Citrus Sinensis ID: 042799

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
MDRKLFEATQAGNVQSLHQLLGENPLILHTSALTSAGNPLHVASAYGHIDFVKEIINLRPDMAQEVNQDGFSPMHMASSIGHTEVVRELLKVDRKLCQLQGPEAKTPLHCAAIKGRSHAVAEMLSACPECVEDVTIQHYTALHLAIKSSQYGVIAIIVDWIREMKKEHIFNMRDEQGNTKIQSYDLSSNYKEQLKTWIHWQVIELLLGHQANASQGLEVNAINHSGLTAIDLLLIFPSEAGDREIEEILRSAGATGMGDDNQTSTGNPPASSAETNPLQTKNDVTEYFKFKKGRDSPGETRSSLLVVAALVATTTFQFGVNPPGGAWQDNSIPTSKTHIAGESIWGSTNTIAFRLYMFFNSLGFKLSLQMINILTTKFPLQFELQLCFLAMNFTYDTAVISIAPDGVKLFVILTISILPVAIGLAAYGFRLQRKRRRSERTATVEPQNQ
cccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHccccccHHHcccHHHHHHHHHHccccccccccccccccccccHHHHHHHcccccccHHHHHHHHHcccccccccccccccccccccccccccccccccEEEHHcccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
cccHHHHHHHcccHHHHHHHHHccccccHcccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccEEcccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHccccccccccccccHHHHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccccHHHHHHHHHHcHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEccccHHHHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
MDRKLFEATQAGNVQSLHQllgenpliLHTSaltsagnplhvasaygHIDFVKEIINLRPdmaqevnqdgfspmhmassiGHTEVVRELLKVDRKLcqlqgpeaktplhcaAIKGRSHAVAEMLSAcpecvedvTIQHYTALHLAIKSSQYGVIAIIVDWIREMKKEHIFNMrdeqgntkiqsyDLSSNYKEQLKTWIHWQVIELLLGhqanasqglevnainhsglTAIDLLLifpseagdREIEEILRSAgatgmgddnqtstgnppassaetnplqtkndVTEYfkfkkgrdspgetrSSLLVVAALVATttfqfgvnppggawqdnsiptskthiagesiwgstNTIAFRLYMFFNSLGFKLSLQMINILTTKFPLQFELQLCFLAMNFTYDTAVISIAPDGVKLFVILTISILPVAIGLAAYGFRLQRkrrrsertatvepqnq
MDRKLFEATQAGNVQSLHQLLGENPLILHTSALTSAGNPLHVASAYGHIDFVKEIINLRPDMAQEVNQDGFSPMHMASSIGHTEVVRELLKVDRKLCQlqgpeaktplhCAAIKGRSHAVAEMLSACPECVEDVTIQHYTALHLAIKSSQYGVIAIIVDWIREMKKEHIFnmrdeqgntKIQSYDLSSNYKEQLKTWIHWQVIELLLGHQANASQGLEVNAINHSGLTAIDLLLIFPSEAGDREIEEILRSAGATGMGDDNQTSTgnppassaetnplqtknDVTEYFKFkkgrdspgetrSSLLVVAALVATTTFQFGVNPPGGAWQDNSIPTSKTHIAGESIWGSTNTIAFRLYMFFNSLGFKLSLQMINILTTKFPLQFELQLCFLAMNFTYDTAVISIAPDGVKLFVILTISILPVAIGLAAygfrlqrkrrrsertatvepqnq
MDRKLFEATQAGNVQSLHQLLGENPLILHTSALTSAGNPLHVASAYGHIDFVKEIINLRPDMAQEVNQDGFSPMHMASSIGHTEVVRELLKVDRKLCQLQGPEAKTPLHCAAIKGRSHAVAEMLSACPECVEDVTIQHYTALHLAIKSSQYGVIAIIVDWIREMKKEHIFNMRDEQGNTKIQSYDLSSNYKEQLKTWIHWQVIELLLGHQANASQGLEVNAINHSGLTAIDLLLIFPSEAGDREIEEILRSAGATGMGDDNQTSTGNPPASSAETNPLQTKNDVTEYFKFKKGRDSPGETRSSllvvaalvatttFQFGVNPPGGAWQDNSIPTSKTHIAGESIWGSTNTIAFRLYMFFNSLGFKLSLQMINILTTKFPLQFELQLCFLAMNFTYDTAVISIAPDGVKLFVILTISILPVAIGLAAYGFRLQRKRRRSERTATVEPQNQ
***************SLHQLLGENPLILHTSALTSAGNPLHVASAYGHIDFVKEIINLRPDM***************SSIGHTEVVRELLKVDRKLCQLQGPEAKTPLHCAAIKGRSHAVAEMLSACPECVEDVTIQHYTALHLAIKSSQYGVIAIIVDWIREMKKEHIFNMRDE*GNTKIQSYDLSSNYKEQLKTWIHWQVIELLLGHQANASQGLEVNAINHSGLTAIDLLLIFPSE***************************************************************SLLVVAALVATTTFQFGVNPPGGAWQDNSIPTSKTHIAGESIWGSTNTIAFRLYMFFNSLGFKLSLQMINILTTKFPLQFELQLCFLAMNFTYDTAVISIAPDGVKLFVILTISILPVAIGLAAYGFRL******************
MDRKLFEATQAGNVQSLHQLLGENPLILHTSALTSAGNPLHVASAYGHIDFVKEIINLRPDMAQEVNQDGFSPMHMASSIGHTEVVRELLKVDRKLCQLQGPEAKTPLHCAAIKGRSHAVAEMLSACPECVEDVTIQHYTALHLAIKSSQYGVIAIIVDWIREMKKEHIFNMRDEQGNTKIQSYDLSSNYKEQLKTWIHWQVIELLLGHQANASQGLEVNAINHSGLTAIDLLLIFPSEAGDREIEEILRSAGATGMG******T*****************DV*************GETRSSLLVVAALVATTTFQFGVNPPGGAWQDNSIPTSKTHIAGESIWGSTNTIAFRLYMFFNSLGFKLSLQMINILTTKFPLQFELQLCFLAMNFTYDTAVISIAPDGVKLFVILTISILPVAIGLAAYGFRLQ*****************
********TQAGNVQSLHQLLGENPLILHTSALTSAGNPLHVASAYGHIDFVKEIINLRPDMAQEVNQDGFSPMHMASSIGHTEVVRELLKVDRKLCQLQGPEAKTPLHCAAIKGRSHAVAEMLSACPECVEDVTIQHYTALHLAIKSSQYGVIAIIVDWIREMKKEHIFNMRDEQGNTKIQSYDLSSNYKEQLKTWIHWQVIELLLGHQANASQGLEVNAINHSGLTAIDLLLIFPSEAGDREIEEILRSAGATGMGD******************LQTKNDVTEYFKFKK********RSSLLVVAALVATTTFQFGVNPPGGAWQDNSIPTSKTHIAGESIWGSTNTIAFRLYMFFNSLGFKLSLQMINILTTKFPLQFELQLCFLAMNFTYDTAVISIAPDGVKLFVILTISILPVAIGLAAYGFRLQ*****************
*DRKLFEATQAGNVQSLHQLLGENPLILHTSALTSAGNPLHVASAYGHIDFVKEIINLRPDMAQEVNQDGFSPMHMASSIGHTEVVRELLKVDRKLCQLQGPEAKTPLHCAAIKGRSHAVAEMLSACPECVEDVTIQHYTALHLAIKSSQYGVIAIIVDWIREMKKEHIFNMRDEQGNTKIQSYDLSSNYKEQLKTWIHWQVIELLLGHQANASQGLEVNAINHSGLTAIDLLLIFPSEAGDREIEEILRSAGATGMGDDNQTSTGNPPASSAETNPLQTKNDVTEYFKFKKGRDSPGETRSSLLVVAALVATTTFQFGVNPPGGAWQDNSIPTSKTHIAGESIWGSTNTIAFRLYMFFNSLGFKLSLQMINILTTKFPLQFELQLCFLAMNFTYDTAVISIAPDGVKLFVILTISILPVAIGLAAYGFRLQRKRRR************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRKLFEATQAGNVQSLHQLLGENPLILHTSALTSAGNPLHVASAYGHIDFVKEIINLRPDMAQEVNQDGFSPMHMASSIGHTEVVRELLKVDRKLCQLQGPEAKTPLHCAAIKGRSHAVAEMLSACPECVEDVTIQHYTALHLAIKSSQYGVIAIIVDWIREMKKEHIFNMRDEQGNTKIQSYDLSSNYKEQLKTWIHWQVIELLLGHQANASQGLEVNAINHSGLTAIDLLLIFPSEAGDREIEEILRSAGATGMGDDNQTSTGNPPASSAETNPLQTKNDVTEYFKFKKGRDSPGETRSSLLVVAALVATTTFQFGVNPPGGAWQDNSIPTSKTHIAGESIWGSTNTIAFRLYMFFNSLGFKLSLQMINILTTKFPLQFELQLCFLAMNFTYDTAVISIAPDGVKLFVILTISILPVAIGLAAYGFRLQRKRRRSERTATVEPQNQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query449 2.2.26 [Sep-21-2011]
Q9ZU96532 Ankyrin repeat-containing no no 0.685 0.578 0.274 6e-18
Q9C7A2590 Ankyrin repeat-containing no no 0.739 0.562 0.244 2e-15
Q92625 1134 Ankyrin repeat and SAM do yes no 0.394 0.156 0.274 2e-11
Q6AWW5524 Ankyrin repeat-containing no no 0.868 0.744 0.219 2e-10
A5PMU4 1280 Ankyrin repeat and steril yes no 0.387 0.135 0.282 2e-10
P59672 1150 Ankyrin repeat and SAM do yes no 0.427 0.166 0.248 1e-09
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no no 0.367 0.042 0.324 5e-09
Q01484 3957 Ankyrin-2 OS=Homo sapiens no no 0.369 0.041 0.316 8e-09
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no no 0.269 0.061 0.323 4e-08
P57078832 Receptor-interacting seri no no 0.258 0.139 0.338 5e-08
>sp|Q9ZU96|Y2168_ARATH Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1 Back     alignment and function desciption
 Score = 92.4 bits (228), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 97/353 (27%), Positives = 149/353 (42%), Gaps = 45/353 (12%)

Query: 38  NPLHVASAYGHIDFVKEIINLRPDMAQEVNQDGFSPMHMASSIGHTEVVRELLKVDRKLC 97
           N  HVA+  GH+  VKE++ L P++ +  +    SP++ A+   H E+V  +L VD    
Sbjct: 96  NAFHVAAKRGHLGIVKELLRLWPELCRICDASNTSPLYAAAVQDHLEIVNAMLDVDPSCA 155

Query: 98  QLQGPEAKTPLHCAAIKGRSHAVAEMLSACPECVEDVTIQHYTALHLAIKSSQYGVIAII 157
            +     KT LH A   G    V  ++      V     +  TALH+A+K     V+  I
Sbjct: 156 MIVRKNGKTSLHTAGRYGLLRIVKALIEKDAAIVGVKDKKGQTALHMAVKGRSLEVVEEI 215

Query: 158 V--DWIREMKKEHIFNMRDEQGNTKIQSYDLSSNYKEQLKTWIHWQVIELLLGHQANASQ 215
           +  D+        I N RD +GNT +      +            Q+  LLL   A    
Sbjct: 216 LQADYT-------ILNERDRKGNTALHIATRKARP----------QITSLLLTFTA---- 254

Query: 216 GLEVNAINHSGLTAIDLLLIFPSEAGDREIEEILRSAGATG---MGDDNQTSTGNPPASS 272
            +EVNAIN+   TA+DL           EI E L  AGA     +G +++        S 
Sbjct: 255 -IEVNAINNQKETAMDLADKLQYSESALEINEALVEAGAKHGRFIGREDEARALKRAVSD 313

Query: 273 ----AETNPLQ---TKNDVTEYFK--FKKGRDSPGETRSSLLVVAALVATTTFQFGVNPP 323
                ++  LQ   T   V+   K   K  R++   T +S+ VVA L A+  F    N P
Sbjct: 314 IKHEVQSQLLQNEKTNRRVSGIAKELRKLHREAVQNTTNSITVVAVLFASIAFLAIFNLP 373

Query: 324 GGAWQDNSIPTSKTHIAGESIWGSTNTIAFRLYMFFNSLGFKLSLQMINILTT 376
           G  + + S      H+   +I G T    FR++   N+    +SL ++ +  T
Sbjct: 374 GQYFTEGS------HVGQANIAGRT---GFRVFCLLNATSLFISLAVVVVQIT 417

Arabidopsis thaliana (taxid: 3702)
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function description
>sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 Back     alignment and function description
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function description
>sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 Back     alignment and function description
>sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query449
359490025450 PREDICTED: LOW QUALITY PROTEIN: ankyrin 0.942 0.94 0.534 1e-135
224114660448 predicted protein [Populus trichocarpa] 0.955 0.957 0.515 1e-128
147791225394 hypothetical protein VITISV_030400 [Viti 0.830 0.946 0.498 1e-118
387169570435 hypothetical protein 34G24.15 [Capsella 0.830 0.857 0.437 4e-89
387169523411 hypothetical protein 11M19.23, partial [ 0.761 0.832 0.455 4e-87
15241393442 ankyrin repeat-containing protein [Arabi 0.779 0.791 0.448 4e-86
255539939320 ankyrin repeat-containing protein, putat 0.659 0.925 0.506 4e-86
297737379392 unnamed protein product [Vitis vinifera] 0.692 0.793 0.486 6e-85
359495749460 PREDICTED: uncharacterized protein LOC10 0.866 0.845 0.377 8e-72
224136414459 predicted protein [Populus trichocarpa] 0.910 0.891 0.369 2e-68
>gi|359490025|ref|XP_003634016.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein At2g01680-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 240/449 (53%), Positives = 319/449 (71%), Gaps = 26/449 (5%)

Query: 1   MDRKLFEATQAGNVQSLHQLLGENPLILHTSALTSAGNPLHVASAYGHIDFVKEIINLRP 60
           MDR+L +A QAGNV+ LHQLL ENPLILHT+AL SA NPLH++S  GH+DFVKE+I L+P
Sbjct: 1   MDRRLLDAAQAGNVEDLHQLLRENPLILHTTALASAENPLHISSISGHVDFVKELIRLKP 60

Query: 61  DMAQEVNQDGFSPMHMASSIGHTEVVRELLKVDRKLCQLQGPEAKTPLHCAAIKGRSHAV 120
           D  +E+NQDGFSP+HMA++ GH EVV ELLK D K C L+G + KTPLHCAA+KG+ + V
Sbjct: 61  DFIKELNQDGFSPIHMAAANGHQEVVMELLKFDWKXCHLEGRDEKTPLHCAAMKGKVNVV 120

Query: 121 AEMLSACPECVEDVTIQHYTALHLAIKSSQYGVIAIIVDWIREMKKEHIFNMRDEQGNTK 180
             +LSAC EC+EDVT+Q   ALHLA+K+SQY  + ++V+ +REM++E + NM+DE GNT 
Sbjct: 121 RVILSACKECIEDVTVQKEIALHLAVKNSQYEAVRVLVEKVREMRREDVLNMKDEHGNTI 180

Query: 181 IQSYDLSSNYKEQLKTWIHWQVIELLLGHQANASQGL-EVNAINHSGLTAIDLLLIFPSE 239
           +            L TW   +  + LLG       G+ EVN +N+SGLTA+D+LLIFPSE
Sbjct: 181 L-----------HLATWRKQRQAKFLLGDATIPGSGVTEVNLMNNSGLTALDVLLIFPSE 229

Query: 240 AGDREIEEILRSAGATGMGD------DNQTSTGNPPASSAETNPLQTKNDVTEYFKFKKG 293
           AGDREI+EIL SAGA    D        Q        ++ ET P+Q  N++  YF+F +G
Sbjct: 230 AGDREIKEILHSAGAKRAQDIAFPPFGTQNHARLNSTTTVETCPMQ-PNNLVNYFRFHRG 288

Query: 294 RDSPGETRSSLLVVAALVATTTFQFGVNPPGGAWQD-------NSIPTSKTHIAGESIWG 346
           RDSPGE RS+LLV+A LVAT T+Q G++PPGG WQD       NS  T+K H AG+SI+ 
Sbjct: 289 RDSPGEARSALLVIAVLVATATYQVGLSPPGGVWQDNSGTNQSNSTATNKAHFAGQSIFS 348

Query: 347 STNTIAFRLYMFFNSLGFKLSLQMINILTTKFPLQFELQLCFLAMNFTYDTAVISIAPDG 406
           S   I+F +++ FNS+GF +SL MI+ILT+KFP++FELQ+C LAM FTY+TA+I+I+PD 
Sbjct: 349 SLGIISFGIFVLFNSIGFSVSLYMISILTSKFPMRFELQICLLAMFFTYNTAIITISPDN 408

Query: 407 VKLFVILTISILPVAIGLAAYGFRLQRKR 435
           +K+F+I+  SILP+ + L A   R   K+
Sbjct: 409 LKIFLIVLTSILPLTVCLVAKWVREYVKK 437

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224114660|ref|XP_002332335.1| predicted protein [Populus trichocarpa] gi|222832582|gb|EEE71059.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147791225|emb|CAN70132.1| hypothetical protein VITISV_030400 [Vitis vinifera] Back     alignment and taxonomy information
>gi|387169570|gb|AFJ66229.1| hypothetical protein 34G24.15 [Capsella rubella] Back     alignment and taxonomy information
>gi|387169523|gb|AFJ66184.1| hypothetical protein 11M19.23, partial [Arabidopsis halleri] Back     alignment and taxonomy information
>gi|15241393|ref|NP_199929.1| ankyrin repeat-containing protein [Arabidopsis thaliana] gi|8843852|dbj|BAA97378.1| unnamed protein product [Arabidopsis thaliana] gi|45825143|gb|AAS77479.1| At5g51160 [Arabidopsis thaliana] gi|51968476|dbj|BAD42930.1| putative protein [Arabidopsis thaliana] gi|62319991|dbj|BAD94109.1| putative protein [Arabidopsis thaliana] gi|332008662|gb|AED96045.1| ankyrin repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255539939|ref|XP_002511034.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223550149|gb|EEF51636.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297737379|emb|CBI26580.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495749|ref|XP_003635081.1| PREDICTED: uncharacterized protein LOC100852638 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224136414|ref|XP_002326854.1| predicted protein [Populus trichocarpa] gi|222835169|gb|EEE73604.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query449
TAIR|locus:2176252442 AT5G51160 "AT5G51160" [Arabido 0.779 0.791 0.421 7.5e-73
TAIR|locus:2132711445 AT4G10720 "AT4G10720" [Arabido 0.708 0.714 0.301 2.6e-40
TAIR|locus:2012532441 AT1G14480 "AT1G14480" [Arabido 0.846 0.861 0.270 4.4e-36
TAIR|locus:2012557436 AT1G14500 "AT1G14500" [Arabido 0.766 0.788 0.282 2.2e-34
TAIR|locus:2180882457 AT5G15500 [Arabidopsis thalian 0.913 0.897 0.267 8.5e-33
TAIR|locus:2172089426 ANK "ankyrin" [Arabidopsis tha 0.534 0.563 0.346 4.7e-32
TAIR|locus:2172099431 AT5G54620 [Arabidopsis thalian 0.670 0.698 0.296 1.6e-31
TAIR|locus:2123406406 AT4G11000 "AT4G11000" [Arabido 0.244 0.270 0.307 2.9e-15
TAIR|locus:2031948627 AT1G05640 "AT1G05640" [Arabido 0.761 0.545 0.248 3.8e-15
TAIR|locus:2170081535 AT5G50140 "AT5G50140" [Arabido 0.320 0.269 0.240 1.5e-12
TAIR|locus:2176252 AT5G51160 "AT5G51160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 736 (264.1 bits), Expect = 7.5e-73, P = 7.5e-73
 Identities = 159/377 (42%), Positives = 228/377 (60%)

Query:    58 LRPDMAQEVNQDGFSPMHMASSIGHTEVVRELLKVDRKLCQLQGPEAKTPLHCAAIKGRS 117
             LR     +++++GFSP+H A++ G  E VR  L V++KLC+L+  + KTPLH A ++G+ 
Sbjct:    35 LRQRSVFDLDKNGFSPLHAAAAAGQVETVRATLGVEKKLCRLKDRDGKTPLHVATMRGKI 94

Query:   118 HAVAEMLSACPECVEDVTIQHYTALHLAIKSSQYGVIAIIVDWIREMKKEHIFNMRDEQG 177
               + E++++C +C+ED T+Q  TALHLA+   +   +  IV+ I E  +  + N +DEQG
Sbjct:    95 DVIREIVASCVDCLEDETVQGQTALHLAVLHLEIEAVIAIVELITETNRFDVLNKKDEQG 154

Query:   178 NTKIQSYDLSSNYKEQLKTWI-HWQVIELLLGHQANASQGLEVNAINHSGLTAIDLLLIF 236
             NT +            L TW  + QVIE+L+      S+  EVNA+N  GL+A+DLL++F
Sbjct:   155 NTALH-----------LATWRKNRQVIEVLVQAIPEESRSFEVNAMNKMGLSAMDLLVMF 203

Query:   237 PSEAGDREIEEILRSAGAT---GMGDDNQTSTGNPPASSAETNPLQTKNDVTEYFKFKKG 293
             PSEAGDREI E L  AGA     +G  N   T +       T   Q+  ++ +YF FKK 
Sbjct:   204 PSEAGDREIYEKLIEAGAQRGRDIGTTNVERTTSTSTCQERTMKSQSHKELVKYFTFKKH 263

Query:   294 RDSPGETRSSXXXXXXXXXXXXFQFGVNPPGGAWQDNSIPT------------SKTHIAG 341
             RDSP E RS+            FQ  + PPGG WQD+SIP              + H AG
Sbjct:   264 RDSPSEARSALLVVASLVATATFQASLTPPGGTWQDSSIPAVSQNTTNVNTTNQQAHTAG 323

Query:   342 ESIWGSTNTIAFRLYMFFNSLGFKLSLQMINILTTKFPLQFELQLCFLAMNFTYDTAVIS 401
             +SI G+ N +AF L++FFN++GF +SL M+NILT  FPL+F+LQ+C +AM F+++T + S
Sbjct:   324 QSIMGTFNGVAFTLFVFFNTIGFSVSLSMLNILTLGFPLRFQLQICMIAMYFSHNTTMAS 383

Query:   402 IAPDGVKLFVILTISIL 418
             IAPD VKL+ IL  SIL
Sbjct:   384 IAPDHVKLYCILITSIL 400
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0006826 "iron ion transport" evidence=RCA
GO:0010043 "response to zinc ion" evidence=RCA
GO:0010106 "cellular response to iron ion starvation" evidence=RCA
GO:0010167 "response to nitrate" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
TAIR|locus:2132711 AT4G10720 "AT4G10720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012532 AT1G14480 "AT1G14480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012557 AT1G14500 "AT1G14500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180882 AT5G15500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172089 ANK "ankyrin" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172099 AT5G54620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123406 AT4G11000 "AT4G11000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031948 AT1G05640 "AT1G05640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170081 AT5G50140 "AT5G50140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query449
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-18
pfam13962114 pfam13962, PGG, Domain of unknown function 8e-16
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-06
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.001
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.002
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.003
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.003
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.003
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 80.1 bits (198), Expect = 3e-18
 Identities = 37/121 (30%), Positives = 63/121 (52%), Gaps = 3/121 (2%)

Query: 38  NPLHVASAYGHIDFVKEIINLRPDMAQEVNQDGFSPMHMASSIGHTEVVRELLKVDRKLC 97
            PLH+A++ GH++ VK ++    D+    + DG +P+H+A+  GH E+V+ LL+    + 
Sbjct: 9   TPLHLAASNGHLEVVKLLLENGADVN-AKDNDGRTPLHLAAKNGHLEIVKLLLEKGADVN 67

Query: 98  QLQGPEAKTPLHCAAIKGRSHAVAEMLSACPECVEDVTIQHYTALHLAIKSSQYGVIAII 157
             +  +  TPLH AA  G    V ++L      V        T LHLA K+    V+ ++
Sbjct: 68  -ARDKDGNTPLHLAARNGN-LDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHLEVVKLL 125

Query: 158 V 158
           +
Sbjct: 126 L 126

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 449
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 99.98
PHA02989494 ankyrin repeat protein; Provisional 99.97
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
KOG0508615 consensus Ankyrin repeat protein [General function 99.97
PHA02798489 ankyrin-like protein; Provisional 99.97
KOG0508 615 consensus Ankyrin repeat protein [General function 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.96
PHA02917 661 ankyrin-like protein; Provisional 99.96
PHA02917 661 ankyrin-like protein; Provisional 99.95
PHA02730672 ankyrin-like protein; Provisional 99.95
PHA02795437 ankyrin-like protein; Provisional 99.95
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.95
PHA02792631 ankyrin-like protein; Provisional 99.95
PHA02795437 ankyrin-like protein; Provisional 99.94
PHA02730 672 ankyrin-like protein; Provisional 99.94
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.94
PLN03192823 Voltage-dependent potassium channel; Provisional 99.93
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.93
PHA02792631 ankyrin-like protein; Provisional 99.93
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.93
PLN03192823 Voltage-dependent potassium channel; Provisional 99.92
PF13962113 PGG: Domain of unknown function 99.92
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.91
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.9
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.9
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.89
KOG0514452 consensus Ankyrin repeat protein [General function 99.87
PHA02743166 Viral ankyrin protein; Provisional 99.86
KOG0514452 consensus Ankyrin repeat protein [General function 99.86
PHA02741169 hypothetical protein; Provisional 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.86
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.86
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.85
PHA02884300 ankyrin repeat protein; Provisional 99.84
PHA02884300 ankyrin repeat protein; Provisional 99.84
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.84
PHA02741169 hypothetical protein; Provisional 99.84
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.83
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.81
PHA02736154 Viral ankyrin protein; Provisional 99.81
PHA02736154 Viral ankyrin protein; Provisional 99.81
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.79
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.78
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.77
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.73
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.71
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.7
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.7
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.68
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.6
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.57
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.5
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.49
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.47
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.42
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.41
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.4
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.4
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.39
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.39
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.37
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.34
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.27
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.94
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.73
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.71
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.71
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.7
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.69
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.64
KOG0522560 consensus Ankyrin repeat protein [General function 98.62
PF1360630 Ank_3: Ankyrin repeat 98.59
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.54
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.53
KOG0522 560 consensus Ankyrin repeat protein [General function 98.52
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.5
PF1360630 Ank_3: Ankyrin repeat 98.44
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.39
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.32
KOG0520975 consensus Uncharacterized conserved protein, conta 98.19
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.09
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.09
KOG0520975 consensus Uncharacterized conserved protein, conta 98.06
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.05
KOG0511516 consensus Ankyrin repeat protein [General function 97.98
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.93
KOG2384223 consensus Major histocompatibility complex protein 97.92
KOG0511516 consensus Ankyrin repeat protein [General function 97.91
KOG2384223 consensus Major histocompatibility complex protein 97.71
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.55
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.27
KOG2505591 consensus Ankyrin repeat protein [General function 95.75
KOG2505591 consensus Ankyrin repeat protein [General function 95.65
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 94.24
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.05
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 93.81
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 89.56
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 87.57
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 84.51
PTZ00370296 STEVOR; Provisional 83.85
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=5.3e-39  Score=262.52  Aligned_cols=206  Identities=24%  Similarity=0.302  Sum_probs=190.4

Q ss_pred             HHHHHHHHhCCHHHHHHHHhcCccccccccCCCCChHHHHHHHcCCHHHHHHHHhhCCCcccccCCCCCcHHHHHHHcCc
Q 042799            3 RKLFEATQAGNVQSLHQLLGENPLILHTSALTSAGNPLHVASAYGHIDFVKEIINLRPDMAQEVNQDGFSPMHMASSIGH   82 (449)
Q Consensus         3 t~L~~Aa~~g~~~~v~~Ll~~~~~~~~~~~~~~g~t~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~g~tpLh~Aa~~g~   82 (449)
                      ++.+.+++......++.+++..+......++.+|+||||+||..|+.+++++|++.-.-..+.+|..||||||.||..|+
T Consensus         5 ~~~~~~~~~~~~~kveel~~s~~kSL~~r~dqD~Rt~LHwa~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~   84 (226)
T KOG4412|consen    5 SLGKAICENCEEFKVEELIQSDPKSLNARDDQDGRTPLHWACSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASNGN   84 (226)
T ss_pred             chHHHHHhhchHHHHHHHHhcChhhhhccccccCCceeeeeeecCchhHHHHHHhcCCCCCCCccccCCchhhhhhhcCc
Confidence            67888899999999999999999776677777899999999999999999999975443447789999999999999999


Q ss_pred             HHHHHHHHHc-CcccccccCCCCCcHhHHHHHhCcHHHHHHHHhhCCCcccccccCCCcHHHHHHHhCCHhHHHHHHHHH
Q 042799           83 TEVVRELLKV-DRKLCQLQGPEAKTPLHCAAIKGRSHAVAEMLSACPECVEDVTIQHYTALHLAIKSSQYGVIAIIVDWI  161 (449)
Q Consensus        83 ~~iv~~Ll~~-~~~~~~~~d~~g~tpLh~A~~~g~~~~v~~Ll~~~~~~~~~~d~~g~t~Lh~A~~~~~~~~v~~Ll~~~  161 (449)
                      .|+|+.|+.+ |+++ +..++.|+|+||+|+..|+.+++++|+++++. +..+|..|.||||.|+.-|+.+++++|+.. 
T Consensus        85 ~evVk~Ll~r~~adv-na~tn~G~T~LHyAagK~r~eIaqlLle~ga~-i~~kD~~~qtplHRAAavGklkvie~Li~~-  161 (226)
T KOG4412|consen   85 DEVVKELLNRSGADV-NATTNGGQTCLHYAAGKGRLEIAQLLLEKGAL-IRIKDKQGQTPLHRAAAVGKLKVIEYLISQ-  161 (226)
T ss_pred             HHHHHHHhcCCCCCc-ceecCCCcceehhhhcCChhhHHHHHHhcCCC-CcccccccCchhHHHHhccchhhHHHHHhc-
Confidence            9999999999 8888 99999999999999999999999999999966 999999999999999999999999999987 


Q ss_pred             HhhccccccccccCCCCCcccchhhhhcccchhhhhhHHHHHHHHhhCccccccCccccccCCCCCChHHHH
Q 042799          162 REMKKEHIFNMRDEQGNTKIQSYDLSSNYKEQLKTWIHWQVIELLLGHQANASQGLEVNAINHSGLTAIDLL  233 (449)
Q Consensus       162 ~~~~~~~~~n~~d~~G~T~Lh~~~~A~~~~~~~~~~~~~~iv~~Ll~~ga~~~~~~~~~~~n~~g~T~l~~A  233 (449)
                           ++.+|.+|+.|+||||   .|...++       .++..+|+++||      +.+..|++| ||+.++
T Consensus       162 -----~a~~n~qDk~G~TpL~---~al~e~~-------~d~a~lLV~~gA------d~~~edke~-t~~~~a  211 (226)
T KOG4412|consen  162 -----GAPLNTQDKYGFTPLH---HALAEGH-------PDVAVLLVRAGA------DTDREDKEG-TALRIA  211 (226)
T ss_pred             -----CCCCCcccccCccHHH---HHHhccC-------chHHHHHHHhcc------ceeeccccC-chHHHH
Confidence                 7889999999999999   9977778       999999999999      899999988 999888

>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PTZ00370 STEVOR; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query449
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 8e-09
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-06
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-08
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-08
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 5e-08
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 6e-08
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-07
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 3e-04
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-07
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-07
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-07
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 4e-04
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 4e-07
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 6e-07
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 7e-07
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-06
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-06
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 5e-06
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 2e-06
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-06
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 2e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-06
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-06
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-06
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 8e-05
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-06
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 1e-04
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-06
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 3e-06
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 3e-06
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 5e-05
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 3e-06
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 4e-06
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 5e-06
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 5e-06
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 5e-06
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 5e-06
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 9e-06
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 3e-05
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 3e-05
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 5e-05
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 5e-05
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 9e-05
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 2e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-04
1uoh_A226 Human Gankyrin Length = 226 2e-04
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 3e-04
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-04
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 5e-04
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 6e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure 
Iteration: 1

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 64/123 (52%), Gaps = 7/123 (5%)
Query: 39  PLHVASAYGHIDFVKEIINLRPDMAQEVNQDGFSPMHMASSIGHTEVVRELLKVDRKLCQ 98
           PLHVAS  GH+  VK ++  R       N    +P+HMA+  GHTEV + LL+ ++    
Sbjct: 17  PLHVASFMGHLPIVKNLLQ-RGASPNVSNVKVETPLHMAARAGHTEVAKYLLQ-NKAKVN 74
Query: 99  LQGPEAKTPLHCAAIKGRSHAVAEML--SACPECVEDVTIQHYTALHLAIKSSQYGVIAI 156
            +  + +TPLHCAA  G ++ V  +L  +A P      T   +T LH+A +      +  
Sbjct: 75  AKAKDDQTPLHCAARIGHTNMVKLLLENNANPNL---ATTAGHTPLHIAAREGHVETVLA 131
Query: 157 IVD 159
           +++
Sbjct: 132 LLE 134
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query449
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-22
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-19
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-09
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-19
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-19
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-17
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-14
2etb_A256 Transient receptor potential cation channel subfam 5e-19
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-19
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 9e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-19
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-18
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-12
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-19
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-18
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-17
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-18
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-15
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-05
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-18
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-05
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-18
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-17
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-17
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-15
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-12
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-17
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-16
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-16
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-14
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-17
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-17
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-14
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-17
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-15
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-06
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-17
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-16
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-14
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-08
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-06
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-17
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-06
2rfa_A232 Transient receptor potential cation channel subfa 5e-17
2rfa_A232 Transient receptor potential cation channel subfa 1e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-17
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-04
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-11
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-16
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-16
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-13
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-16
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-15
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-16
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-16
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-16
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-16
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-09
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-15
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-15
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-15
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-08
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-04
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-15
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-15
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-15
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-14
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-14
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-05
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-14
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-10
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-04
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-14
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-09
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-05
2pnn_A273 Transient receptor potential cation channel subfa 2e-13
2pnn_A273 Transient receptor potential cation channel subfa 1e-11
2pnn_A273 Transient receptor potential cation channel subfa 3e-10
2pnn_A273 Transient receptor potential cation channel subfa 2e-05
2pnn_A273 Transient receptor potential cation channel subfa 2e-04
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-13
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-12
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-13
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-09
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-09
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 8e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-10
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-06
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-04
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
 Score = 90.9 bits (227), Expect = 9e-22
 Identities = 36/234 (15%), Positives = 69/234 (29%), Gaps = 97/234 (41%)

Query: 39  PLHVASAYGHIDFVKEIINLRPDMAQEVNQDGFSPMHMASSIGHTEVVRELLKVDRKLCQ 98
            +H  +A G +D +KE +    ++  + ++ GF+P+  AS+ G  E VR LL+       
Sbjct: 5   SIHQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLE------- 57

Query: 99  LQG--PEAK-----TPLHCAAIKGRSHAVAEMLSACPECVEDVTIQH-----------YT 140
             G  P        + L  A+  G    +  +L           ++             T
Sbjct: 58  -WGADPHILAKERESALSLASTGG-YTDIVGLL-----------LERDVDINIYDWNGGT 104

Query: 141 ALHLAIKSSQYGVIAIIVDWIREMKKEHIFNMRDEQGNTKIQSYDLSSNYKEQLKTWIHW 200
            L  A    +                                                H 
Sbjct: 105 PLLYA---VRGN----------------------------------------------HV 115

Query: 201 QVIELLLGHQANASQGLEVNAINHSGLTAIDLLLIFPSEAGDREIEEILRSAGA 254
           + +E LL   A+      +     SG T     +      G R++++++ +   
Sbjct: 116 KCVEALLARGAD------LTTEADSGYTP----MDLAVALGYRKVQQVIENHIL 159
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query449
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.98
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.98
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.98
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.9
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.89
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.89
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.89
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.88
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.88
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.87
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.86
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.86
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.85
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.85
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.84
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.81
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.79
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.74
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.72
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
Probab=100.00  E-value=2.1e-40  Score=302.13  Aligned_cols=224  Identities=20%  Similarity=0.313  Sum_probs=210.3

Q ss_pred             CHHHHHHHHhCCHHHHHHHHhcCccccccccCCCCChHHHHHHHcCCHHHHHHHHhhCCCcccccCCCCCcHHHHHHHcC
Q 042799            2 DRKLFEATQAGNVQSLHQLLGENPLILHTSALTSAGNPLHVASAYGHIDFVKEIINLRPDMAQEVNQDGFSPMHMASSIG   81 (449)
Q Consensus         2 dt~L~~Aa~~g~~~~v~~Ll~~~~~~~~~~~~~~g~t~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~g~tpLh~Aa~~g   81 (449)
                      ++|||.|++.|+.+.++.|++.++...... +..|.||||+|+..|+.+++++|+++|.++ +..|..|+||||+|+..|
T Consensus         7 ~~~l~~A~~~g~~~~v~~ll~~~~~~~~~~-~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~-~~~~~~g~t~L~~A~~~~   84 (231)
T 3aji_A            7 NIMICNLAYSGKLDELKERILADKSLATRT-DQDSRTALHWACSAGHTEIVEFLLQLGVPV-NDKDDAGWSPLHIAASAG   84 (231)
T ss_dssp             SSHHHHHHHHTCHHHHHHHHHHCGGGGGCC-CTTSCCHHHHHHHHTCHHHHHHHHHTTCCS-CCCCTTSCCHHHHHHHHT
T ss_pred             cchHHHHHHhCCHHHHHHHHHhchhhhhcC-CCCCCCHHHHHHHcCcHHHHHHHHHhCCCC-CCcCCCCCCHHHHHHHcC
Confidence            689999999999999999999887654333 345999999999999999999999999987 888999999999999999


Q ss_pred             cHHHHHHHHHcCcccccccCCCCCcHhHHHHHhCcHHHHHHHHhhCCCcccccccCCCcHHHHHHHhCCHhHHHHHHHHH
Q 042799           82 HTEVVRELLKVDRKLCQLQGPEAKTPLHCAAIKGRSHAVAEMLSACPECVEDVTIQHYTALHLAIKSSQYGVIAIIVDWI  161 (449)
Q Consensus        82 ~~~iv~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~~v~~Ll~~~~~~~~~~d~~g~t~Lh~A~~~~~~~~v~~Ll~~~  161 (449)
                      +.+++++|+++|+++ +.+|..|.||||+|+..|+.+++++|++.+.+ ++..|..|.||||+|+..|+.+++++|+++ 
T Consensus        85 ~~~~v~~Ll~~g~~~-~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~-~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~-  161 (231)
T 3aji_A           85 XDEIVKALLVKGAHV-NAVNQNGCTPLHYAASKNRHEIAVMLLEGGAN-PDAKDHYDATAMHRAAAKGNLKMVHILLFY-  161 (231)
T ss_dssp             CHHHHHHHHHTTCCT-TCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCC-TTCCCTTSCCHHHHHHHHTCHHHHHHHHHT-
T ss_pred             HHHHHHHHHHcCCCC-CCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCC-CCCcCCCCCcHHHHHHHcCCHHHHHHHHhc-
Confidence            999999999999998 88999999999999999999999999999887 888999999999999999999999999987 


Q ss_pred             HhhccccccccccCCCCCcccchhhhhcccchhhhhhHHHHHHHHhhCccccccCccccccCCCCCChHHHHhhCCCCcC
Q 042799          162 REMKKEHIFNMRDEQGNTKIQSYDLSSNYKEQLKTWIHWQVIELLLGHQANASQGLEVNAINHSGLTAIDLLLIFPSEAG  241 (449)
Q Consensus       162 ~~~~~~~~~n~~d~~G~T~Lh~~~~A~~~~~~~~~~~~~~iv~~Ll~~ga~~~~~~~~~~~n~~g~T~l~~A~~~~~~~~  241 (449)
                           +.+++.+|..|+||||   +|+..++       .+++++|+++|+      +++.+|..|.||+|+|    ...+
T Consensus       162 -----g~~~~~~~~~g~t~L~---~A~~~~~-------~~~v~~Ll~~ga------~~~~~~~~g~t~l~~A----~~~~  216 (231)
T 3aji_A          162 -----KASTNIQDTEGNTPLH---LACDEER-------VEEAKFLVTQGA------SIYIENKEEKTPLQVA----KGGL  216 (231)
T ss_dssp             -----TCCSCCCCTTSCCHHH---HHHHTTC-------HHHHHHHHHTTC------CSCCCCTTSCCHHHHS----CHHH
T ss_pred             -----CCCccccCCCCCCHHH---HHHHCCC-------HHHHHHHHHCCC------CCCCCCCCCCCHHHHH----HhhH
Confidence                 7889999999999999   9999999       999999999998      8999999999999999    7788


Q ss_pred             hhHHHHHHHHcCCC
Q 042799          242 DREIEEILRSAGAT  255 (449)
Q Consensus       242 ~~~i~~~Ll~~ga~  255 (449)
                      +.+++++|.++|++
T Consensus       217 ~~~i~~lL~~~~a~  230 (231)
T 3aji_A          217 GLILKRLAEGEEAS  230 (231)
T ss_dssp             HHHHHHHHHHHHHC
T ss_pred             HHHHHHHHcccccc
Confidence            99999999998876
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 449
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-18
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-14
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-15
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-14
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-14
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-13
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-10
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.001
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 5e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 7e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.002
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 9e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.004
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.001
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 83.1 bits (204), Expect = 7e-18
 Identities = 63/262 (24%), Positives = 103/262 (39%), Gaps = 31/262 (11%)

Query: 39  PLHVASAYGHIDFVKEIINLRPDMAQEVNQDGFSPMHMASSIGHTEVVRELLKVDRKLCQ 98
           PLHVAS  GH+  VK ++          N    +P+HMA+  GHTEV + LL+   K+  
Sbjct: 3   PLHVASFMGHLPIVKNLLQRGASP-NVSNVKVETPLHMAARAGHTEVAKYLLQNKAKV-N 60

Query: 99  LQGPEAKTPLHCAAIKGRSHAVAEMLSACPECVEDVTIQHYTALHLAIKSSQYGVIAIIV 158
            +  + +TPLHCAA  G ++ + ++L          T   +T LH+A +           
Sbjct: 61  AKAKDDQTPLHCAARIGHTN-MVKLLLENNANPNLATTAGHTPLHIAAREGHV------E 113

Query: 159 DWIREMKKEHIFNMRDEQGNTKIQSYDLSSNYKEQLKTWIHWQVIELLLGHQANASQGLE 218
             +  ++KE       ++G T +                   +V ELLL   A+      
Sbjct: 114 TVLALLEKEASQACMTKKGFTPLHVAAKYG----------KVRVAELLLERDAH------ 157

Query: 219 VNAINHSGLTAIDLLLIFPSEAGDREIEEILRSAGATGMGDDNQTSTGNPPASSAETNPL 278
            NA   +GLT     L       + +I ++L   G +         T  P   +A+ N +
Sbjct: 158 PNAAGKNGLTP----LHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYT--PLHIAAKQNQV 211

Query: 279 QTKNDVTEYFKFKKGRDSPGET 300
           +    + +Y          G T
Sbjct: 212 EVARSLLQYGGSANAESVQGVT 233
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query449
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.98
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.92
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.91
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.9
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.89
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.88
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.88
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.87
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 26S proteasome non-ATPase regulatory subunit 10, gankyrin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.6e-37  Score=279.71  Aligned_cols=219  Identities=22%  Similarity=0.336  Sum_probs=203.0

Q ss_pred             CHHHHHHHHhCCHHHHHHHHhcCccccccccCCCCChHHHHHHHcCCHHHHHHHHhhCCCcccccCCCCCcHHHHHHHcC
Q 042799            2 DRKLFEATQAGNVQSLHQLLGENPLILHTSALTSAGNPLHVASAYGHIDFVKEIINLRPDMAQEVNQDGFSPMHMASSIG   81 (449)
Q Consensus         2 dt~L~~Aa~~g~~~~v~~Ll~~~~~~~~~~~~~~g~t~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~g~tpLh~Aa~~g   81 (449)
                      ++.|+.+|..|+.+.|+.+++.++...... +..|+||||+||..|+.+++++|++.+... ...+..+.++++.++..|
T Consensus         4 ~~~~~~~a~~G~~~~v~~~l~~~~~~~~~~-D~~G~TpLh~Aa~~g~~e~~~~l~~~~~~~-~~~~~~~~~~~~~~~~~~   81 (223)
T d1uoha_           4 NLMVCNLAYSGKLEELKESILADKSLATRT-DQDSRTALHWACSAGHTEIVEFLLQLGVPV-NDKDDAGWSPLHIAASAG   81 (223)
T ss_dssp             SSHHHHHHHTTCHHHHHHHHHHCGGGGGCC-CTTSCCHHHHHHHHTCHHHHHHHHHHTCCS-CCCCTTCCCHHHHHHHHT
T ss_pred             HHHHHHHHHhCCHHHHHHHHHhCCCcCcCc-CCCCCCHHHHHHHhhhhccccccccccccc-cccccccccccccccccc
Confidence            578999999999999999999887665443 445999999999999999999999999887 677788999999999999


Q ss_pred             cHHHHHHHHHcCcccccccCCCCCcHhHHHHHhCcHHHHHHHHhhCCCcccccccCCCcHHHHHHHhCCHhHHHHHHHHH
Q 042799           82 HTEVVRELLKVDRKLCQLQGPEAKTPLHCAAIKGRSHAVAEMLSACPECVEDVTIQHYTALHLAIKSSQYGVIAIIVDWI  161 (449)
Q Consensus        82 ~~~iv~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~~v~~Ll~~~~~~~~~~d~~g~t~Lh~A~~~~~~~~v~~Ll~~~  161 (449)
                      +.+++++|+++++++ +.+|.+|.||||+|+..|+.+++++|++++.+ ++.+|..|.||||+|+..++.+++++|++. 
T Consensus        82 ~~~i~~~Ll~~~~d~-~~~d~~g~tpL~~A~~~~~~e~~~~Ll~~g~d-~~~~~~~~~t~L~~a~~~~~~~~~~~L~~~-  158 (223)
T d1uoha_          82 RDEIVKALLGKGAQV-NAVNQNGCTPLHYAASKNRHEIAVMLLEGGAN-PDAKDHYEATAMHRAAAKGNLKMIHILLYY-  158 (223)
T ss_dssp             CHHHHHHHHHTTCCT-TCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCC-TTCCCTTSCCHHHHHHHTTCHHHHHHHHHT-
T ss_pred             ccchhHHHhccCcee-EeeCCCCCchhhHHHHcCCHHHHHHHHHCCCC-CCCcCCCCCccchhhhhcCCcchhhhhccc-
Confidence            999999999999988 88999999999999999999999999999877 889999999999999999999999999876 


Q ss_pred             HhhccccccccccCCCCCcccchhhhhcccchhhhhhHHHHHHHHhhCccccccCccccccCCCCCChHHHHhhCCCCcC
Q 042799          162 REMKKEHIFNMRDEQGNTKIQSYDLSSNYKEQLKTWIHWQVIELLLGHQANASQGLEVNAINHSGLTAIDLLLIFPSEAG  241 (449)
Q Consensus       162 ~~~~~~~~~n~~d~~G~T~Lh~~~~A~~~~~~~~~~~~~~iv~~Ll~~ga~~~~~~~~~~~n~~g~T~l~~A~~~~~~~~  241 (449)
                           +.++|.+|.+|+||||   .|+..++       .+++++|+++|+      +++.+|..|+||||+|     ..+
T Consensus       159 -----~~~i~~~d~~g~TpL~---~Aa~~g~-------~~~v~~LL~~Ga------d~~~~d~~g~tpl~~A-----~~~  212 (223)
T d1uoha_         159 -----KASTNIQDTEGNTPLH---LACDEER-------VEEAKLLVSQGA------SIYIENKEEKTPLQVA-----KGG  212 (223)
T ss_dssp             -----TCCSCCCCTTCCCHHH---HHHHTTC-------HHHHHHHHHTTC------CSCCCCTTSCCHHHHC-----CTT
T ss_pred             -----cceeeeccCCCCceec---cccccCc-------HHHHHHHHHCCC------CCCCCCCCCCCHHHHH-----HCC
Confidence                 7889999999999999   9999999       999999999999      9999999999999998     469


Q ss_pred             hhHHHHHHHH
Q 042799          242 DREIEEILRS  251 (449)
Q Consensus       242 ~~~i~~~Ll~  251 (449)
                      +.+++++|++
T Consensus       213 ~~~i~~~Ll~  222 (223)
T d1uoha_         213 LGLILKRMVE  222 (223)
T ss_dssp             HHHHHHHHHC
T ss_pred             CHHHHhcccC
Confidence            9999999975
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure