Citrus Sinensis ID: 042818

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440
MKVKGGGKRKVVNPALNDAEEANDDIENQENINYDSIDLIDVEYQENQEQEKENEKEKEKGKEKVGEEKNNEEEEEEEEEEEEGEDEDEDAVPQEERPKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPENANTWEPLENLQSCSDVIDAFEESLRSGKSSRKRKRKGGGSSSLPKKKQARTFSAPYYVTGGVGQSLPADPLINAGLIDLSPSTQSIGSGHVGGNVGNVNNLRTAKQTNDNRLANGSKQIDGRNEEAEYDPKLSELKGMISNNEANADKLALHFQEARVSEGNGLTNGLSKADQVEPLHSNRRTGARRRKPSSVKRFKQDLASTKVIVTQDSTPGIAVGCDSADEQLGIGNSSHKSKHEGPINASAIVKILKPIDFSASVSDNMQDVVVTFMAVRSDGKEVMVDNKYLKANNPLLLINFYEQHLKYSTQ
ccccccccccccccccccHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccccccccccccccccccccccEEEEEEEEcEEEEccEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccEEEEEEcccccEEEEEEEEEEcccccEEEEcccHHHHcccccHHHHHHHHHccccc
cccccccccccccHHHHcHHcccccccccHccccccccEEEEEHHHHHcHHHcccccccEccccccccccccccccHHHHHHcccccccccccHHHcHHHHHHHEEEEEEEEEEEEccEEEEEEEEccccHHHcEEEEHHHEccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEEccccccEEEEEEEEEcccccEEEEccHHHcccccHHHHHHHHHHcccccc
mkvkgggkrkvvnpalndaeeanddienqeninydsidLIDVEYQENQEQEKENEKEKEKgkekvgeeknneeeeeeeeeeeegedededavpqeerpkldegFFEIEAIRRKRVRKGQLQYLIKWrgwpenantweplenlqscSDVIDAFEESLRSGkssrkrkrkgggssslpkkkqartfsapyyvtggvgqslpadplinaglidlspstqsigsghvggnvgnvnnlrtakqtndnrlangskqidgrneeaeydpklselkgmisnneANADKLALHFQEARVsegngltnglskadqveplhsnrrtgarrrkpssvkrFKQDLASTKVIvtqdstpgiavgcdsadeqlgignsshkskhegpinASAIVKILkpidfsasvsdNMQDVVVTFMAVrsdgkevmvdnkylkannplLLINFYEQHLKYSTQ
mkvkgggkrkvvnpalndaeeanddienqeninYDSIDLIDVEYQENqeqekenekekekgkekvgeeknneeeeeeeeeeeegedededavpqeerpkldegffeieairrkrvrkGQLQYLIKWRGWPENANTWEPLENLQSCSDVIDAFEEslrsgkssrkrkrkgggssslpkkkqartFSAPYYVTGGVGQSLPADPLINAGLIDLSPSTQSIGSGHVGGNVGNVNNLRtakqtndnrlangskqidgrneeAEYDPKLSELKGMISNNEANADKLALHFQEARVSEGNGltnglskadqveplhsnrrtgarrrkpssvkrfkqdlastkvivtqdstpgiaVGCDSADEQLGIGNSSHKSKHEGPINASAIVKILKPIDFSASVSDNMQDVVVTFMAVRSDGKEVMVDNKYLKANNPLLLINFYEQHLKYSTQ
MkvkgggkrkvvNPALNDAEEANDDIENQENINYDSIDLIDVEYqenqeqekenekekekgkekvgeeknneeeeeeeeeeeegedededAVPQEERPKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPENANTWEPLENLQSCSDVIDAFEEslrsgkssrkrkrkgggssslpkkkQARTFSAPYYVTGGVGQSLPADPLINAGLIDLSPSTQSIGSGHvggnvgnvnnLRTAKQTNDNRLANGSKQIDGRNEEAEYDPKLSELKGMISNNEANADKLALHFQEARVSEGNGLTNGLSKADQVEPLHSNRRTGARRRKPSSVKRFKQDLASTKVIVTQDSTPGIAVGCDSADEQLGIGNSSHKSKHEGPINASAIVKILKPIDFSASVSDNMQDVVVTFMAVRSDGKEVMVDNKYLKANNPLLLINFYEQHLKYSTQ
*********************************YDSIDLIDV************************************************************GFFEIEAIRRKRVRKGQLQYLIKWRGWPENANTWEPLENLQSCSDVIDA*********************************SAPYYVTGGVGQSLPADPLINAGLIDL*****************************************************************************************************************************VIV*******IAVG************************ASAIVKILKPIDFSASVSDNMQDVVVTFMAVRSDGKEVMVDNKYLKANNPLLLINFYEQHL*****
*******************************************************************************************************FFEIEAIRRKRVRKGQLQYLIKWRGWPENANTWEPLENLQSCSDVID************************************************************************************************************************************************************************************************************************************VKILKPIDFSASVSDNMQDVVVTFMAVRSDGKEVMVDNKYLKANNPLLLINFYEQHLKY***
********RKVVNPALNDAEEANDDIENQENINYDSIDLIDVEY****************************************************RPKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPENANTWEPLENLQSCSDVIDAFEE*************************QARTFSAPYYVTGGVGQSLPADPLINAGLIDLSPSTQSIGSGHVGGNVGNVNNLRTAKQTNDNRLANGSKQIDGRNEEAEYDPKLSELKGMISNNEANADKLALHFQEARVSEGNGLTNGLSKADQVEPLH*****************FKQDLASTKVIVTQDSTPGIAVGCDSADEQLGIGN********GPINASAIVKILKPIDFSASVSDNMQDVVVTFMAVRSDGKEVMVDNKYLKANNPLLLINFYEQHLKYSTQ
**********************NDDIENQENINYDSIDLIDVEYQENQE******************************************VPQEERPKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPENANTWEPLENLQSCSDVIDAFEESLRS*****************************************************************************************************YDPKLS*********************************************************************************************************GPINASAIVKILKPIDFSASVSDNMQDVVVTFMAVRSDGKEVMVDNKYLKANNPLLLINFYEQHLKYS**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVKGGGKRKVVNPALNDAEEANDDIENQENINYDSIDLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVPQEERPKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPENANTWEPLENLQSCSDVIDAFEESLRSGKSSRKRKRKGGGSSSLPKKKQARTFSAPYYVTGGVGQSLPADPLINAGLIDLSPSTQSIGSGHVGGNVGNVNNLRTAKQTNDNRLANGSKQIDGRNEEAEYDPKLSELKGMISNNEANADKLALHFQEARVSEGNGLTNGLSKADQVEPLHSNRRTGARRRKPSSVKRFKQDLASTKVIVTQDSTPGIAVGCDSADEQLGIGNSSHKSKHEGPINASAIVKILKPIDFSASVSDNMQDVVVTFMAVRSDGKEVMVDNKYLKANNPLLLINFYEQHLKYSTQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query440 2.2.26 [Sep-21-2011]
Q946J8445 Chromo domain-containing yes no 0.704 0.696 0.463 5e-68
Q944N1399 Chromo domain protein LHP N/A no 0.718 0.791 0.419 1e-64
Q339W7415 Probable chromo domain-co yes no 0.138 0.146 0.732 4e-24
O55187 551 E3 SUMO-protein ligase CB yes no 0.265 0.212 0.385 8e-11
O00257 560 E3 SUMO-protein ligase CB yes no 0.195 0.153 0.411 2e-10
O95931251 Chromobox protein homolog no no 0.152 0.266 0.441 5e-10
P60889158 Chromobox protein homolog no no 0.152 0.424 0.455 6e-10
Q8VDS3158 Chromobox protein homolog no no 0.152 0.424 0.455 6e-10
P05205206 Heterochromatin protein 1 no no 0.175 0.373 0.410 8e-10
P30658 519 Chromobox protein homolog no no 0.109 0.092 0.520 3e-08
>sp|Q946J8|LHP1_ARATH Chromo domain-containing protein LHP1 OS=Arabidopsis thaliana GN=LHP1 PE=1 SV=2 Back     alignment and function desciption
 Score =  258 bits (660), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 173/373 (46%), Positives = 216/373 (57%), Gaps = 63/373 (16%)

Query: 97  RPKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPENANTWEPLENLQSCSDVIDAFEESL 156
           RPKLDEGF+EIEAIRRKRVRKG++QYLIKWRGWPE ANTWEPLENLQS +DVIDAFE SL
Sbjct: 100 RPKLDEGFYEIEAIRRKRVRKGKVQYLIKWRGWPETANTWEPLENLQSIADVIDAFEGSL 159

Query: 157 RSGKSSRKRKRKGGGSSSLPKKKQARTFSAPYYVT----------GGVGQSLPADPLINA 206
           + GK  RKRKRK  G  S  KKKQ R  S  +  T                +P DPL   
Sbjct: 160 KPGKPGRKRKRKYAGPHSQMKKKQ-RLTSTSHDATEKSDSSTSLNNSSLPDIP-DPL--- 214

Query: 207 GLIDLSPSTQSIGSGHVGGNVGNVNNLRTAKQTNDNRLANG-SKQIDGRNEEAEYDPKLS 265
              DLS      GS  +  +V    N   + Q   N  + G ++Q+   + E EYDP L+
Sbjct: 215 ---DLS------GSSLLNRDV-EAKNAYVSNQVEANSGSVGMARQVRLIDNEKEYDPTLN 264

Query: 266 ELKGMISNNEANADKLALHFQEARVSEGNGL--------TNGLSKADQVEPLHSNRRTGA 317
           EL+G ++N+             A  S+G G+         NGL K    E   ++R  GA
Sbjct: 265 ELRGPVNNSNG-----------AGCSQGGGIGSEGDNVRPNGLLKVYPKELDKNSRFIGA 313

Query: 318 RRRKPSSVKRFKQDLAST---KVIVTQDSTPGIAVGCDSADEQLGIGNS----------S 364
           +RRK  SVKRFKQD +++        Q+ TP +    DS      +GN           S
Sbjct: 314 KRRKSGSVKRFKQDGSTSNNHTAPTDQNLTPDLTT-LDSFGRIARMGNEYPGVMENCNLS 372

Query: 365 HKSKHEGPINASAIVKILKPIDFSASVSDNMQDVVVTFMAVRSDGKEVMVDNKYLKANNP 424
            K+K    I    I KILKP+ F+ASVSDN+Q+V+VTF+A+RSDGKE +VDN++LKA+NP
Sbjct: 373 QKTK----IEELDITKILKPMSFTASVSDNVQEVLVTFLALRSDGKEALVDNRFLKAHNP 428

Query: 425 LLLINFYEQHLKY 437
            LLI FYEQHLKY
Sbjct: 429 HLLIEFYEQHLKY 441
Structural component of heterochromatin involved in gene repression, including several floral homeotic genes and FLT that regulates flowering time. Required for maintenance of vernalization-induced repression of FLC. As part of the PRC1-like complex, recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me), leading to epigenetic repression. PcG PRC1 complex maintains the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility.
Arabidopsis thaliana (taxid: 3702)
>sp|Q944N1|LHP1_SOLLC Chromo domain protein LHP1 OS=Solanum lycopersicum GN=LHP1 PE=1 SV=2 Back     alignment and function description
>sp|Q339W7|LHP1_ORYSJ Probable chromo domain-containing protein LHP1 OS=Oryza sativa subsp. japonica GN=LHP1 PE=3 SV=1 Back     alignment and function description
>sp|O55187|CBX4_MOUSE E3 SUMO-protein ligase CBX4 OS=Mus musculus GN=Cbx4 PE=1 SV=2 Back     alignment and function description
>sp|O00257|CBX4_HUMAN E3 SUMO-protein ligase CBX4 OS=Homo sapiens GN=CBX4 PE=1 SV=3 Back     alignment and function description
>sp|O95931|CBX7_HUMAN Chromobox protein homolog 7 OS=Homo sapiens GN=CBX7 PE=1 SV=1 Back     alignment and function description
>sp|P60889|CBX7_RAT Chromobox protein homolog 7 OS=Rattus norvegicus GN=Cbx7 PE=2 SV=1 Back     alignment and function description
>sp|Q8VDS3|CBX7_MOUSE Chromobox protein homolog 7 OS=Mus musculus GN=Cbx7 PE=1 SV=1 Back     alignment and function description
>sp|P05205|HP1_DROME Heterochromatin protein 1 OS=Drosophila melanogaster GN=Su(var)205 PE=1 SV=2 Back     alignment and function description
>sp|P30658|CBX2_MOUSE Chromobox protein homolog 2 OS=Mus musculus GN=Cbx2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query440
224126057438 chromodomain protein [Populus trichocarp 0.806 0.810 0.600 1e-112
224144902435 chromo domain protein [Populus trichocar 0.945 0.956 0.546 1e-109
255565966462 Heterochromatin protein, putative [Ricin 0.763 0.727 0.576 4e-95
156104756453 terminal flower 2 protein [Malus x domes 0.770 0.748 0.553 5e-94
156104764453 like heterochromatin protein 1 [Malus x 0.770 0.748 0.553 6e-94
156104754453 terminal flower 2 protein [Malus x domes 0.770 0.748 0.550 2e-93
156104758456 terminal flower 2 protein [Malus x domes 0.772 0.745 0.549 3e-92
156104760456 terminal flower 2 protein [Malus x domes 0.772 0.745 0.549 3e-92
225436225424 PREDICTED: chromo domain protein LHP1 [V 0.754 0.783 0.537 1e-88
449454536454 PREDICTED: chromo domain-containing prot 0.790 0.766 0.510 2e-88
>gi|224126057|ref|XP_002319745.1| chromodomain protein [Populus trichocarpa] gi|222858121|gb|EEE95668.1| chromodomain protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 221/368 (60%), Positives = 262/368 (71%), Gaps = 13/368 (3%)

Query: 83  EGEDEDEDAVPQEERPKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPENANTWEPLENL 142
           +G+DE  +    EER KLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPE ANTWEPLENL
Sbjct: 73  KGKDEKGNLF-DEERTKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPETANTWEPLENL 131

Query: 143 QSCSDVIDAFEESLRSGKSSRKRKRKGGGSSSLPKKKQARTFSAPYYV----TGGVGQSL 198
           QSCSDVIDAFEESLRSG+SSRKRKRK G   +  KKKQ R+ SA Y V         + L
Sbjct: 132 QSCSDVIDAFEESLRSGRSSRKRKRKHGAPHTPSKKKQPRS-SAVYNVMDVEVSIADKHL 190

Query: 199 PADPLINAGLIDLSPSTQSIGSGHVGGNVGNVNNLRTAKQTNDNRLANGSKQIDGRNEEA 258
           P+ PL N+ L DL   +Q IG GH G + G+VNN++T+KQT++N   NGSK I  R E+ 
Sbjct: 191 PSAPLNNSLLADLPSPSQFIGLGHGGESSGDVNNIKTSKQTDENGSINGSKHIFERKEDN 250

Query: 259 EYDPKLSELKGMISNNEANADKLALHFQEARVSEGNGLTNGLSKADQVEPLHSNRRTGAR 318
           EYDPKLSEL G I N + N +K  +HFQE + SE NG+ NGL K D V+ + ++R TGA+
Sbjct: 251 EYDPKLSELIGTIPNIDVNTNKFTIHFQEEKASEDNGIANGLPKVDYVDLVQNSRCTGAK 310

Query: 319 RRKPSSVKRFKQDLASTKVIVTQDSTPGIAVGCDSADEQLGI-------GNSSHKSKHEG 371
           +RK  SVKRFK+D    + +   +S+   +VG   A  Q GI       GNSSH      
Sbjct: 311 KRKSGSVKRFKKDSVMCEPVFLPNSSGNFSVGSTGAAAQPGIENPSLTWGNSSHMPMTGN 370

Query: 372 PINASAIVKILKPIDFSASVSDNMQDVVVTFMAVRSDGKEVMVDNKYLKANNPLLLINFY 431
            INA AI KILKPI FSASV DN+QDV++TF A+RSDG+EV VDNK+LKANNP LLINFY
Sbjct: 371 SINAFAITKILKPIGFSASVFDNVQDVLITFRALRSDGQEVTVDNKFLKANNPHLLINFY 430

Query: 432 EQHLKYST 439
           EQHLKYST
Sbjct: 431 EQHLKYST 438

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224144902|ref|XP_002325456.1| chromo domain protein [Populus trichocarpa] gi|222862331|gb|EEE99837.1| chromo domain protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255565966|ref|XP_002523971.1| Heterochromatin protein, putative [Ricinus communis] gi|223536698|gb|EEF38339.1| Heterochromatin protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|156104756|dbj|BAF75817.1| terminal flower 2 protein [Malus x domestica] Back     alignment and taxonomy information
>gi|156104764|dbj|BAF75821.1| like heterochromatin protein 1 [Malus x domestica] Back     alignment and taxonomy information
>gi|156104754|dbj|BAF75816.1| terminal flower 2 protein [Malus x domestica] gi|156104762|dbj|BAF75820.1| like heterochromatin protein 1 [Malus x domestica] Back     alignment and taxonomy information
>gi|156104758|dbj|BAF75818.1| terminal flower 2 protein [Malus x domestica] Back     alignment and taxonomy information
>gi|156104760|dbj|BAF75819.1| terminal flower 2 protein [Malus x domestica] Back     alignment and taxonomy information
>gi|225436225|ref|XP_002273726.1| PREDICTED: chromo domain protein LHP1 [Vitis vinifera] gi|296090196|emb|CBI40015.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449454536|ref|XP_004145010.1| PREDICTED: chromo domain-containing protein LHP1-like [Cucumis sativus] gi|449473948|ref|XP_004154028.1| PREDICTED: chromo domain-containing protein LHP1-like [Cucumis sativus] gi|449498945|ref|XP_004160678.1| PREDICTED: chromo domain-containing protein LHP1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query440
TAIR|locus:2176006445 TFL2 "TERMINAL FLOWER 2" [Arab 0.754 0.746 0.434 3.2e-58
MGI|MGI:1196439158 Cbx7 "chromobox 7" [Mus muscul 0.131 0.367 0.457 8e-13
RGD|735027158 Cbx7 "chromobox homolog 7" [Ra 0.131 0.367 0.457 8e-13
UNIPROTKB|B0QYP2158 CBX7 "Chromobox protein homolo 0.131 0.367 0.457 1.6e-12
UNIPROTKB|J3KS05174 CBX1 "Chromobox protein homolo 0.129 0.327 0.431 5e-12
UNIPROTKB|H9L191168 CBX1 "Uncharacterized protein" 0.129 0.339 0.431 8.8e-11
UNIPROTKB|F8WCW660 CBX4 "E3 SUMO-protein ligase C 0.106 0.783 0.531 8.9e-11
FB|FBgn0003607206 Su(var)205 "Suppressor of vari 0.118 0.252 0.471 2.3e-10
UNIPROTKB|G5E6N7185 CBX1 "Uncharacterized protein" 0.129 0.308 0.431 2.9e-10
UNIPROTKB|E2QT97185 CBX1 "Uncharacterized protein" 0.129 0.308 0.431 2.9e-10
TAIR|locus:2176006 TFL2 "TERMINAL FLOWER 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 598 (215.6 bits), Expect = 3.2e-58, P = 3.2e-58
 Identities = 156/359 (43%), Positives = 205/359 (57%)

Query:    94 QEERPKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPENANTWEPLENLQSCSDVIDAFE 153
             QEERPKLDEGF+EIEAIRRKRVRKG++QYLIKWRGWPE ANTWEPLENLQS +DVIDAFE
Sbjct:    97 QEERPKLDEGFYEIEAIRRKRVRKGKVQYLIKWRGWPETANTWEPLENLQSIADVIDAFE 156

Query:   154 EXXXXXXXXXXXXXXXXXXXXXXXXXQARTFSAPYYVTGGVGQSLPADPLINAGLIDLSP 213
                                       Q  T S  +  T    +S  +  L N+ L D+ P
Sbjct:   157 GSLKPGKPGRKRKRKYAGPHSQMKKKQRLT-STSHDATE---KSDSSTSLNNSSLPDI-P 211

Query:   214 STQSIGSGHXXXXXXXXXXLRTAKQTNDNRLANG-SKQIDGRNEEAEYDPKLSELKGMIS 272
                 +                 + Q   N  + G ++Q+   + E EYDP L+EL+G ++
Sbjct:   212 DPLDLSGSSLLNRDVEAKNAYVSNQVEANSGSVGMARQVRLIDNEKEYDPTLNELRGPVN 271

Query:   273 N-NEANADKLALHFQEARV-SEGNGLT-NGLSKADQVEPLHSNRRTGARRRKPSSVKRFK 329
             N N A         Q   + SEG+ +  NGL K    E   ++R  GA+RRK  SVKRFK
Sbjct:   272 NSNGAGCS------QGGGIGSEGDNVRPNGLLKVYPKELDKNSRFIGAKRRKSGSVKRFK 325

Query:   330 QDLASTK---VIVTQDSTPGIAVGCDS-------ADEQLGIGNSSHKSKHEGPINASAIV 379
             QD +++        Q+ TP +    DS        +E  G+  + + S+ +  I    I 
Sbjct:   326 QDGSTSNNHTAPTDQNLTPDLTT-LDSFGRIARMGNEYPGVMENCNLSQ-KTKIEELDIT 383

Query:   380 KILKPIDFSASVSDNMQDVVVTFMAVRSDGKEVMVDNKYLKANNPLLLINFYEQHLKYS 438
             KILKP+ F+ASVSDN+Q+V+VTF+A+RSDGKE +VDN++LKA+NP LLI FYEQHLKY+
Sbjct:   384 KILKPMSFTASVSDNVQEVLVTFLALRSDGKEALVDNRFLKAHNPHLLIEFYEQHLKYN 442
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0000791 "euchromatin" evidence=IDA
GO:0006325 "chromatin organization" evidence=IMP
GO:0005720 "nuclear heterochromatin" evidence=IDA
GO:0006342 "chromatin silencing" evidence=IEP;IMP
GO:0045814 "negative regulation of gene expression, epigenetic" evidence=IMP
GO:0010048 "vernalization response" evidence=RCA;IMP
GO:0003677 "DNA binding" evidence=IDA
GO:0035064 "methylated histone residue binding" evidence=IDA
GO:0048573 "photoperiodism, flowering" evidence=RCA;IMP
GO:0005515 "protein binding" evidence=IPI
GO:0045857 "negative regulation of molecular function, epigenetic" evidence=IMP
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0007346 "regulation of mitotic cell cycle" evidence=RCA
GO:0016246 "RNA interference" evidence=RCA
GO:0031048 "chromatin silencing by small RNA" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
GO:0009648 "photoperiodism" evidence=IMP
GO:0009825 "multidimensional cell growth" evidence=IMP
GO:0009910 "negative regulation of flower development" evidence=IMP
GO:0010016 "shoot system morphogenesis" evidence=IMP
GO:0048364 "root development" evidence=IMP
MGI|MGI:1196439 Cbx7 "chromobox 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|735027 Cbx7 "chromobox homolog 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|B0QYP2 CBX7 "Chromobox protein homolog 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KS05 CBX1 "Chromobox protein homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H9L191 CBX1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F8WCW6 CBX4 "E3 SUMO-protein ligase CBX4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0003607 Su(var)205 "Suppressor of variegation 205" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G5E6N7 CBX1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QT97 CBX1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query440
cd0003454 cd00034, ChSh, Chromo Shadow Domain, found in asso 6e-17
smart0029855 smart00298, CHROMO, Chromatin organization modifie 1e-13
pfam0038552 pfam00385, Chromo, Chromo (CHRromatin Organisation 2e-13
cd0002455 cd00024, CHROMO, Chromatin organization modifier ( 9e-13
smart0030061 smart00300, ChSh, Chromo Shadow Domain 3e-09
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-07
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 8e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-04
pfam04147809 pfam04147, Nop14, Nop14-like family 7e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 8e-04
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.002
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.003
pfam04006613 pfam04006, Mpp10, Mpp10 protein 0.003
PRK12329449 PRK12329, nusA, transcription elongation factor Nu 0.004
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 0.004
pfam05285317 pfam05285, SDA1, SDA1 0.004
PRK05658619 PRK05658, PRK05658, RNA polymerase sigma factor Rp 0.004
>gnl|CDD|237998 cd00034, ChSh, Chromo Shadow Domain, found in association with N-terminal chromo (CHRromatin Organization MOdifier) domain; Chromo domains mediate the interaction of the heterochromatin with other heterochromatin proteins, thereby affecting chromatin structure (e Back     alignment and domain information 
 Score = 74.3 bits (183), Expect = 6e-17
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 4/57 (7%)

Query: 381 ILKPIDFSASVSDNMQDVVVTFMAVRSDGKEVMVDNKYLKANNPLLLINFYEQHLKY 437
           ++KPI   AS SD   D  +TF+A   DG+  +V NK L    PLL+I+FYE+HL Y
Sbjct: 1   LVKPISG-ASKSD---DGELTFLAKWKDGQASLVPNKELNVKCPLLVISFYEEHLTY 53

g. Drosophila and human heterochromatin protein (HP1) and mammalian modifier 1 and modifier 2). Length = 54
>gnl|CDD|214605 smart00298, CHROMO, Chromatin organization modifier domain Back     alignment and domain information
>gnl|CDD|215889 pfam00385, Chromo, Chromo (CHRromatin Organisation MOdifier) domain Back     alignment and domain information
>gnl|CDD|237991 cd00024, CHROMO, Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>gnl|CDD|197638 smart00300, ChSh, Chromo Shadow Domain Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein Back     alignment and domain information
>gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 440
KOG2748369 consensus Uncharacterized conserved protein, conta 99.56
KOG1911270 consensus Heterochromatin-associated protein HP1 a 99.56
PF0038555 Chromo: Chromo (CHRromatin Organisation MOdifier) 99.52
cd0002455 CHROMO Chromatin organization modifier (chromo) do 99.4
smart0029855 CHROMO Chromatin organization modifier domain. 99.17
cd0003454 ChSh Chromo Shadow Domain, found in association wi 99.16
smart0030061 ChSh Chromo Shadow Domain. 98.88
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 97.32
PF0139358 Chromo_shadow: Chromo shadow domain Web page maint 96.52
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 96.47
cd0003454 ChSh Chromo Shadow Domain, found in association wi 96.36
PF0139358 Chromo_shadow: Chromo shadow domain Web page maint 96.27
PF1171755 Tudor-knot: RNA binding activity-knot of a chromod 95.64
smart0030061 ChSh Chromo Shadow Domain. 95.35
PF1406150 Mtf2_C: Polycomb-like MTF2 factor 2 94.46
>KOG2748 consensus Uncharacterized conserved protein, contains chromo domain [Chromatin structure and dynamics] Back     alignment and domain information 
Probab=99.56  E-value=4.3e-16  Score=156.41  Aligned_cols=85  Identities=40%  Similarity=0.690  Sum_probs=68.6

Q ss_pred             CCCCCCceEEEEEEEEeEEeCCeEEEEEEecCCCCCCCceeecCCcCChHHHHHHHHHHhhcCCCCCCCCCCCCCCCCCc
Q 042818           97 RPKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPENANTWEPLENLQSCSDVIDAFEESLRSGKSSRKRKRKGGGSSSLP  176 (440)
Q Consensus        97 ~p~~dEeEYEVEkILd~R~~~GkleYLVKWKGY~eseNTWEPeENL~dc~ELIeeFe~k~~~~K~srKRkRks~g~~s~~  176 (440)
                      +..+++.+|.+|.||.+|+++|+++|||||+||+..+|||||++||.+. .||..|+++.+..+...+|||   ++.+.+
T Consensus         3 l~avGe~VfAaEsIlkkRirKGrvEYlVKWkGWs~kyNTWEPEENILDp-RLi~AFe~rErek~~~~~kKr---gpkPk~   78 (369)
T KOG2748|consen    3 LSAVGERVFAAESILKKRIRKGRVEYLVKWKGWSQKYNTWEPEENILDP-RLIAAFEQREREKELYGKKKR---GPKPKG   78 (369)
T ss_pred             cccchhhHHHHHHHHHHHhhccceEEEEEecccccccCccCccccccCH-HHHHHHHhhhHHHhhhhhhcc---CCCCcc
Confidence            5678899999999999999999999999999999999999999999995 599999999776554333321   555555


Q ss_pred             ccccccCCC
Q 042818          177 KKKQARTFS  185 (440)
Q Consensus       177 kKrk~rs~s  185 (440)
                      ...+.++++
T Consensus        79 ~~~k~~a~s   87 (369)
T KOG2748|consen   79 FLLKARAAS   87 (369)
T ss_pred             chhhHHHhh
Confidence            555555433

>KOG1911 consensus Heterochromatin-associated protein HP1 and related CHROMO domain proteins [Chromatin structure and dynamics] Back     alignment and domain information
>PF00385 Chromo: Chromo (CHRromatin Organisation MOdifier) domain; InterPro: IPR023780 The CHROMO (CHRromatin Organization MOdifier) domain [, , , ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation Back     alignment and domain information
>cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>smart00298 CHROMO Chromatin organization modifier domain Back     alignment and domain information
>cd00034 ChSh Chromo Shadow Domain, found in association with N-terminal chromo (CHRromatin Organization MOdifier) domain; Chromo domains mediate the interaction of the heterochromatin with other heterochromatin proteins, thereby affecting chromatin structure (e Back     alignment and domain information
>smart00300 ChSh Chromo Shadow Domain Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>PF01393 Chromo_shadow: Chromo shadow domain Web page maintained by Rein Aasland; InterPro: IPR008251 Chromo shadow domain is distantly related to chromo domain Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>cd00034 ChSh Chromo Shadow Domain, found in association with N-terminal chromo (CHRromatin Organization MOdifier) domain; Chromo domains mediate the interaction of the heterochromatin with other heterochromatin proteins, thereby affecting chromatin structure (e Back     alignment and domain information
>PF01393 Chromo_shadow: Chromo shadow domain Web page maintained by Rein Aasland; InterPro: IPR008251 Chromo shadow domain is distantly related to chromo domain Back     alignment and domain information
>PF11717 Tudor-knot: RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F Back     alignment and domain information
>smart00300 ChSh Chromo Shadow Domain Back     alignment and domain information
>PF14061 Mtf2_C: Polycomb-like MTF2 factor 2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query440
2kvm_A74 Solution Structure Of The Cbx7 Chromodomain In Comp 5e-10
2l12_A56 Solution Nmr Structure Of The Chromobox Protein 7 W 5e-10
2k1b_A73 Solution Nmr Structure Of The Chromo Domain Of The 7e-10
3i8z_A55 Crystal Structure Of Human Chromobox Homolog 4 (Cbx 1e-09
3i91_A54 Crystal Structure Of Human Chromobox Homolog 8 (Cbx 6e-09
2k28_A60 Solution Nmr Structure Of The Chromo Domain Of The 1e-08
3i90_A51 Crystal Structure Of Human Chromobox Homolog 6 (Cbx 1e-08
3h91_A54 Crystal Structure Of The Complex Of Human Chromobox 1e-08
1kna_A69 Chromo Domain Of Hp1 Complexed With Histone H3 Tail 2e-08
2dnv_A64 Solution Structure Of Rsgi Ruh-055, A Chromo Domain 3e-08
3gv6_A58 Crystal Structure Of Human Chromobox Homolog 6 (Cbx 4e-08
2d9u_A74 Solution Structure Of The Chromo Domain Of Chromobo 4e-08
3tzd_A58 Crystal Structure Of The Complex Of Human Chromobox 4e-07
3f2u_A55 Crystal Structure Of Human Chromobox Homolog 1 (Cbx 7e-07
3fdt_A59 Crystal Structure Of The Complex Of Human Chromobox 8e-07
2l11_A54 Solution Nmr Structure Of The Cbx3 In Complex With 1e-06
3dm1_A58 Crystal Structure Of The Complex Of Human Chromobox 3e-06
4hae_A81 Crystal Structure Of The Cdyl2-Chromodomain Length 7e-06
1ap0_A73 Structure Of The Chromatin Binding (Chromo) Domain 1e-05
1pfb_A55 Structural Basis For Specific Binding Of Polycomb C 1e-05
2dnt_A78 Solution Structure Of Rsgi Ruh-064, A Chromo Domain 2e-05
1pdq_A72 Polycomb Chromodomain Complexed With The Histone H3 3e-05
3qo2_A64 Structural Insights For Mpp8 Chromodomain Interacti 1e-04
3mts_A64 Chromo Domain Of Human Histone-lysine N-methyltrans 2e-04
3lwe_A62 The Crystal Structure Of Mpp8 Length = 62 2e-04
>pdb|2KVM|A Chain A, Solution Structure Of The Cbx7 Chromodomain In Complex With A H3k27me2 Peptide Length = 74 Back     alignment and structure 
Iteration: 1

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 42/59 (71%), Gaps = 1/59 (1%)
Query: 96  ERPKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPENANTWEPLENLQSCSDVIDAFEE 154
           E   + E  F +E+IR+KRVRKG+++YL+KW+GWP   +TWEP E++     ++ A+EE
Sbjct: 5   ELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILD-PRLVMAYEE 62
>pdb|2L12|A Chain A, Solution Nmr Structure Of The Chromobox Protein 7 With H3k9me3 Length = 56 Back     alignment and structure
>pdb|2K1B|A Chain A, Solution Nmr Structure Of The Chromo Domain Of The Chromobox Protein Homolog 7 Length = 73 Back     alignment and structure
>pdb|3I8Z|A Chain A, Crystal Structure Of Human Chromobox Homolog 4 (Cbx4) Length = 55 Back     alignment and structure
>pdb|3I91|A Chain A, Crystal Structure Of Human Chromobox Homolog 8 (Cbx8) With H3k9 Peptide Length = 54 Back     alignment and structure
>pdb|2K28|A Chain A, Solution Nmr Structure Of The Chromo Domain Of The Chromobox Protein Homolog 4 Length = 60 Back     alignment and structure
>pdb|3I90|A Chain A, Crystal Structure Of Human Chromobox Homolog 6 (Cbx6) With H3k27 Peptide Length = 51 Back     alignment and structure
>pdb|3H91|A Chain A, Crystal Structure Of The Complex Of Human Chromobox Homolog 2 (Cbx2) And H3k27 Peptide Length = 54 Back     alignment and structure
>pdb|1KNA|A Chain A, Chromo Domain Of Hp1 Complexed With Histone H3 Tail Containing Dimethyllysine 9. Length = 69 Back     alignment and structure
>pdb|2DNV|A Chain A, Solution Structure Of Rsgi Ruh-055, A Chromo Domain From Mus Musculus Cdna Length = 64 Back     alignment and structure
>pdb|3GV6|A Chain A, Crystal Structure Of Human Chromobox Homolog 6 (Cbx6) With H3k9 Peptide Length = 58 Back     alignment and structure
>pdb|2D9U|A Chain A, Solution Structure Of The Chromo Domain Of Chromobox Homolog 2 From Human Length = 74 Back     alignment and structure
>pdb|3TZD|A Chain A, Crystal Structure Of The Complex Of Human Chromobox Homolog 3 (cbx3) Length = 58 Back     alignment and structure
>pdb|3F2U|A Chain A, Crystal Structure Of Human Chromobox Homolog 1 (Cbx1) Length = 55 Back     alignment and structure
>pdb|3FDT|A Chain A, Crystal Structure Of The Complex Of Human Chromobox Homolog 5 (Cbx5) With H3k9(Me)3 Peptide Length = 59 Back     alignment and structure
>pdb|2L11|A Chain A, Solution Nmr Structure Of The Cbx3 In Complex With H3k9me3 Peptide Length = 54 Back     alignment and structure
>pdb|3DM1|A Chain A, Crystal Structure Of The Complex Of Human Chromobox Homolog 3 (cbx3) With Peptide Length = 58 Back     alignment and structure
>pdb|4HAE|A Chain A, Crystal Structure Of The Cdyl2-Chromodomain Length = 81 Back     alignment and structure
>pdb|1AP0|A Chain A, Structure Of The Chromatin Binding (Chromo) Domain From Mouse Modifier Protein 1, Nmr, 26 Structures Length = 73 Back     alignment and structure
>pdb|1PFB|A Chain A, Structural Basis For Specific Binding Of Polycomb Chromodomain To Histone H3 Methylated At K27 Length = 55 Back     alignment and structure
>pdb|2DNT|A Chain A, Solution Structure Of Rsgi Ruh-064, A Chromo Domain From Human Cdna Length = 78 Back     alignment and structure
>pdb|1PDQ|A Chain A, Polycomb Chromodomain Complexed With The Histone H3 Tail Containing Trimethyllysine 27 Length = 72 Back     alignment and structure
>pdb|3QO2|A Chain A, Structural Insights For Mpp8 Chromodomain Interaction With Histone H3 Lysine 9 Length = 64 Back     alignment and structure
>pdb|3MTS|A Chain A, Chromo Domain Of Human Histone-lysine N-methyltransferase Suv39h1 Length = 64 Back     alignment and structure
>pdb|3LWE|A Chain A, The Crystal Structure Of Mpp8 Length = 62 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query440
3lwe_A62 M-phase phosphoprotein 8; MPP8, structural genomic 99.75
1ap0_A73 Modifier protein 1; chromatin-binding, protein int 99.74
2rso_A92 Chromatin-associated protein SWI6; chromodomain, s 99.74
3fdt_A59 Chromobox protein homolog 5; chromobox homolog5, C 99.73
3f2u_A55 Chromobox protein homolog 1; human chromobox homol 99.72
3i91_A54 Chromobox protein homolog 8; chromobox homolog 8, 99.72
2rsn_A75 Chromo domain-containing protein 1; chromodomain, 99.72
3h91_A54 Chromobox protein homolog 2; human chromobox homol 99.71
1q3l_A69 Heterochromatin protein 1; chromodomain, HP1, chro 99.7
1pfb_A55 Polycomb protein; chromatin, histone methylation, 99.69
2d9u_A74 Chromobox protein homolog 2 (isoform 2); chromobox 99.69
2dnt_A78 Chromodomain protein, Y chromosome-like, isoform B 99.69
2dnv_A64 Chromobox protein homolog 8; chromo domain, histon 99.69
2kvm_A74 Chromobox protein homolog 7; histone modification, 99.69
1pdq_A72 Polycomb protein; methyllysine, chromodomain, poly 99.68
3g7l_A61 Chromo domain-containing protein 1; chromodomain, 99.68
1g6z_A70 CLR4 protein; transferase; NMR {Schizosaccharomyce 99.68
2k1b_A73 Chromobox protein homolog 7; alpha/beta protein, c 99.68
3mts_A64 Histone-lysine N-methyltransferase SUV39H1; histon 99.67
4hae_A81 CDY-like 2, chromodomain Y-like protein 2; protein 99.65
2epb_A68 Chromodomain-helicase-DNA-binding protein 6; struc 99.41
1x3p_A54 Cpsrp43; chromo-2 domain, chloroplasts, LHCP, prot 99.31
2ee1_A64 Chromodomain helicase-DNA-binding protein 4; EC 3. 99.23
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.18
2b2y_C115 CHD-1, chromodomain-helicase-DNA-binding protein 1 99.13
2b2y_A187 CHD-1, chromodomain-helicase-DNA-binding protein 1 98.9
2h1e_A177 Chromo domain protein 1; CHD1, tandem chromodomain 98.88
2b2y_A187 CHD-1, chromodomain-helicase-DNA-binding protein 1 98.6
2h1e_A177 Chromo domain protein 1; CHD1, tandem chromodomain 98.55
3kup_A65 Chromobox protein homolog 3; chromo shadow domain, 98.43
2fmm_A74 Chromobox protein homolog 1; ENT domain, chromo sh 98.39
3i3c_A75 Chromobox protein homolog 5; CBX5, chromo shadow d 98.21
3p7j_A87 Heterochromatin protein 1; chromo shadow domain, g 98.18
3q6s_A78 Chromobox protein homolog 1; incenp, heterochromat 98.14
1e0b_A68 SWI6 protein; chromatin-binding, chromodomain, sha 96.46
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 96.37
1e0b_A68 SWI6 protein; chromatin-binding, chromodomain, sha 94.94
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 93.85
3p7j_A87 Heterochromatin protein 1; chromo shadow domain, g 93.21
2lcc_A76 AT-rich interactive domain-containing protein 4A; 92.7
3kup_A65 Chromobox protein homolog 3; chromo shadow domain, 92.2
3q6s_A78 Chromobox protein homolog 1; incenp, heterochromat 92.11
2ro0_A92 Histone acetyltransferase ESA1; HAT, chromodomain, 91.48
2rnz_A94 Histone acetyltransferase ESA1; HAT, chromodomain, 91.14
3i3c_A75 Chromobox protein homolog 5; CBX5, chromo shadow d 90.37
2eko_A87 Histone acetyltransferase htatip; chromo domain, h 90.28
2fmm_A74 Chromobox protein homolog 1; ENT domain, chromo sh 90.26
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 90.17
2bud_A92 Males-absent on the first protein; transferase, MO 89.22
1wgs_A133 MYST histone acetyltransferase 1; tudor domain, MY 87.94
2lrq_A85 Protein MRG15, NUA4 complex subunit EAF3 homolog; 87.28
3oa6_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 84.71
3m9p_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 84.08
3m9q_A101 Protein MALE-specific lethal-3; chromodomain, MSL3 84.07
>3lwe_A M-phase phosphoprotein 8; MPP8, structural genomics, structural genomics consortium, S repeat, nucleus, cell cycle; 2.05A {Homo sapiens} SCOP: b.34.13.0 PDB: 3r93_A* 3svm_A* 3qo2_A* Back     alignment and structure
Probab=99.75  E-value=3.8e-19  Score=137.55  Aligned_cols=59  Identities=29%  Similarity=0.749  Sum_probs=55.5

Q ss_pred             CCceEEEEEEEEeEEeCCeEEEEEEecCCCCCCCceeecCCcCChHHHHHHHHHHhhcC
Q 042818          101 DEGFFEIEAIRRKRVRKGQLQYLIKWRGWPENANTWEPLENLQSCSDVIDAFEESLRSG  159 (440)
Q Consensus       101 dEeEYEVEkILd~R~~~GkleYLVKWKGY~eseNTWEPeENL~dc~ELIeeFe~k~~~~  159 (440)
                      ++++|+||+||++|..+|+++|||||+||+..++||||++||.+|+++|.+|+.++...
T Consensus         1 ge~~y~VE~Il~~r~~~g~~~YlVkWkGy~~~~~TWEp~~nl~~~~~li~~f~~~~~~~   59 (62)
T 3lwe_A            1 GEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAEN   59 (62)
T ss_dssp             CCCSCCEEEEEEEEEETTEEEEEEEETTSCGGGCEEEEHHHHTTCHHHHHHHHHHHHHH
T ss_pred             CCceEEEEEEEEEEEcCCeEEEEEEEeCCCCcCCCeeeHhHhhccHHHHHHHHHhhHhh
Confidence            46799999999999999999999999999999999999999999999999999998753
>1ap0_A Modifier protein 1; chromatin-binding, protein interaction motif, alpha+beta; NMR {Mus musculus} SCOP: b.34.13.2 PDB: 1guw_A* Back     alignment and structure
>2rso_A Chromatin-associated protein SWI6; chromodomain, silencing, chromosomal protein, Met transcription; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3fdt_A Chromobox protein homolog 5; chromobox homolog5, CBX5, structural GENO structural genomics consortium, SGC, centromere, nucleus, phosphoprotein; HET: M3L; 2.00A {Homo sapiens} Back     alignment and structure
>3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* Back     alignment and structure
>3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} SCOP: b.34.13.2 PDB: 3gv6_A* 3i90_A* Back     alignment and structure
>2rsn_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, RNA-mediated gene SIL chromosomal protein, methylation; HET: M3L; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3h91_A Chromobox protein homolog 2; human chromobox homolog 2, CBX2, structural genomics, structural genomics consortium, SGC, chromatin regulator, D binding, nucleus; HET: M3L; 1.50A {Homo sapiens} SCOP: b.34.13.2 PDB: 2k28_A 3i8z_A Back     alignment and structure
>1q3l_A Heterochromatin protein 1; chromodomain, HP1, chromatin, methyllysine, monomethyllysine, structural protein; HET: MLZ; 1.64A {Drosophila melanogaster} SCOP: b.34.13.2 PDB: 1kne_A* 1kna_A* Back     alignment and structure
>1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>2d9u_A Chromobox protein homolog 2 (isoform 2); chromobox homolog 2, chromo domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnt_A Chromodomain protein, Y chromosome-like, isoform B; histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
>2dnv_A Chromobox protein homolog 8; chromo domain, histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.34.13.2 Back     alignment and structure
>2kvm_A Chromobox protein homolog 7; histone modification, lysine methylation, chromobox, polycom chromatin-binding; HET: MLY; NMR {Mus musculus} Back     alignment and structure
>1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>3g7l_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, silencing, cell cycle, chromosome partition, DNA-binding, nucleus; HET: M3L; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>1g6z_A CLR4 protein; transferase; NMR {Schizosaccharomyces pombe} SCOP: b.34.13.2 Back     alignment and structure
>2k1b_A Chromobox protein homolog 7; alpha/beta protein, chromatin regulator, nucleus, repressor, transcription, transcription regulation; NMR {Homo sapiens} PDB: 2l12_A* 2l1b_A* Back     alignment and structure
>3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} Back     alignment and structure
>4hae_A CDY-like 2, chromodomain Y-like protein 2; protein binding, structural genomics consortiu; 2.00A {Homo sapiens} Back     alignment and structure
>2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3p_A Cpsrp43; chromo-2 domain, chloroplasts, LHCP, protein translocation, unknown function; NMR {Arabidopsis thaliana} SCOP: b.34.13.2 Back     alignment and structure
>2ee1_A Chromodomain helicase-DNA-binding protein 4; EC 3.6.1.-, ATP- dependent helicase CHD4, CHD-4, MI-2 autoantigen 218 kDa protein, MI2-beta; NMR {Homo sapiens} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2b2y_C CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 PDB: 2b2u_C* 2b2v_C* 2b2t_C* 2b2w_C Back     alignment and structure
>2b2y_A CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 b.34.13.2 PDB: 2b2u_A* 2b2v_A* 2b2w_A 2b2t_A* Back     alignment and structure
>2h1e_A Chromo domain protein 1; CHD1, tandem chromodomains, three-stranded ANT B-sheet, hydrolase; 2.20A {Saccharomyces cerevisiae} PDB: 2dy7_A 2dy8_A Back     alignment and structure
>2b2y_A CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 b.34.13.2 PDB: 2b2u_A* 2b2v_A* 2b2w_A 2b2t_A* Back     alignment and structure
>2h1e_A Chromo domain protein 1; CHD1, tandem chromodomains, three-stranded ANT B-sheet, hydrolase; 2.20A {Saccharomyces cerevisiae} PDB: 2dy7_A 2dy8_A Back     alignment and structure
>3kup_A Chromobox protein homolog 3; chromo shadow domain, structural genomics consortium, SGC, acetylation, chromatin regulator, nucleus, phosphoprotein; 1.77A {Homo sapiens} SCOP: b.34.13.2 PDB: 1dz1_A Back     alignment and structure
>2fmm_A Chromobox protein homolog 1; ENT domain, chromo shadow domain, EMSY protein, heterochroma protein 1, transcription; 1.80A {Homo sapiens} SCOP: b.34.13.2 PDB: 1s4z_A Back     alignment and structure
>3i3c_A Chromobox protein homolog 5; CBX5, chromo shadow domain, structural genomics, structural consortium, SGC, centromere, nucleus, phosphoprotein; 2.48A {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
>3p7j_A Heterochromatin protein 1; chromo shadow domain, gene silenc epigenetics, transcription; 2.30A {Drosophila melanogaster} Back     alignment and structure
>3q6s_A Chromobox protein homolog 1; incenp, heterochromatin, centromere, cell cycle; 1.93A {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
>1e0b_A SWI6 protein; chromatin-binding, chromodomain, shadow, heterochromatin; HET: 1PG; 1.9A {Schizosaccharomyces pombe} SCOP: b.34.13.2 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1e0b_A SWI6 protein; chromatin-binding, chromodomain, shadow, heterochromatin; HET: 1PG; 1.9A {Schizosaccharomyces pombe} SCOP: b.34.13.2 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3p7j_A Heterochromatin protein 1; chromo shadow domain, gene silenc epigenetics, transcription; 2.30A {Drosophila melanogaster} Back     alignment and structure
>2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>3kup_A Chromobox protein homolog 3; chromo shadow domain, structural genomics consortium, SGC, acetylation, chromatin regulator, nucleus, phosphoprotein; 1.77A {Homo sapiens} SCOP: b.34.13.2 PDB: 1dz1_A Back     alignment and structure
>3q6s_A Chromobox protein homolog 1; incenp, heterochromatin, centromere, cell cycle; 1.93A {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
>2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3i3c_A Chromobox protein homolog 5; CBX5, chromo shadow domain, structural genomics, structural consortium, SGC, centromere, nucleus, phosphoprotein; 2.48A {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
>2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fmm_A Chromobox protein homolog 1; ENT domain, chromo shadow domain, EMSY protein, heterochroma protein 1, transcription; 1.80A {Homo sapiens} SCOP: b.34.13.2 PDB: 1s4z_A Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Back     alignment and structure
>2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 Back     alignment and structure
>1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 Back     alignment and structure
>2lrq_A Protein MRG15, NUA4 complex subunit EAF3 homolog; epigenetics, LID complex, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>3oa6_A MALE-specific lethal 3 homolog; chromodomain, MSL3, histone H4 tail, DNA backbone recognitio methyllysine recognition, H4K20ME1; HET: DNA MLZ; 2.35A {Homo sapiens} PDB: 3ob9_A* Back     alignment and structure
>3m9q_A Protein MALE-specific lethal-3; chromodomain, MSL3, methyllysine recognition, aromatic CAGE, complex, transcription upregulation; 1.29A {Drosophila melanogaster} SCOP: b.34.13.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 440
d1guwa_73 b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mou 1e-16
d1pfba_55 b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Dr 2e-16
d2dnva152 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mo 3e-16
d1q3la_52 b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fru 1e-15
d1g6za_70 b.34.13.2 (A:) Histone methyltransferase clr4, chr 3e-15
d2dnta166 b.34.13.2 (A:8-73) Chromodomain protein, Y-like is 1e-14
d2dy7a181 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 1e-12
d2b2ya180 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 7e-11
d2dy8a169 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 3e-10
d1x3pa154 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidops 5e-09
d2b2ya295 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 ( 1e-06
d2f5ka183 b.34.13.3 (A:6-88) Mortality factor 4-like protein 2e-05
d2huga155 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidops 0.004
>d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Length = 73 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Chromo domain-like
family: Chromo domain
domain: Heterochromatin protein 1, HP1
species: Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]

 Score = 72.2 bits (177), Expect = 1e-16
 Identities = 27/70 (38%), Positives = 45/70 (64%), Gaps = 1/70 (1%)

Query: 95  EERPKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPENANTWEPLENLQSCSDVIDAFEE 154
           EE  + +E  + +E +  +RV KG+++YL+KW+G+ +  NTWEP ENL  C D+I  F +
Sbjct: 4   EEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENL-DCPDLIAEFLQ 62

Query: 155 SLRSGKSSRK 164
           S ++   + K
Sbjct: 63  SQKTAHETDK 72
>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 55 Back     information, alignment and structure
>d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 52 Back     information, alignment and structure
>d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 70 Back     information, alignment and structure
>d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2b2ya1 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 69 Back     information, alignment and structure
>d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 54 Back     information, alignment and structure
>d2b2ya2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2huga1 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 55 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query440
d1guwa_73 Heterochromatin protein 1, HP1 {Mouse (Mus musculu 99.72
d1pfba_55 Polycomb protein, Pc {Fruit fly (Drosophila melano 99.71
d1q3la_52 Heterochromatin protein 1, HP1 {Fruit fly (Drosoph 99.7
d2dnva152 Chromobox protein homolog 8 {Mouse (Mus musculus) 99.7
d2dnta166 Chromodomain protein, Y-like isoform {Human (Homo 99.69
d1g6za_70 Histone methyltransferase clr4, chromo domain {Fis 99.65
d2dy8a169 ATP-dependent helicase CHD1 (Chromo domain protein 99.45
d2b2ya180 ATP-dependent helicase CHD1 (Chromo domain protein 99.27
d1x3pa154 CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId 99.25
d2dy7a181 ATP-dependent helicase CHD1 (Chromo domain protein 99.15
d2b2ya295 ATP-dependent helicase CHD1 (Chromo domain protein 98.72
d2huga155 CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId 97.91
d3deoa144 CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId 97.69
d2fmma168 Heterochromatin protein 1, HP1 {Mouse (Mus musculu 97.31
d2f5ka183 Mortality factor 4-like protein 1, MRG15 {Human (H 97.16
d2fmma168 Heterochromatin protein 1, HP1 {Mouse (Mus musculu 90.21
d1wgsa_133 Probable histone acetyltransferase MYST1 {Mouse (M 88.46
d2buda188 Putative histone acetyltransferase MOF {Fruit fly 87.85
>d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Chromo domain-like
family: Chromo domain
domain: Heterochromatin protein 1, HP1
species: Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]

Probab=99.72  E-value=1.7e-18  Score=136.31  Aligned_cols=65  Identities=40%  Similarity=0.820  Sum_probs=58.5

Q ss_pred             CCCCCCCCceEEEEEEEEeEEeCCeEEEEEEecCCCCCCCceeecCCcCChHHHHHHHHHHhhcCC
Q 042818           95 EERPKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPENANTWEPLENLQSCSDVIDAFEESLRSGK  160 (440)
Q Consensus        95 e~~p~~dEeEYEVEkILd~R~~~GkleYLVKWKGY~eseNTWEPeENL~dc~ELIeeFe~k~~~~K  160 (440)
                      +.....++++|+||+||++|..+|+++|||||+||+..++||||++|| +|+++|.+|+++++..+
T Consensus         4 e~~~~d~~~eyeVE~Il~~r~~~~~~~YlVkW~Gy~~~~~TWEp~~nl-~~~~~i~~f~~~~~~~~   68 (73)
T d1guwa_           4 EEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENL-DCPDLIAEFLQSQKTAH   68 (73)
T ss_dssp             SCCCSCCCCCCBEEEECCCBCCTTCCEECEEESSSCTTSCCCEETTTE-ECHHHHHHHHHHHCSSS
T ss_pred             cccccCCCceEEEEEEEEEEEcCCcEEEEEEECCCCCcCCcCcChHHC-CCHHHHHHHHHHhhccc
Confidence            455667788999999999999999999999999999999999999999 79999999999876543
>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b2ya1 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b2ya2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2huga1 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3deoa1 b.34.13.2 (A:85-128) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fmma1 b.34.13.2 (A:108-175) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Back     information, alignment and structure
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fmma1 b.34.13.2 (A:108-175) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Back     information, alignment and structure
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure