Protein kinase [General function predict 99.16
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.06
KOG1266458 consensus Protein kinase [Signal transduction mech 99.02
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.98
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 98.95
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 98.9
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 98.87
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.87
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 98.86
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 98.55
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 98.5
KOG3741 655 consensus Poly(A) ribonuclease subunit [RNA proces 98.46
KOG06061205 consensus Microtubule-associated serine/threonine 98.43
COG4248 637 Uncharacterized protein with protein kinase and he 98.05
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 97.98
KOG3087229 consensus Serine/threonine protein kinase [General 97.97
COG0478304 RIO-like serine/threonine protein kinase fused to 97.95
COG0661517 AarF Predicted unusual protein kinase [General fun 97.91
KOG2137 700 consensus Protein kinase [Signal transduction mech 97.88
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 97.63
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 97.57
KOG1235538 consensus Predicted unusual protein kinase [Genera 97.5
KOG0576 829 consensus Mitogen-activated protein kinase kinase 97.41
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 97.41
KOG1093 725 consensus Predicted protein kinase (contains TBC a 97.39
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 97.21
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 97.18
KOG2268465 consensus Serine/threonine protein kinase [Signal 97.12
PRK09902216 hypothetical protein; Provisional 96.97
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 96.81
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 96.32
COG1718268 RIO1 Serine/threonine protein kinase involved in c 96.28
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 95.84
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 95.38
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 95.29
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 95.12
PF01636239 APH: Phosphotransferase enzyme family This family 93.18
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoser 91.85
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 91.73
PHA00451362 protein kinase 91.46
KOG1826 2724 consensus Ras GTPase activating protein RasGAP/neu 90.71
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 90.4
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 89.04
TIGR01767 370 MTRK 5-methylthioribose kinase. This enzyme is inv 88.25
PLN02756 418 S-methyl-5-thioribose kinase 86.82
PLN02876 822 acyl-CoA dehydrogenase 84.01
PRK10593297 hypothetical protein; Provisional 82.68
KOG1033 516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 80.97
cd00891352 PI3Kc Phosphoinositide 3-kinase (PI3K), catalytic 80.81
PRK09550 401 mtnK methylthioribose kinase; Reviewed 80.02
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
Probab=100.00  E-value=3.6e-42  Score=297.14  Aligned_cols=209  Identities=17%  Similarity=0.245  Sum_probs=186.5

Q ss_pred             CceeeeeccCCCcceEEEEEEEcCCCcceeeeeeHH-----------------HHhhhcCCCceeeeeeEEEeCCeEEEE
Q 042690           24 SHIYSLKKPCGGSFSTVYTGVLAPGDKTNIGVKKLD-----------------KVVHVAHHKNLVCLLGYHIEQECRLLV   86 (266)
Q Consensus        24 ~~~~~~~~ig~G~~g~V~~~~~~~~~~~~vaiK~~~-----------------~~l~~~~h~~iv~~~~~~~~~~~~~lv   86 (266)
                      ..|...+.||+|+|..||.++.. .++..||+|++.                 ++.+.++|||||+++++|++.+..|+|
T Consensus        18 ~~Y~~g~~LGkGgFA~cYe~~~~-~tge~~A~KvVpk~~l~k~~~reKv~~EIeIHr~L~HpnIV~f~~~FEDs~nVYiv   96 (592)
T KOG0575|consen   18 KRYKRGRFLGKGGFARCYEARDL-DTGEVVAVKVVPKKLLKKPKQREKVLNEIEIHRSLKHPNIVQFYHFFEDSNNVYIV   96 (592)
T ss_pred             ceeeeeeeeccCcceEEEEEEEc-CCCcEEEEEEeehHHhcCcchHHHHHHHHHHHHhcCCCcEEeeeeEeecCCceEEE
Confidence            57999999999999999999985 589999999887                 378899999999999999999999999


Q ss_pred             EEcCCCCCHHHHHhhcCCCC------HHHHHHHHHHHhhhcCcccc-----ceeecCCCEEEEeecCcceeecccccccc
Q 042690           87 YKFMHNRSISSLLYECLRPT------WQQRMQDCIRDCWRTRALAC-----RILLHDYFTVETSDLGLAKLLMINQTQTL  155 (266)
Q Consensus        87 ~e~~~~~~L~~~l~~~~~~~------~~~~l~~~~~~~~~~~~~h~-----nili~~~~~~~l~Dfg~a~~~~~~~~~~~  155 (266)
                      +|+|+.++|..+++....++      +..++...+.++|.++++|+     |+|++++.++|++|||+|..+. .+....
T Consensus        97 LELC~~~sL~el~Krrk~ltEpEary~l~QIv~GlkYLH~~~IiHRDLKLGNlfL~~~~~VKIgDFGLAt~le-~~~Erk  175 (592)
T KOG0575|consen   97 LELCHRGSLMELLKRRKPLTEPEARYFLRQIVEGLKYLHSLGIIHRDLKLGNLFLNENMNVKIGDFGLATQLE-YDGERK  175 (592)
T ss_pred             EEecCCccHHHHHHhcCCCCcHHHHHHHHHHHHHHHHHHhcCceecccchhheeecCcCcEEecccceeeeec-Cccccc
Confidence            99999999999999666654      45677777899999999999     9999999999999999999876 345566


Q ss_pred             ccccCCCCcCCccccCCCCCCcccchhhHHHHHHHHHhCCCcccCC---------------CCccccchHHHHHHHhhhc
Q 042690          156 TGMRETKGYLPPEWFRNMPVTVKVDVYSFGVMLLEIISCRCVERQG---------------SDPKTLEKPVMIAIQFVKE  220 (266)
Q Consensus       156 ~~~~~~~~y~aPE~~~~~~~~~~~Di~slG~i~~~l~tg~~p~~~~---------------~~~~~~~~~~~l~~~cl~~  220 (266)
                      ...+||+.|.|||++.....+..+||||+||++|.|+.|++||...               .|...+....++|.++|+.
T Consensus       176 ~TlCGTPNYIAPEVl~k~gHsfEvDiWSlGcvmYtLL~G~PPFetk~vkety~~Ik~~~Y~~P~~ls~~A~dLI~~lL~~  255 (592)
T KOG0575|consen  176 KTLCGTPNYIAPEVLNKSGHSFEVDIWSLGCVMYTLLVGRPPFETKTVKETYNKIKLNEYSMPSHLSAEAKDLIRKLLRP  255 (592)
T ss_pred             ceecCCCcccChhHhccCCCCCchhhhhhhhHHHhhhhCCCCcccchHHHHHHHHHhcCcccccccCHHHHHHHHHHhcC
Confidence            7789999999999999888999999999999999999999999873               2455667778999999999


Q ss_pred             CCCCCCCHHHHHHH
Q 042690          221 KPPLRPSLRIVALM  234 (266)
Q Consensus       221 ~p~~Rps~~~il~~  234 (266)
                      ||.+|||+++|+.-
T Consensus       256 ~P~~Rpsl~~vL~h  269 (592)
T KOG0575|consen  256 NPSERPSLDEVLDH  269 (592)
T ss_pred             CcccCCCHHHHhcC
Confidence            99999999999853



>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>PHA00451 protein kinase Back     alignment and domain information
>KOG1826 consensus Ras GTPase activating protein RasGAP/neurofibromin [Defense mechanisms] Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>TIGR01767 MTRK 5-methylthioribose kinase Back     alignment and domain information
>PLN02756 S-methyl-5-thioribose kinase Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00891 PI3Kc Phosphoinositide 3-kinase (PI3K), catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query266
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 1e-16
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 2e-16
3tl8_A349 The Avrptob-Bak1 Complex Reveals Two Structurally S 8e-15
3uim_A326 Structural Basis For The Impact Of Phosphorylation 2e-13
2nry_A307 Crystal Structure Of Irak-4 Length = 307 7e-12
2nru_A307 Crystal Structure Of Irak-4 Length = 307 1e-11
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 5e-11
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 2e-10
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 4e-07
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 6e-07
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 6e-07
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 6e-07
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 6e-07
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 1e-06
3dkg_A317 Sgx Clone 5698a109kfg1h1 Length = 317 1e-06
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 1e-06
3q6w_A307 Structure Of Dually-phosphorylated Met Receptor Kin 1e-06
3c1x_A373 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-06
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-06
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 2e-06
3qti_A314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 2e-06
3cth_A314 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-06
3dkc_A317 Sgx Clone 5698a65kfg1h1 Length = 317 2e-06
3a4p_A319 Human C-Met Kinase Domain Complexed With 6-Benzylox 2e-06
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 2e-06
1r0p_A312 Crystal Structure Of The Tyrosine Kinase Domain Of 3e-06
2g15_A318 Structural Characterization Of Autoinhibited C-Met 3e-06
3q6u_A308 Structure Of The Apo Met Receptor Kinase In The Dua 3e-06
4gg5_A319 Crystal Structure Of Cmet In Complex With Novel Inh 3e-06
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 3e-06
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 3e-06
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 3e-06
2wgj_A306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 3e-06
3lq8_A302 Structure Of The Kinase Domain Of C-Met Bound To Xl 3e-06
3f66_A298 Human C-Met Kinase In Complex With Quinoxaline Inhi 3e-06
2rfn_A310 X-ray Structure Of C-met With Inhibitor. Length = 3 3e-06
3i5n_A309 Crystal Structure Of C-Met With Triazolopyridazine 3e-06
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 4e-06
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 4e-06
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 1e-05
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 1e-05
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 1e-05
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 1e-05
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 1e-05
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 1e-05
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 1e-05
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 1e-05
3t8o_A543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 1e-05
3qc9_A543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 1e-05
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 1e-05
3c4w_A543 Crystal Structure Of G Protein Coupled Receptor Kin 1e-05
3c4x_A543 Crystal Structure Of G Protein Coupled Receptor Kin 1e-05
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 2e-05
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 2e-05
2pl0_A289 Lck Bound To Imatinib Length = 289 2e-05
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 2e-05
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 2e-05
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 2e-05
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 2e-05
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 2e-05
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 2e-05
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 3e-05
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 3e-05
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 3e-05
3nyn_A 576 Crystal Structure Of G Protein-Coupled Receptor Kin 3e-05
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 3e-05
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 3e-05
2acx_A 576 Crystal Structure Of G Protein Coupled Receptor Kin 3e-05
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 4e-05
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 4e-05
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 4e-05
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 4e-05
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 4e-05
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 4e-05
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 4e-05
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 4e-05
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 5e-05
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 5e-05
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 5e-05
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 5e-05
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 5e-05
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 5e-05
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 5e-05
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 5e-05
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 5e-05
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 5e-05
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 5e-05
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 5e-05
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 7e-05
2yfx_A327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 1e-04
2xb7_A315 Structure Of Human Anaplastic Lymphoma Kinase In Co 1e-04
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 1e-04
2yjs_A342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 1e-04
2xp2_A327 Structure Of The Human Anaplastic Lymphoma Kinase I 1e-04
2yjr_A342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 1e-04
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 1e-04
2yhv_A342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 1e-04
4fnz_A327 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-04
4fnw_A327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 1e-04
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 1e-04
3aox_A344 X-Ray Crystal Structure Of Human Anaplastic Lymphom 1e-04
4dce_A333 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-04
3lcd_A329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 1e-04
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 1e-04
4fob_A353 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-04
4fnx_A327 Crystal Structure Of The Apo R1275q Anaplastic Lymp 1e-04
3lct_A344 Crystal Structure Of The Anaplastic Lymphoma Kinase 1e-04
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 2e-04
3l9p_A367 Crystal Structure Of The Anaplastic Lymphoma Kinase 2e-04
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 2e-04
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 2e-04
3pls_A298 Ron In Complex With Ligand Amp-Pnp Length = 298 2e-04
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 2e-04
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 3e-04
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 3e-04
2wqb_A324 Structure Of The Tie2 Kinase Domain In Complex With 3e-04
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 3e-04
1fvr_A327 Tie2 Kinase Domain Length = 327 3e-04
4h58_A275 Braf In Complex With Compound 3 Length = 275 3e-04
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 3e-04
2oo8_X317 Synthesis, Structural Analysis, And Sar Studies Of 3e-04
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 3e-04
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 3e-04
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 4e-04
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 4e-04
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 4e-04
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 4e-04
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 4e-04
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 6e-04
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 6e-04
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 6e-04
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 7e-04
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure

Iteration: 1

Score = 83.2 bits (204), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 60/191 (31%), Positives = 92/191 (48%), Gaps = 28/191 (14%) Query: 35 GSFSTVYTGVLAPGDKTNIGVKKLDK------------VVHVAHHKNLVCLLGYHIEQEC 82 G F VY GVL G K + + + + H +LV L+G+ E+ Sbjct: 50 GVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFCRHPHLVSLIGFCDERNE 109 Query: 83 RLLVYKFMHNRSISSLLYECLRPT----WQQRMQDCIRDC-----WRTRALACR------ 127 +L+YK+M N ++ LY PT W+QR++ CI TRA+ R Sbjct: 110 MILIYKYMENGNLKRHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAIIHRDVKSIN 169 Query: 128 ILLHDYFTVETSDLGLAKL-LMINQTQTLTGMRETKGYLPPEWFRNMPVTVKVDVYSFGV 186 ILL + F + +D G++K ++QT ++ T GY+ PE+F +T K DVYSFGV Sbjct: 170 ILLDENFVPKITDFGISKKGTELDQTHLXXVVKGTLGYIDPEYFIKGRLTEKSDVYSFGV 229 Query: 187 MLLEIISCRCV 197 +L E++ R Sbjct: 230 VLFEVLCARSA 240
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 Back     alignment and structure
>pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 Back     alignment and structure
>pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query266
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 5e-38
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 3e-36
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 2e-32
3soc_A322 Activin receptor type-2A; structural genomics cons 8e-19
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 3e-18
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 5e-17
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 2e-15
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 5e-15
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 8e-14
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 2e-13
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 7e-13
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 1e-12
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 8e-12
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 3e-11
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 2e-10
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 4e-10
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 6e-10
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 6e-10
3q4u_A301 Activin receptor type-1; structural genomics conso 2e-09
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-09
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 4e-09
3lzb_A327 Epidermal growth factor receptor; epidermal growth 6e-09
3ork_A311 Serine/threonine protein kinase; structural genomi 7e-09
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 8e-09
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 1e-08
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 2e-08
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 3e-08
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 3e-08
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 4e-08
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 5e-08
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 7e-08
3poz_A327 Epidermal growth factor receptor; kinase domain, a 8e-08
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 9e-08
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 1e-07
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 1e-07
3pls_A298 Macrophage-stimulating protein receptor; protein k 2e-07
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 2e-07
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 2e-07
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 2e-07
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 2e-07
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 2e-07
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 3e-07
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 4e-07
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 4e-07
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 4e-07
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 5e-07
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 5e-07
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 6e-07
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 7e-07
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 7e-07
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 7e-07
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 8e-07
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 8e-07
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 9e-07
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 9e-07
4aoj_A329 High affinity nerve growth factor receptor; transf 1e-06
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 1e-06
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 1e-06
2xir_A316 Vascular endothelial growth factor receptor 2; ang 1e-06
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 2e-06
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 2e-06
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 2e-06
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 2e-06
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 2e-06
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 3e-06
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 3e-06
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 4e-06
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 4e-06
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 6e-06
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 7e-06
2a19_B284 Interferon-induced, double-stranded RNA-activated 8e-06
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 9e-06
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 1e-05
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 1e-05
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 2e-05
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 2e-05
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 3e-05
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 4e-05
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 4e-05
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 5e-05
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 5e-05
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 5e-05
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 5e-05
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 1e-04
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 1e-04
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 2e-04
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 2e-04
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 2e-04
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 2e-04
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
 Score =  135 bits (341), Expect = 5e-38
 Identities = 64/200 (32%), Positives = 89/200 (44%), Gaps = 42/200 (21%)

Query: 33  CGGSFSTVYTGVLAPGDKTNIGVKKLDK----------VVHV-----AHHKNLVCLLGYH 77
            GG F  VY G LA  D T + VK+L +             V     A H+NL+ L G+ 
Sbjct: 40  RGG-FGKVYKGRLA--DGTLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFC 96

Query: 78  IEQECRLLVYKFMHNRSISSLLYECLRP----TWQQRMQDCIRDCWRTRALA-----CR- 127
           +    RLLVY +M N S++S L E         W +R +  +      R LA     C  
Sbjct: 97  MTPTERLLVYPYMANGSVASCLRERPESQPPLDWPKRQRIALG---SARGLAYLHDHCDP 153

Query: 128 -----------ILLHDYFTVETSDLGLAKLLMINQTQTLTGMRETKGYLPPEWFRNMPVT 176
                      ILL + F     D GLAKL+    T   T +R T G++ PE+      +
Sbjct: 154 KIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSS 213

Query: 177 VKVDVYSFGVMLLEIISCRC 196
            K DV+ +GVMLLE+I+ + 
Sbjct: 214 EKTDVFGYGVMLLELITGQR 233


>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query266
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 100.0
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 100.0
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 100.0
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 100.0
3soc_A322 Activin receptor type-2A; structural genomics cons 100.0
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 100.0
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 100.0
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 100.0
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 100.0
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 100.0
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 100.0
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 100.0
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 100.0
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 100.0
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 100.0
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 100.0
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 100.0
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 100.0
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 100.0
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 100.0
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 100.0
3poz_A327 Epidermal growth factor receptor; kinase domain, a 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 100.0
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 100.0
3q4u_A301 Activin receptor type-1; structural genomics conso 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 100.0
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
3dls_A335 PAS domain-containing serine/threonine-protein KI; 100.0
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 100.0
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
2a19_B284 Interferon-induced, double-stranded RNA-activated 100.0
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 100.0
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 100.0
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 100.0
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
3lzb_A327 Epidermal growth factor receptor; epidermal growth 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 100.0
3ork_A311 Serine/threonine protein kinase; structural genomi 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 100.0
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 100.0
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 100.0
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 100.0
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 100.0
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 100.0
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 100.0
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 100.0
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
2xir_A316 Vascular endothelial growth factor receptor 2; ang 100.0
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 100.0
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 100.0
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 100.0
3pls_A298 Macrophage-stimulating protein receptor; protein k 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 100.0
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 100.0
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 100.0
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 100.0
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 100.0
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 100.0
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 100.0
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 100.0
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 100.0
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 100.0
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 100.0
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 100.0
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
3bhy_A283 Death-associated protein kinase 3; death associate 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 100.0
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 100.0
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 100.0
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 100.0
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 100.0
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 100.0
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 100.0
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 100.0
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 100.0
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 100.0
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 100.0
3fme_A290 Dual specificity mitogen-activated protein kinase; 100.0
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 100.0
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 100.0
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 100.0
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 100.0
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 100.0
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 100.0
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 100.0
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 100.0
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 100.0
3an0_A340 Dual specificity mitogen-activated protein kinase; 100.0
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 100.0
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 100.0
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 100.0
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 100.0
2fst_X367 Mitogen-activated protein kinase 14; active mutant 100.0
3aln_A327 Dual specificity mitogen-activated protein kinase; 100.0
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 100.0
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 100.0
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 100.0
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 100.0
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 100.0
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 100.0
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 100.0
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 100.0
2dyl_A318 Dual specificity mitogen-activated protein kinase 100.0
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 100.0
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 100.0
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 100.0
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 100.0
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 100.0
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 100.0
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 100.0
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 100.0
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 100.0
3uqc_A286 Probable conserved transmembrane protein; structur 100.0
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 100.0
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 100.0
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 100.0
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.97
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.96
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.9
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.84
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.68
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.36
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.22
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 98.61
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 98.38
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 97.64
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 96.76
3r70_A320 Aminoglycoside phosphotransferase; structural geno 96.69
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 96.28
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 95.89
2olc_A 397 MTR kinase, methylthioribose kinase; kinase ADP-2H 95.24
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 95.01
2pyw_A 420 Uncharacterized protein; 5-methylthioribose kinase 93.33
3jr1_A312 Putative fructosamine-3-kinase; YP_719053.1, struc 93.14
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 92.83
2q83_A346 YTAA protein; 2635576, structural genomics, joint 92.2
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 89.93
3f7w_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 83.83
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
Probab=100.00  E-value=2.8e-50  Score=342.30  Aligned_cols=215  Identities=21%  Similarity=0.255  Sum_probs=179.2

Q ss_pred             hhHhcccCceeeeeccCCCcceEEEEEEEcCCCcceeeeeeHH----------------HHhhhcCCCceeeeeeEEEeC
Q 042690           17 NRVFGSFSHIYSLKKPCGGSFSTVYTGVLAPGDKTNIGVKKLD----------------KVVHVAHHKNLVCLLGYHIEQ   80 (266)
Q Consensus        17 ~~~~~~~~~~~~~~~ig~G~~g~V~~~~~~~~~~~~vaiK~~~----------------~~l~~~~h~~iv~~~~~~~~~   80 (266)
                      +.+++++++|.+++.||+|+||+||+|.++ .+++.||||++.                ++++.++|||||++++++.++
T Consensus        17 n~~f~sme~Y~~~~~lG~G~fg~V~~a~~~-~~~~~vAiK~i~~~~~~~~~~~~~~~E~~il~~l~HpnIV~~~~~~~~~   95 (350)
T 4b9d_A           17 NLYFQSMEKYVRLQKIGEGSFGKAILVKST-EDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEEN   95 (350)
T ss_dssp             CCBCSCCCCEEEEEEC------CEEEEEET-TTCCEEEEEEEECTTSCHHHHHHHHHHHHHHHHCCCTTBCCEEEEEEET
T ss_pred             ccCCCcccceEEeEEEecCCCeEEEEEEEC-CCCCEEEEEEEehHHCCHHHHHHHHHHHHHHHHCCCCCCCcEEEEEEEC
Confidence            445677889999999999999999999986 678999999874                378899999999999999999


Q ss_pred             CeEEEEEEcCCCCCHHHHHhhcCC--C------CHHHHHHHHHHHhhhcCcccc-----ceeecCCCEEEEeecCcceee
Q 042690           81 ECRLLVYKFMHNRSISSLLYECLR--P------TWQQRMQDCIRDCWRTRALAC-----RILLHDYFTVETSDLGLAKLL  147 (266)
Q Consensus        81 ~~~~lv~e~~~~~~L~~~l~~~~~--~------~~~~~l~~~~~~~~~~~~~h~-----nili~~~~~~~l~Dfg~a~~~  147 (266)
                      +.+|+|||||++|+|.+++.....  +      .+..++..++.++|.++++|+     |||++.+|.+||+|||+|+..
T Consensus        96 ~~~yiVmEy~~gg~L~~~i~~~~~~~~~e~~~~~~~~qi~~aL~ylH~~~IiHRDlKp~NILl~~~g~vKl~DFGla~~~  175 (350)
T 4b9d_A           96 GSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVL  175 (350)
T ss_dssp             TEEEEEEECCTTCBHHHHHHHTTTCCCCHHHHHHHHHHHHHHHHHHHHTTCEETTCCGGGEEECTTCCEEECSTTEESCC
T ss_pred             CEEEEEEeCCCCCcHHHHHHHcCCCCCCHHHHHHHHHHHHHHHHHHHHCCeeeccCCHHHEEECCCCCEEEcccccceee
Confidence            999999999999999999975432  2      355677788899998888888     999999999999999999876


Q ss_pred             ccccccccccccCCCCcCCccccCCCCCCcccchhhHHHHHHHHHhCCCcccCC----------------CCccccchHH
Q 042690          148 MINQTQTLTGMRETKGYLPPEWFRNMPVTVKVDVYSFGVMLLEIISCRCVERQG----------------SDPKTLEKPV  211 (266)
Q Consensus       148 ~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~slG~i~~~l~tg~~p~~~~----------------~~~~~~~~~~  211 (266)
                      ... ........||+.|||||++.+..++.++|||||||++|+|+||+.||...                .+...+..+.
T Consensus       176 ~~~-~~~~~~~~GT~~YmAPE~l~~~~y~~~~DiwSlGvilyemltG~~PF~~~~~~~~~~~i~~~~~~~~~~~~s~~~~  254 (350)
T 4b9d_A          176 NST-VELARACIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLR  254 (350)
T ss_dssp             CHH-HHHHHHHHSCCTTCCHHHHTTCCCCHHHHHHHHHHHHHHHHHSSCSCCCSSHHHHHHHHHHTCCCCCCTTSCHHHH
T ss_pred             cCC-cccccccCCCccccCHHHHCCCCCCcHHHHHHHHHHHHHHHHCCCCCCCcCHHHHHHHHHcCCCCCCCccCCHHHH
Confidence            422 12223467999999999999999999999999999999999999999762                2234567788


Q ss_pred             HHHHHhhhcCCCCCCCHHHHHH
Q 042690          212 MIAIQFVKEKPPLRPSLRIVAL  233 (266)
Q Consensus       212 ~l~~~cl~~~p~~Rps~~~il~  233 (266)
                      +++.+||+.||.+|||++|+++
T Consensus       255 ~li~~~L~~dP~~R~s~~e~l~  276 (350)
T 4b9d_A          255 SLVSQLFKRNPRDRPSVNSILE  276 (350)
T ss_dssp             HHHHHHTCSSGGGSCCHHHHHT
T ss_pred             HHHHHHccCChhHCcCHHHHhc
Confidence            9999999999999999999975



>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 266
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 3e-26
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 3e-25
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 6e-25
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-24
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 2e-24
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 2e-24
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-24
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 8e-24
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 1e-22
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 3e-22
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 1e-21
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 1e-21
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 3e-21
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 9e-21
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 9e-21
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 3e-20
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 4e-20
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 7e-20
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-19
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 3e-19
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 4e-19
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 6e-19
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 1e-18
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-18
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 5e-18
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 1e-17
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-17
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-17
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 3e-17
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 6e-17
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 7e-17
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 3e-16
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 4e-16
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 4e-16
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 5e-16
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 8e-16
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 3e-15
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 4e-15
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 8e-15
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 8e-15
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-14
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-14
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-14
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 9e-14
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 1e-13
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 4e-13
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 5e-13
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-12
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-12
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 4e-12
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 5e-12
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 8e-12
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 1e-10
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-10
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 1e-09
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 3e-09
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 4e-09
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 5e-09
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 6e-09
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 2e-07
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 3e-07
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 2e-05
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase Itk/Tsk
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  101 bits (252), Expect = 3e-26
 Identities = 55/257 (21%), Positives = 95/257 (36%), Gaps = 45/257 (17%)

Query: 27  YSLKKPCG-GSFSTVYTGVLAPGDKTNIGVKKLDK-------------VVHVAHHKNLVC 72
            +  +  G G F  V+ G     DK  + +K + +             V+    H  LV 
Sbjct: 7   LTFVQEIGSGQFGLVHLGYWLNKDK--VAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQ 64

Query: 73  LLGYHIEQECRLLVYKFMHNRSISSL-LYECLRPTWQQR----------MQDCIRDCWRT 121
           L G  +EQ    LV++FM +  +S     +      +            M      C   
Sbjct: 65  LYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIH 124

Query: 122 RALACR-ILLHDYFTVETSDLGLAKLLMINQTQTLTGMRETKGYLPPEWFRNMPVTVKVD 180
           R LA R  L+ +   ++ SD G+ + ++ +Q  + TG +    +  PE F     + K D
Sbjct: 125 RDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSD 184

Query: 181 VYSFGVMLLEIISCRCVERQGSDPKTLEKPVM-----------------IAIQFVKEKPP 223
           V+SFGV++ E+ S   +  +      + + +                  I     KE+P 
Sbjct: 185 VWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPE 244

Query: 224 LRPSLRIVALMLQSILE 240
            RP+   +   L  I E
Sbjct: 245 DRPAFSRLLRQLAEIAE 261


>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query266
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.97
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.56
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 97.27
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 95.41
d2pula1 392 Methylthioribose kinase MtnK {Bacillus subtilis [T 94.74
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase Itk/Tsk
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=8.5e-48  Score=315.52  Aligned_cols=216  Identities=23%  Similarity=0.274  Sum_probs=171.6

Q ss_pred             cCceeeeeccCCCcceEEEEEEEcCCCcceeeeeeHH-------------HHhhhcCCCceeeeeeEEEeCCeEEEEEEc
Q 042690           23 FSHIYSLKKPCGGSFSTVYTGVLAPGDKTNIGVKKLD-------------KVVHVAHHKNLVCLLGYHIEQECRLLVYKF   89 (266)
Q Consensus        23 ~~~~~~~~~ig~G~~g~V~~~~~~~~~~~~vaiK~~~-------------~~l~~~~h~~iv~~~~~~~~~~~~~lv~e~   89 (266)
                      -++|++.+.||+|+||+||+|.++  ++..||||++.             ++++.++||||++++|++..++..++||||
T Consensus         4 p~~~~~~~~iG~G~fg~Vy~~~~~--~~~~vAvK~i~~~~~~~~~~~~E~~~l~~l~HpnIv~~~g~~~~~~~~~lv~E~   81 (263)
T d1sm2a_           4 PSELTFVQEIGSGQFGLVHLGYWL--NKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEF   81 (263)
T ss_dssp             CSCEEEEEEEECCSSCCEEEEEET--TTEEEEEEECCSSSSCHHHHHHHHHHHHHCCCTTBCCEEEEECSSSSCEEEEEC
T ss_pred             hHHcEEEEEEeeCCCeEEEEEEEC--CCCEEEEEEECCCcCcHHHHHHHHHHHHhcCCCCcccccceeccCCceEEEEEe
Confidence            468999999999999999999985  56789999875             388899999999999999999999999999


Q ss_pred             CCCCCHHHHHhhcCC-CC------HHHHHHHHHHHhhhcCcccc-----ceeecCCCEEEEeecCcceeecccccccccc
Q 042690           90 MHNRSISSLLYECLR-PT------WQQRMQDCIRDCWRTRALAC-----RILLHDYFTVETSDLGLAKLLMINQTQTLTG  157 (266)
Q Consensus        90 ~~~~~L~~~l~~~~~-~~------~~~~l~~~~~~~~~~~~~h~-----nili~~~~~~~l~Dfg~a~~~~~~~~~~~~~  157 (266)
                      +++|+|.+++..... ++      +..++..++.++|.++++|+     ||+++.++.+||+|||+++............
T Consensus        82 ~~~g~L~~~l~~~~~~~~~~~~~~i~~qia~gl~~lH~~~iiHrDlKp~Nill~~~~~~Kl~DFGla~~~~~~~~~~~~~  161 (263)
T d1sm2a_          82 MEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTG  161 (263)
T ss_dssp             CTTCBHHHHHHTTTTCCCHHHHHHHHHHHHHHHHHHHHTTCCCTTCSGGGEEECGGGCEEECSCC---------------
T ss_pred             cCCCcHHHHhhccccCCCHHHHHHHHHHHHHHHHhhhccceeecccchhheeecCCCCeEecccchheeccCCCceeecc
Confidence            999999999875433 33      44566667788888888887     8999999999999999998765444444445


Q ss_pred             ccCCCCcCCccccCCCCCCcccchhhHHHHHHHHHhCC-CcccC----------------CCCccccchHHHHHHHhhhc
Q 042690          158 MRETKGYLPPEWFRNMPVTVKVDVYSFGVMLLEIISCR-CVERQ----------------GSDPKTLEKPVMIAIQFVKE  220 (266)
Q Consensus       158 ~~~~~~y~aPE~~~~~~~~~~~Di~slG~i~~~l~tg~-~p~~~----------------~~~~~~~~~~~~l~~~cl~~  220 (266)
                      ..||+.|+|||.+.+..++.++||||||+++|||+|+. +|+..                ..+......+.+++.+||+.
T Consensus       162 ~~gt~~y~aPE~l~~~~~~~k~DVwS~Gvil~el~t~~~~~~~~~~~~~~~~~i~~~~~~~~p~~~~~~l~~li~~cl~~  241 (263)
T d1sm2a_         162 TKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKE  241 (263)
T ss_dssp             ---CTTSCCHHHHTTCCCCHHHHHHHHHHHHHHHHTTSCCTTCSCCHHHHHHHHHHTCCCCCCTTSCHHHHHHHHHHTCS
T ss_pred             eecCcccCChHHhcCCCCCchhhhcchHHHHHHHHHCCCCCCCCCCHHHHHHHHHhcCCCCCccccCHHHHHHHHHHccC
Confidence            67899999999999999999999999999999999954 45543                12334556788999999999


Q ss_pred             CCCCCCCHHHHHHHHHHHHh
Q 042690          221 KPPLRPSLRIVALMLQSILE  240 (266)
Q Consensus       221 ~p~~Rps~~~il~~l~~~~~  240 (266)
                      ||.+|||++++++.|+++.+
T Consensus       242 ~p~~Rps~~~il~~L~~i~e  261 (263)
T d1sm2a_         242 RPEDRPAFSRLLRQLAEIAE  261 (263)
T ss_dssp             SGGGSCCHHHHHHHHHHHHH
T ss_pred             CHhHCcCHHHHHHHHHHHHh
Confidence            99999999999999998865



>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure