Mediates the conversion of geranyl diphosphate into alpha-terpineol, a monoterpenol. Monoterpenols contribute to the final grape and wine aroma and flavor. Also forms some 1,8-cineole and traces of other monoterpenoids.
Catalyzes a mixture of sesquiterpenoids from (2E,6E)-farnesyl diphosphate. Catalyzes the formation of exo-alpha-bergamotene, as well as (E)-nerolidol, (Z)-alpha-bisabolene, (E)-beta-farnesene and beta-sesquiphellandrene. Also has activity towards geranyl diphosphate, but to a much lesser extent.
Sesquiterpene synthase that catalyzes the formation of alpha-zingiberene and other sesquiterpenes from trans,trans-farnesyl diphosphate (FPP). May have an additional monoterpene synthase activity.
Involved in monoterpene (C10) biosynthesis. The major product is beta-myrcene (56%) followed by (E)-beta-ocimene (20%) and minor amounts (less than 5%) of the cyclic monoterpene (-)-limonene, (+)-limonene, 2-carene and tricyclene.
Monoterpene synthase converting geranyl diphosphate into alpha-terpineol. In vitro, can also have an sesquiterpene synthase activity, converting farnesyl diphosphate into (E)-alpha-bisabolene (33.1%), alpha-bisabolene (18.7%), beta-sesquiphellandrene (15.8%), beta-bergamotene (12.6%), (Z)-alpha-farnesene (10.4%), and (Z)-alpha-bisabolene (9.4%).
Catalyzes the formation of the (-)-3-isothujone precursor sabinene from geranyl diphosphate. The enzyme also produces significant amounts of gamma-terpinene, terpinolene and limonene.
Monoterpene synthase that catalyzes the formation of (3R)-linalool from geranyl diphosphate, but not from isopentenyl diphosphate, dimethylallyl diphosphate, chrysanthemyl diphosphate, farnesyl diphosphate, (+)-copalyl diphosphate or geranylgeranyl diphosphate.
Artemisia annua (taxid: 35608)
EC: 4
EC: .
EC: 2
EC: .
EC: 3
EC: .
EC: 2
EC: 6
>sp|B5A434|MTPS1_SANAL (+)-alpha-terpineol synthase OS=Santalum album PE=1 SV=1
It has been suggested that this gene family be designated tps (for terpene synthase). It has been split into six subgroups on the basis of phylogeny, called tpsa-tpsf. tpsa includes vetispiridiene synthase, 5-epi- aristolochene synthase, and (+)-delta-cadinene synthase. tpsb includes (-)-limonene synthase. tpsc includes kaurene synthase A. tpsd includes taxadiene synthase, pinene synthase, and myrcene synthase. tpse includes kaurene synthase B. tpsf includes linalool synthase. Length = 177
>gnl|CDD|173832 cd00684, Terpene_cyclase_plant_C1, Plant Terpene Cyclases, Class 1
This CD includes a diverse group of monomeric plant terpene cyclases (Tspa-Tspf) that convert the acyclic isoprenoid diphosphates, geranyl diphosphate (GPP), farnesyl diphosphate (FPP), or geranylgeranyl diphosphate (GGPP) into cyclic monoterpenes, diterpenes, or sesquiterpenes, respectively; a few form acyclic species. Terpnoid cyclases are soluble enzymes localized to the cytosol (sesquiterpene synthases) or plastids (mono- and diterpene synthases). All monoterpene and diterpene synthases have restrict substrate specificity, however, some sesquiterpene synthases can accept both FPP and GPP. The catalytic site consists of a large central cavity formed by mostly antiparallel alpha helices with two aspartate-rich regions located on opposite walls. These residues mediate binding of prenyl diphosphates, via bridging Mg2+ ions (K+ preferred by gymnosperm cyclases), inducing conformational changes such that an N-terminal region forms a cap over the catalytic core. Loss of diphosphate from the enzyme-bound substrate (GPP, FPP, or GGPP) results in an allylic carbocation that electrophilically attacks a double bond further down the terpene chain to effect the first ring closure. Unlike monoterpene, sesquiterene, and macrocyclic diterpenes synthases, which undergo substrate ionization by diphosphate ester scission, Tpsc-like diterpene synthases catalyze cyclization reactions by an initial protonation step producing a copalyl diphosphate intermediate. These enzymes lack the aspartate-rich sequences mentioned above. Most diterpene synthases have an N-terminal, internal element (approx 210 aa) whose function is unknown. Length = 542
>PF01397 Terpene_synth: Terpene synthase, N-terminal domain; InterPro: IPR001906 Sequences containing this domain belong to the terpene synthase family
Probab=100.00 E-value=7.4e-36 Score=207.48 Aligned_cols=81 Identities=49% Similarity=0.854 Sum_probs=68.8
Q ss_pred ChHHHHHHHHHHHhhc-ChhhHHHHHHHHHHhccccchHHHHHHHHHHHhhcCCCCCCCCCCHHHHHHHHHHHhhCCCCC
Q 042821 1 AEELKGKVKTTIKYAT-EPLDQLEQIDNLQRLGLAYHFQTEIRNILHGIYNNNKDDNWRNKNVYAASVEFRLLRQHGYNV 79 (81)
Q Consensus 1 ~e~LkeeVk~ml~~~~-~~~~~L~lID~lqrLGi~~hF~~EI~~~L~~i~~~~~~~~~~~~dL~~~aL~FRLLRq~Gy~V 79 (81)
+++||++||.|+.... ++.++|+|||+||||||+|||++||+++|+++|+.+........|||+|||+|||||||||+|
T Consensus 28 ~~~Lk~~v~~~l~~~~~d~~~~L~lID~lqRLGi~yhFe~EI~~~L~~i~~~~~~~~~~~~dL~~~AL~FRLLRqhGy~V 107 (183)
T PF01397_consen 28 AEELKEEVRNMLPASYPDPLEKLELIDTLQRLGISYHFEDEIKEILDSIYRSWDEDNEEIDDLYTTALRFRLLRQHGYYV 107 (183)
T ss_dssp HHHHHHHHHHHHHSSSSHHHHHHHHHHHHHHTTCGGGGHHHHHHHHHHHHHTTTTTSHTSSCHHHHHHHHHHHHHTT---
T ss_pred HHHHHHHHHHHHhhcCCCHHHHHHHHHHHHHcCCcHHHHHHHHHHHHHHhhhccccccccCchhHHHHHHHHHHHcCCcc
Confidence 3789999999998754 799999999999999999999999999999999987764322259999999999999999999
Q ss_pred CC
Q 042821 80 SQ 81 (81)
Q Consensus 80 S~ 81 (81)
||
T Consensus 108 S~ 109 (183)
T PF01397_consen 108 SS 109 (183)
T ss_dssp -G
T ss_pred cH
Confidence 97
It has been suggested that this gene family be designated tps (for terpene synthase). Sequence comparisons reveal similarities between the monoterpene (C10) synthases, sesquiterpene (C15) synthases and the diterpene (C20) synthases. It has been split into six subgroups on the basis of phylogeny, called Tpsa-Tpsf []. Tpsa includes vetispiridiene synthase Q39979 from SWISSPROT, 5-epi- aristolochene synthase, Q40577 from SWISSPROT and (+)-delta-cadinene synthase P93665 from SWISSPROT . Tpsb includes (-)-limonene synthase, Q40322 from SWISSPROT. Tpsc includes copalyl diphosphate synthase (kaurene synthase A), O04408 from SWISSPROT. Tpsd includes taxadiene synthase, Q41594 from SWISSPROT, pinene synthase, O24475 from SWISSPROT and myrcene synthase, O24474 from SWISSPROT. Tpse includes ent-kaurene synthase B Q39548 from SWISSPROT. Tpsf includes linalool synthase Q9ZPN5 from SWISSPROT. In the fungus Phaeosphaeria sp. (strain L487) the synthesis of ent-kaurene from geranylgeranyl dophosphate is promoted by a single bifunctional protein [].; GO: 0016829 lyase activity, 0008152 metabolic process; PDB: 2ONH_A 2ONG_B 3P5R_A 3P5P_A 3N0F_A 3N0G_B 3PYB_A 3PYA_A 3G4F_A 3G4D_B ....
>cd00684 Terpene_cyclase_plant_C1 Plant Terpene Cyclases, Class 1
This CD includes a diverse group of monomeric plant terpene cyclases (Tspa-Tspf) that convert the acyclic isoprenoid diphosphates, geranyl diphosphate (GPP), farnesyl diphosphate (FPP), or geranylgeranyl diphosphate (GGPP) into cyclic monoterpenes, diterpenes, or sesquiterpenes, respectively; a few form acyclic species. Terpnoid cyclases are soluble enzymes localized to the cytosol (sesquiterpene synthases) or plastids (mono- and diterpene synthases). All monoterpene and diterpene synthases have restrict substrate specificity, however, some sesquiterpene synthases can accept both FPP and GPP. The catalytic site consists of a large central cavity formed by mostly antiparallel alpha helices with two aspartate-rich regions located on opposite walls. These residues mediate binding of prenyl diphosphates, via bridging Mg2+ ions (K+ preferred by gymnosperm cyclases), inducing conformational changes such that an N-terminal regi
>pdb|3LZ9|A Chain A, The Crystal Structure Of 5-Epi-Aristolochene Synthase M4 Mut Complexed With (2-Trans,6-Trans)-2-Fluorofarnesyl Diphospha Length = 550
>pdb|3G4D|A Chain A, Crystal Structure Of (+)-Delta-Cadinene Synthase From Gossypium Arboreum And Evolutionary Divergence Of Metal Binding Motifs For Catalysis Length = 554
>pdb|2J5C|A Chain A, Rational Conversion Of Substrate And Product Specificity In A Monoterpene Synthase. Structural Insights Into The Molecular Basis Of Rapid Evolution. Length = 569
>pdb|3P5P|A Chain A, Crystal Structure Of Taxadiene Synthase From Pacific Yew (Taxus Brevifolia) In Complex With Mg2+ And 13-Aza-13,14-Dihydrocopalyl Diphosphate Length = 764
>pdb|3PYA|A Chain A, Crystal Structure Of Ent-Copalyl Diphosphate Synthase From Arabidopsis Thaliana In Complex With (S)-15-Aza-14,15-Dihydrogeranylgeranyl Thiolodiphosphate Length = 727
>3pya_A ENT-copalyl diphosphate synthase, chloroplastic; class I and II terpene cyclase fold, class II diterpene CYCL DXXDD motif; HET: AG8 1PE; 2.25A {Arabidopsis thaliana} PDB: 3pyb_A* Length = 727
>3pya_A ENT-copalyl diphosphate synthase, chloroplastic; class I and II terpene cyclase fold, class II diterpene CYCL DXXDD motif; HET: AG8 1PE; 2.25A {Arabidopsis thaliana} PDB: 3pyb_A*
