Citrus Sinensis ID: 042906


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-----
MDQELLEVLRNGDENKIKQLALRQNIFSTSSPGGNTVLHMAVRFRNQQVIREILRQQNFIALRLHYSLLRQKNLMDETPLHIAARIGNRAIVSEIVKYVPAVNQAGPLPVLESLFRMRDIEGNTPLHNAVTNQHKRVIRILVEKDSVPSSYINKAYQTPLSIAIDARLNDSACFIIDKSPESLNTTRLPDELTLLHFVVMRQNYDIMVKILGTNKELIDRLDWHQRNPLHYAAASGNVKMAQRLLEESKQLAYKRDCNGETPLHLAAENGKLKVLKLLINKYPDAIEIRDNSDRSILHVAAKHGNWNIVSFILKSPEMENLINLVDRNGNTPLHLAAMGLHSDVVFTLSRHKSVNIRAKNRSARNNIALEIAEITRADGKEIQKHLTLKALKTAYAKRALSAEELQQKRQVSKEE
ccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHccHHHHHHHHHccccccccccccHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccc
ccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHcccccccccHHHHHHHcccHHHHHHHHHccccccHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHHHHccccccccccccccHHHHHHHHcccccc
MDQELLEVLRNGDENKIKQLALRQNIfstsspggntvLHMAVRFRNQQVIREILRQQNFIALRLHYSLLRqknlmdetpLHIAARIGNRAIVSEIVKYvpavnqagplpvleSLFRMrdiegntplhnavTNQHKRVIRILVekdsvpssyinkayqtpLSIAIDArlndsacfiidkspeslnttrlpdelTLLHFVVMRQNYDIMVKILGTNKELIDRLdwhqrnplhyaaaSGNVKMAQRLLEESKQLAYkrdcngetplhlaAENGKLKVLKLLINKypdaieirdnsdRSILHVAAKHGNWNIVSFILKSPEMENLINLvdrngntplhlAAMGLHSDVVFTLSRHKSVNIRAKNRSARNNIALEIAEITRADGKEIQKHLTLKALKTAYAKRALSAEELQQKRQVSKEE
MDQELLEVLRNGDENKIKQLALRQNIFstsspggntVLHMAVRFRNQQVIREILRQQNFIALRLHYSLLRQKNLMDETPLHIAARIGNRAIVSEIVKYVPAVNQAGPLPVLESLFRMRDIEGNtplhnavtnqhKRVIRILVekdsvpssyiNKAYQTPLSIAIDARLNDSACFIIDkspeslnttrlpdELTLLHFVVMRQNYDIMVKILGTNKELIDRLDWHQRNPLHYAAASGNVKMAQRLLEESKQLAYKRDCNGETPLhlaaengklKVLKLLINKYPDAIEIRDNSDRSILHVAAKHGNWNIVSFILKSPEMENLINLVDRNGNTPLHLAAMGLHSDVVFTLSRHKSvniraknrsarnniALEIAEITRADGKEIQKHLTLKALKTAYAKRALSAEelqqkrqvskee
MDQELLEVLRNGDENKIKQLALRQNIFSTSSPGGNTVLHMAVRFRNQQVIREILRQQNFIALRLHYSLLRQKNLMDETPLHIAARIGNRAIVSEIVKYVPAVNQAGPLPVLESLFRMRDIEGNTPLHNAVTNQHKRVIRILVEKDSVPSSYINKAYQTPLSIAIDARLNDSACFIIDKSPESLNTTRLPDELTLLHFVVMRQNYDIMVKILGTNKELIDRLDWHQRNPLHYAAASGNVKMAQRLLEESKQLAYKRDCNGETPLHLAAENGKLKVLKLLINKYPDAIEIRDNSDRSILHVAAKHGNWNIVSFILKSPEMENLINLVDRNGNTPLHLAAMGLHSDVVFTLSRHKSVNIRAKNRSARNNIALEIAEITRADGKEIQKHLTLKALKTAYAKRALSAEELQQKRQVSKEE
*******************LALRQNIFS****GGNTVLHMAVRFRNQQVIREILRQQNFIALRLHYSLLRQKNLMDETPLHIAARIGNRAIVSEIVKYVPAVNQAGPLPVLESLFRMRDIEGNTPLHNAVTNQHKRVIRILV************AYQTPLSIAIDARLNDSACFIIDKSPESLNTTRLPDELTLLHFVVMRQNYDIMVKILGTNKELIDRLDWHQRNPLHYAAASGNVKMAQRLLEESKQLAYKRDCNGETPLHLAAENGKLKVLKLLINKYPDAIEIRDNSDRSILHVAAKHGNWNIVSFILKSPEMENLINLVDRNGNTPLHLAAMGLHSDVVFTLSRHKSVNIRAKNRSARNNIALEIAEITRADGKEIQKHLTLKALKTAYA*******************
MDQELLEVLRNGDENKIKQLALRQNIFSTSSPGGNTVLHMAVRFRNQQVIREILRQQNFIALRLHYSLLRQKNLMDETPLHIAARIGNRAIVSEIVKYVPAVNQAGPLPVLESLFRMRDIEGNTPLHNAVTNQHKRVIRILVEKDSVPSSYINKAYQTPLSIAIDARLNDSACFIIDKSPESLNTTRLPDELTLLHFVVMRQNYDIMVKILGTNKELIDRLDWHQRNPLHYAAASGNVKMAQRLLEESKQLAYKRDCNGETPLHLAAENGKLKVLKLLINKYPDAIEIRDNSDRSILHVAAKHGNWNIVSFILKSPEMENLINLVDRNGNTPLHLAAMGLHSDVVFTLSRHKSVNIRAKNRSARNNIALEIAEITRADGKEIQKHLTLKALKTAYAKRALSAE************
MDQELLEVLRNGDENKIKQLALRQNIFSTSSPGGNTVLHMAVRFRNQQVIREILRQQNFIALRLHYSLLRQKNLMDETPLHIAARIGNRAIVSEIVKYVPAVNQAGPLPVLESLFRMRDIEGNTPLHNAVTNQHKRVIRILVEKDSVPSSYINKAYQTPLSIAIDARLNDSACFIIDKSPESLNTTRLPDELTLLHFVVMRQNYDIMVKILGTNKELIDRLDWHQRNPLHYAAASGNVKMAQRLLEESKQLAYKRDCNGETPLHLAAENGKLKVLKLLINKYPDAIEIRDNSDRSILHVAAKHGNWNIVSFILKSPEMENLINLVDRNGNTPLHLAAMGLHSDVVFTLSRHKSVNIRAKNRSARNNIALEIAEITRADGKEIQKHLTLKALKTAYAKRALS**************
MDQELLEVLRNGDENKIKQLALRQNIFSTSSPGGNTVLHMAVRFRNQQVIREILRQQNFIALRLHYSLLRQKNLMDETPLHIAARIGNRAIVSEIVKYVPAVNQAGPLPVLESLFRMRDIEGNTPLHNAVTNQHKRVIRILVEKDSVPSSYINKAYQTPLSIAIDARLNDSACFIIDKSPESLNTTRLPDELTLLHFVVMRQNYDIMVKILGTNKELIDRLDWHQRNPLHYAAASGNVKMAQRLLEESKQLAYKRDCNGETPLHLAAENGKLKVLKLLINKYPDAIEIRDNSDRSILHVAAKHGNWNIVSFILKSPEMENLINLVDRNGNTPLHLAAMGLHSDVVFTLSRHKSVNIRAKNRSARNNIALEIAEITRADGKEIQKHLTLKALKT***KRALSAEELQQKRQ*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQELLEVLRNGDENKIKQLALRQNIFSTSSPGGNTVLHMAVRFRNQQVIREILRQQNFIALRLHYSLLRQKNLMDETPLHIAARIGNRAIVSEIVKYVPAVNQAGPLPVLESLFRMRDIEGNTPLHNAVTNQHKRVIRILVEKDSVPSSYINKAYQTPLSIAIDARLNDSACFIIDKSPESLNTTRLPDELTLLHFVVMRQNYDIMVKILGTNKELIDRLDWHQRNPLHYAAASGNVKMAQRLLEESKQLAYKRDCNGETPLHLAAENGKLKVLKLLINKYPDAIEIRDNSDRSILHVAAKHGNWNIVSFILKSPEMENLINLVDRNGNTPLHLAAMGLHSDVVFTLSRHKSVNIRAKNRSARNNIALEIAEITRADGKEIQKHLTLKALKTAYAKRALSAEELQQKRQVSKEE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query415 2.2.26 [Sep-21-2011]
P57078832 Receptor-interacting seri no no 0.698 0.348 0.296 3e-20
P16157 1881 Ankyrin-1 OS=Homo sapiens no no 0.706 0.155 0.289 5e-20
Q9ERK0786 Receptor-interacting seri yes no 0.696 0.367 0.290 9e-20
Q6AWW5 524 Ankyrin repeat-containing no no 0.6 0.475 0.294 2e-19
Q4UMH6 1179 Putative ankyrin repeat p yes no 0.768 0.270 0.276 4e-19
Q12955 4377 Ankyrin-3 OS=Homo sapiens no no 0.761 0.072 0.268 1e-18
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no no 0.814 0.172 0.263 3e-18
Q02357 1862 Ankyrin-1 OS=Mus musculus no no 0.701 0.156 0.284 4e-18
Q54KA7 986 Ankyrin repeat, PH and SE yes no 0.763 0.321 0.274 2e-17
Q71S21 1002 Inversin-B OS=Xenopus lae N/A no 0.689 0.285 0.257 4e-17
>sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 Back     alignment and function desciption
 Score =  100 bits (248), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 98/330 (29%), Positives = 157/330 (47%), Gaps = 40/330 (12%)

Query: 34  GNTVLHMAVRFRNQQVIREILRQQNFIALRLHYSLLRQKNLMDE---TPLHIAARIGNRA 90
           G+T LHMAV  R + V+  +L ++  +            N  DE   T LH AA+ G+ +
Sbjct: 519 GSTPLHMAVERRVRGVVELLLARKISV------------NAKDEDQWTALHFAAQNGDES 566

Query: 91  IVSEIVKYVPAVNQAGPLPVLESLFRMRDIEGNTPLHNAVTNQHKRVIRILVEKDSVPSS 150
               +++   +VN+              D EG TP+H A  +  + ++RIL+ +  V  S
Sbjct: 567 STRLLLEKNASVNEV-------------DFEGRTPMHVACQHGQENIVRILLRR-GVDVS 612

Query: 151 YINKAYQTPLSIAIDARLNDSACFIIDKSPESLNTTRLPDELTLLHFVVMRQNYDIMVKI 210
              K    PL  A           +  +   S+N   L D  T LH    R +Y +  +I
Sbjct: 613 LQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTL-DGRTPLHLAAQRGHYRV-ARI 670

Query: 211 LGTNKELIDRLDWHQRNPLHYAAASGNVKMAQRLLEE-SKQLAYKRDCNGETPLHLAAEN 269
           L      ++      + PLH AA +G+   A+ LL   + + A   D  G T LHLAA N
Sbjct: 671 LIDLCSDVNVCSLLAQTPLHVAAETGHTSTARLLLHRGAGKEAMTSD--GYTALHLAARN 728

Query: 270 GKLKVLKLLINKYPDAIEIRDNSDRSILHVAAKHGNWNIVSFILKSPEMENLINLVDRNG 329
           G L  +KLL+ +  D +  R   +++ LH+AA HG+  +V  ++ +    ++I+L D  G
Sbjct: 729 GHLATVKLLVEEKADVLA-RGPLNQTALHLAAAHGHSEVVEELVSA----DVIDLFDEQG 783

Query: 330 NTPLHLAAMGLHSDVVFTLSRHKS-VNIRA 358
            + LHLAA G H+  V TL RH + +N+++
Sbjct: 784 LSALHLAAQGRHAQTVETLLRHGAHINLQS 813




Involved in stratified epithelial development. It is a direct transcriptional target of TP63. Plays a role in NF-kappa-B activation.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 Back     alignment and function description
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function description
>sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=4 SV=1 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 Back     alignment and function description
>sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query415
147820412 624 hypothetical protein VITISV_004974 [Viti 0.831 0.552 0.368 4e-45
302143222 617 unnamed protein product [Vitis vinifera] 0.831 0.559 0.368 5e-45
224117424381 predicted protein [Populus trichocarpa] 0.843 0.918 0.336 1e-42
255547566 581 ankyrin repeat-containing protein, putat 0.891 0.636 0.305 2e-42
224109440 577 predicted protein [Populus trichocarpa] 0.843 0.606 0.336 3e-42
224117420 577 predicted protein [Populus trichocarpa] 0.843 0.606 0.336 1e-41
224117416451 predicted protein [Populus trichocarpa] 0.845 0.778 0.329 3e-41
359485365 781 PREDICTED: ankyrin repeat-containing pro 0.848 0.450 0.326 2e-39
225446910 777 PREDICTED: ankyrin repeat-containing pro 0.857 0.458 0.328 4e-39
297739103 647 unnamed protein product [Vitis vinifera] 0.857 0.550 0.328 4e-39
>gi|147820412|emb|CAN63354.1| hypothetical protein VITISV_004974 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  188 bits (477), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 134/364 (36%), Positives = 203/364 (55%), Gaps = 19/364 (5%)

Query: 13  DENKIKQLALRQNIFSTSSPGGNTVLHMAVRFRNQQVIREILRQQNFIALRLHYSLLRQK 72
           D ++I  L L  ++   SS   NT LH+A R  N++++  +L +          SLL + 
Sbjct: 26  DHDEISNLNL--HVGFDSSHRKNTALHIAARVGNKKMVEALLSEGT------PASLLTE- 76

Query: 73  NLMDETPLHIAARIGNRAIVSEIVKYVPAVN--QAGPLPVLESLFRMRDIEGNTPLHNAV 130
           N   ETPLHIAAR G+  +V  ++ +       +AG +   + + RMR++EGNTPLH AV
Sbjct: 77  NSKHETPLHIAARSGHVHVVKFLIDWATQSTDVEAGGI---QQVLRMRNMEGNTPLHEAV 133

Query: 131 TNQHKRVIRILVEK-DSVPSSYINKAYQTPLSIAIDARLNDSACFIIDKS-PESLNTTRL 188
            N H   + +LVE  DS     +N A ++PL +A+D R ++    I+  S P SL   R 
Sbjct: 134 RNGHHSTVLVLVEANDSDLLVSLNNAGESPLFMAVDVRASEIVKTILPNSNPYSL-LHRS 192

Query: 189 PDELTLLHFVVMRQNYDIMVKILGTNKELIDRLDWHQRNPLHYAAASGNVKMAQRLLEES 248
            D  T+LH  ++R +   M  I+    EL++  D   R+PLHYAAASG + +   LL+  
Sbjct: 193 SDGQTILHRAILRADLKTMKIIIQHMPELVNEKDSCGRSPLHYAAASGALALVDHLLQLK 252

Query: 249 KQLAYKRDCNGETPLHLAAENGKLKVLKLLINKYPDAIEIRDNSDRSILHVAAKHGNWNI 308
                  D N  TP H+AAENG L VLKL + +    +E+ +N  ++ILHVAA++G+  +
Sbjct: 253 PSNGSFLDNNLATPAHMAAENGHLNVLKLFVKRCRYWVELLNNHHQNILHVAAQNGHLKV 312

Query: 309 VSFILKSPEMENLINLVDRNGNTPLHLAAMGLHSDVVFTLSRHKSVNIRAKNRSARNNIA 368
           V +I     + +L+N  D +GNTPLHLAA  LHS +V TL +  +++  A N+  +    
Sbjct: 313 VRYIQNMFMVNDLLNETDEDGNTPLHLAAAKLHSSIVSTLVQTGNMDTTAINK--KGETV 370

Query: 369 LEIA 372
           L+IA
Sbjct: 371 LDIA 374




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|302143222|emb|CBI20517.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224117424|ref|XP_002317571.1| predicted protein [Populus trichocarpa] gi|222860636|gb|EEE98183.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255547566|ref|XP_002514840.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223545891|gb|EEF47394.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224109440|ref|XP_002333254.1| predicted protein [Populus trichocarpa] gi|222835818|gb|EEE74253.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224117420|ref|XP_002317570.1| predicted protein [Populus trichocarpa] gi|222860635|gb|EEE98182.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224117416|ref|XP_002317569.1| predicted protein [Populus trichocarpa] gi|222860634|gb|EEE98181.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359485365|ref|XP_003633264.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225446910|ref|XP_002266647.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297739103|emb|CBI28754.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query415
TAIR|locus:2128781 677 AT4G03460 "AT4G03460" [Arabido 0.930 0.570 0.302 4.4e-39
TAIR|locus:2020833 616 AT1G03670 "AT1G03670" [Arabido 0.836 0.563 0.288 5.5e-32
TAIR|locus:2128791 683 AT4G03470 [Arabidopsis thalian 0.901 0.547 0.277 3.6e-30
TAIR|locus:2138391572 AT4G05040 "AT4G05040" [Arabido 0.932 0.676 0.272 1.1e-29
TAIR|locus:2128771 641 AT4G03450 "AT4G03450" [Arabido 0.918 0.594 0.267 3.6e-29
TAIR|locus:2129685 694 AT4G14390 "AT4G14390" [Arabido 0.867 0.518 0.278 1.9e-24
UNIPROTKB|F1NJ80 1699 ANK3 "Uncharacterized protein" 0.922 0.225 0.264 3.9e-22
UNIPROTKB|F1NNX8 1737 ANK3 "Uncharacterized protein" 0.922 0.220 0.264 4e-22
UNIPROTKB|F1NNX6 1824 ANK3 "Uncharacterized protein" 0.922 0.209 0.264 4.2e-22
UNIPROTKB|F1NNX7 1915 ANK3 "Uncharacterized protein" 0.922 0.2 0.264 4.5e-22
TAIR|locus:2128781 AT4G03460 "AT4G03460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 422 (153.6 bits), Expect = 4.4e-39, P = 4.4e-39
 Identities = 123/406 (30%), Positives = 204/406 (50%)

Query:     1 MDQELLEVLRNGDENKIKQLALRQNI-FSTSSPGGNTVLHMAVRFRNQQVIREILRQQNF 59
             M  + +  +R GDE  ++ +    NI  S+ +  GNT+LH+A    +  ++  IL     
Sbjct:    97 MGPKTIAAVRAGDETYLRDMKFDVNIALSSVNDHGNTMLHLAAAAGHTDLVCYILNA--- 153

Query:    60 IALRLHYSLLRQKNLMDETPLHIAARIGNRAIVSEIVKYVPAVNQAGPLPVLESLFRMRD 119
                  +  LL + N M E  LH+AA  G+ A+V  +V ++  ++   P  V + ++  +D
Sbjct:   154 -----YPGLLMKSNSMGEVALHVAAGAGHLAVVEALVSFIKDISCNKP-GVAKKIYFAKD 207

Query:   120 IEGNTPLHNAVTNQHKRVIRILVEKDSVPSSYINKAYQTPLSIAIDARLNDSACFIIDKS 179
                +  LH ++  +H +V   LV  +   S   N    +PL +A++A   D A  +   S
Sbjct:   208 RHQDNALHVSLKRKHLKVASCLVCAEQSLSFVANNDGVSPLYLAVEAGQADLAKTMWQHS 267

Query:   180 PE-SLNTTRLPDEL---TLLHFVVMRQNYDIMVKILGTNKELIDRLDWHQRNPLHYAAAS 235
                S +T+ L  ++   +++H  +  +  DI+V IL  +  LI+  D   R  L + A+ 
Sbjct:   268 NNGSSSTSTLASKIGGRSIVHGAMKARRKDILVAILSEDASLINFRD-EGRTCLSFGASL 326

Query:   236 GNVKMAQRLLEESKQLAYKRDCNGETPLHLAAENGKLKVLKLLINKYPDAIEIRDNSDRS 295
             G  +    LL+++    Y  D +G  P+H+A + G +K+LK ++ + PDA+E+ D  +++
Sbjct:   327 GYYEGFCYLLDKALDSVYVSDDDGSFPIHMAVKYGYVKILKAILKRCPDALELLDRENQN 386

Query:   296 ILHVAAKHGNWNIVSFIL---KSPEMENLINLVDRNGNTPLHLAAMGLHSDVVFTLSRHK 352
             +LHVAAK+G   ++ FIL   K    E LIN  D NGNTPLHLA    H  VV  L+   
Sbjct:   387 VLHVAAKNGKIEVLKFILRCCKDKNKEKLINEEDANGNTPLHLATKNWHPKVVSMLTWDN 446

Query:   353 SVNIRAKNRSARNNIALEIAEITRADGKEIQKHLTLKALKTAYAKR 398
              V+++  N       AL+IAE          + LT  AL +A A R
Sbjct:   447 RVDLKTLNHDGVT--ALDIAEKNMDSSYTFFERLTWMALISAGAPR 490




GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2020833 AT1G03670 "AT1G03670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128791 AT4G03470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138391 AT4G05040 "AT4G05040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128771 AT4G03450 "AT4G03450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129685 AT4G14390 "AT4G14390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJ80 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNX8 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNX6 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNX7 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query415
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-28
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-22
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-20
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-17
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-14
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-14
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-14
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-13
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-11
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-10
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 9e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-07
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 9e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-06
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 2e-06
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-06
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-06
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 5e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 7e-05
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-04
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-04
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-04
smart0024830 smart00248, ANK, ankyrin repeats 3e-04
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 4e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 6e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 9e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.001
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.002
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.003
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score =  106 bits (266), Expect = 7e-28
 Identities = 52/127 (40%), Positives = 80/127 (62%), Gaps = 5/127 (3%)

Query: 219 DRLDWHQRNPLHYAAASGNVKMAQRLLEESKQLAYKRDCNGETPLHLAAENGKLKVLKLL 278
           +  D   R PLH AA++G++++ + LLE    +   +D +G TPLHLAA+NG L+++KLL
Sbjct: 1   NARDEDGRTPLHLAASNGHLEVVKLLLENGADV-NAKDNDGRTPLHLAAKNGHLEIVKLL 59

Query: 279 INKYPDAIEIRDNSDRSILHVAAKHGNWNIVSFILKSPEMENLINLVDRNGNTPLHLAAM 338
           + K  D +  RD    + LH+AA++GN ++V  +LK       +N  D++G TPLHLAA 
Sbjct: 60  LEKGAD-VNARDKDGNTPLHLAARNGNLDVVKLLLKHGAD---VNARDKDGRTPLHLAAK 115

Query: 339 GLHSDVV 345
             H +VV
Sbjct: 116 NGHLEVV 122


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 415
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02792 631 ankyrin-like protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG0508 615 consensus Ankyrin repeat protein [General function 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
KOG0508 615 consensus Ankyrin repeat protein [General function 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
PHA02859209 ankyrin repeat protein; Provisional 99.97
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.97
PHA02795437 ankyrin-like protein; Provisional 99.97
PHA02795 437 ankyrin-like protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.96
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.95
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.95
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.94
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.94
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.94
PLN03192823 Voltage-dependent potassium channel; Provisional 99.93
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.92
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.92
KOG0514452 consensus Ankyrin repeat protein [General function 99.91
PHA02743166 Viral ankyrin protein; Provisional 99.9
PHA02743166 Viral ankyrin protein; Provisional 99.9
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.9
PHA02741169 hypothetical protein; Provisional 99.9
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.89
KOG0514452 consensus Ankyrin repeat protein [General function 99.89
PHA02884300 ankyrin repeat protein; Provisional 99.87
PHA02736154 Viral ankyrin protein; Provisional 99.87
PHA02741169 hypothetical protein; Provisional 99.87
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.87
PHA02884300 ankyrin repeat protein; Provisional 99.86
PHA02736154 Viral ankyrin protein; Provisional 99.86
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.85
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.81
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.8
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.8
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.79
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.77
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.77
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.75
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.74
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.72
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.69
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.6
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.6
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.54
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.53
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.53
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.52
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.49
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.48
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.47
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.45
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.45
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.42
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 99.25
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 99.07
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.94
PF1360630 Ank_3: Ankyrin repeat 98.94
PF1360630 Ank_3: Ankyrin repeat 98.91
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.89
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.85
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.84
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.82
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.8
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.77
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.7
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.61
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.6
KOG0522 560 consensus Ankyrin repeat protein [General function 98.58
KOG0522 560 consensus Ankyrin repeat protein [General function 98.5
KOG0511516 consensus Ankyrin repeat protein [General function 98.47
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.44
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.39
KOG2384223 consensus Major histocompatibility complex protein 98.33
KOG2384223 consensus Major histocompatibility complex protein 98.28
KOG0511 516 consensus Ankyrin repeat protein [General function 98.15
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.12
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.08
KOG0520975 consensus Uncharacterized conserved protein, conta 97.96
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.91
KOG2505591 consensus Ankyrin repeat protein [General function 97.11
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.07
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.06
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.02
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.89
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.74
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.05
KOG2505591 consensus Ankyrin repeat protein [General function 95.89
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 95.53
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 95.05
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 90.53
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 86.4
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 84.13
PLN03077 857 Protein ECB2; Provisional 80.42
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=7.3e-53  Score=401.45  Aligned_cols=339  Identities=20%  Similarity=0.237  Sum_probs=195.4

Q ss_pred             hHHHHHHHcCChhHHHHHHhhccc-cccCCCCCCCHHHHHH---------------------------------------
Q 042906            3 QELLEVLRNGDENKIKQLALRQNI-FSTSSPGGNTVLHMAV---------------------------------------   42 (415)
Q Consensus         3 ~~L~~A~~~g~~~~v~~ll~~~~~-~~~~~~~g~t~L~~A~---------------------------------------   42 (415)
                      ++||.|+..|+.|+|+.+++...+ +...|..|.||||+|+                                       
T Consensus        43 t~LH~A~~~g~~e~V~~ll~~~~~~~~~~~~~~~tpLh~a~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  122 (682)
T PHA02876         43 TAIHQALQLRQIDIVEEIIQQNPELIYITDHKCHSTLHTICIIPNVMDIVISLTLDCDIILDIKYASIILNKHKLDEACI  122 (682)
T ss_pred             hHHHHHHHHHhhhHHHHHHHhCcccchhhchhhccccccccCCCCccccccccccchhhcccccHHHHHHHHHHHHHHHH
Confidence            589999999999999999998866 4566778999999766                                       


Q ss_pred             -------------------------------HhCCHHHHHHHHhccchHHHHHHhHhhhcCCCCCCChHHHHHHhCcHHH
Q 042906           43 -------------------------------RFRNQQVIREILRQQNFIALRLHYSLLRQKNLMDETPLHIAARIGNRAI   91 (415)
Q Consensus        43 -------------------------------~~g~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~~   91 (415)
                                                     ..|+.+++++|++.         +++++.+|..|.||||+|+..|+.++
T Consensus       123 ~il~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~i~k~Ll~~---------Gadvn~~d~~G~TpLh~Aa~~G~~~i  193 (682)
T PHA02876        123 HILKEAISGNDIHYDKINESIEYMKLIKERIQQDELLIAEMLLEG---------GADVNAKDIYCITPIHYAAERGNAKM  193 (682)
T ss_pred             HHHHHHhcCCcccHHhhccchhhhHHHHHHHHCCcHHHHHHHHhC---------CCCCCCCCCCCCCHHHHHHHCCCHHH
Confidence                                           33556667777776         56677788888888888888888888


Q ss_pred             HHHHHhhccccccCCCcchhhhhhhcccCCCChHHHHHHHcCCHHHHHHHHhCCCCCcc---------------------
Q 042906           92 VSEIVKYVPAVNQAGPLPVLESLFRMRDIEGNTPLHNAVTNQHKRVIRILVEKDSVPSS---------------------  150 (415)
Q Consensus        92 v~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~g~t~l~~A~~~~~~~~v~~Ll~~~~~~~~---------------------  150 (415)
                      |++|+++|++++             ..+..|.||||+|+..++.+++++|++.+.+...                     
T Consensus       194 v~~LL~~Gad~n-------------~~~~~g~t~L~~A~~~~~~~ivk~Ll~~~~~~~~~~~~L~~ai~~~~~~~~~~Ll  260 (682)
T PHA02876        194 VNLLLSYGADVN-------------IIALDDLSVLECAVDSKNIDTIKAIIDNRSNINKNDLSLLKAIRNEDLETSLLLY  260 (682)
T ss_pred             HHHHHHCCCCcC-------------ccCCCCCCHHHHHHHcCCHHHHHHHHhcCCCCCCCcHHHHHHHHcCCHHHHHHHH
Confidence            888888888766             3566777888888887777777777665543321                     


Q ss_pred             -------cccccCCcHHHHHHHcCCh-hHHHHHhhhCCCCccCCCCCcchhHHHHHHHcC-CHHHHHHHHhcChhhhccc
Q 042906          151 -------YINKAYQTPLSIAIDARLN-DSACFIIDKSPESLNTTRLPDELTLLHFVVMRQ-NYDIMVKILGTNKELIDRL  221 (415)
Q Consensus       151 -------~~~~~~~~~l~~a~~~~~~-~~~~~ll~~~~~~~~~~~~~~~~~~l~~a~~~~-~~~~~~~ll~~~~~~~~~~  221 (415)
                             ..+..|.||||+|+..++. +++++|++.+.+....  +..|.||||.|+..| ..+.++.|+..+.+ ++..
T Consensus       261 ~~g~~vn~~d~~g~TpLh~Aa~~~~~~~iv~lLl~~gadin~~--d~~g~TpLh~Aa~~g~~~~~v~~Ll~~gad-in~~  337 (682)
T PHA02876        261 DAGFSVNSIDDCKNTPLHHASQAPSLSRLVPKLLERGADVNAK--NIKGETPLYLMAKNGYDTENIRTLIMLGAD-VNAA  337 (682)
T ss_pred             HCCCCCCCCCCCCCCHHHHHHhCCCHHHHHHHHHHCCCCCCCc--CCCCCCHHHHHHHhCCCHHHHHHHHHcCCC-CCCc
Confidence                   2233444555555544443 3444444444332221  234445555555444 24444444444433 4444


Q ss_pred             ccCCCCHHHHHHhc-CCHHHHHHHHHhchhhhhccCCCCCCHHHHHHHcCCHHHHHHHHHhCCCccccccCCCCcHHHHH
Q 042906          222 DWHQRNPLHYAAAS-GNVKMAQRLLEESKQLAYKRDCNGETPLHLAAENGKLKVLKLLINKYPDAIEIRDNSDRSILHVA  300 (415)
Q Consensus       222 ~~~~~t~l~~a~~~-~~~~~~~~Ll~~~~~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~t~l~~A  300 (415)
                      +..|.||||+|+.. +..++++.|++.|++++ .++..|.||||+|+..++.+++++|++.|++ ++..+..|.||||+|
T Consensus       338 d~~g~TpLh~A~~~~~~~~iv~lLl~~gadin-~~d~~G~TpLh~Aa~~~~~~iv~~Ll~~gad-~~~~~~~g~T~Lh~A  415 (682)
T PHA02876        338 DRLYITPLHQASTLDRNKDIVITLLELGANVN-ARDYCDKTPIHYAAVRNNVVIINTLLDYGAD-IEALSQKIGTALHFA  415 (682)
T ss_pred             ccCCCcHHHHHHHhCCcHHHHHHHHHcCCCCc-cCCCCCCCHHHHHHHcCCHHHHHHHHHCCCC-ccccCCCCCchHHHH
Confidence            44455555555443 23444444555444444 3444455555555555555555555555544 244444455555554


Q ss_pred             HhcCC-HHHHHHHhhCCCcccccccCCCCCCcHHHHHHhcC-ChHHHHHHhhccCcCccccccccccchhHHHHHH
Q 042906          301 AKHGN-WNIVSFILKSPEMENLINLVDRNGNTPLHLAAMGL-HSDVVFTLSRHKSVNIRAKNRSARNNIALEIAEI  374 (415)
Q Consensus       301 ~~~~~-~~~~~~Ll~~~~~~~~~~~~~~~g~t~l~~A~~~~-~~~~~~~Ll~~~g~~~~~~d~~g~~~t~l~~a~~  374 (415)
                      +..++ ..++++|++.|++   +|.+|..|+||||+|+..+ +.+++++|+++ |++++.+|..|  .|||++|+.
T Consensus       416 ~~~~~~~~~vk~Ll~~gad---in~~d~~G~TpLh~Aa~~~~~~~iv~lLl~~-Gad~n~~d~~g--~tpl~~a~~  485 (682)
T PHA02876        416 LCGTNPYMSVKTLIDRGAN---VNSKNKDLSTPLHYACKKNCKLDVIEMLLDN-GADVNAINIQN--QYPLLIALE  485 (682)
T ss_pred             HHcCCHHHHHHHHHhCCCC---CCcCCCCCChHHHHHHHhCCcHHHHHHHHHC-CCCCCCCCCCC--CCHHHHHHH
Confidence            44332 2344455554444   4455555555555555433 34455555543 45555555555  555555544



>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query415
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-21
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 9e-18
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-13
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-13
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-13
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-11
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 7e-13
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-12
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-12
2xee_A157 Structural Determinants For Improved Thermal Stabil 7e-11
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 3e-12
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 5e-12
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 3e-11
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 4e-11
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 4e-10
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 6e-11
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 2e-10
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 1e-10
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-10
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-04
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-10
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-08
1uoh_A226 Human Gankyrin Length = 226 6e-10
1uoh_A226 Human Gankyrin Length = 226 2e-07
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 6e-10
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-07
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 6e-10
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 3e-08
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-09
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-09
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-09
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-09
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-09
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-09
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-09
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-09
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 5e-09
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-07
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 6e-09
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 6e-09
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 8e-09
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-07
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-08
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 6e-08
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-08
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 4e-08
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 5e-05
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-07
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 3e-07
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-07
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 3e-07
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 4e-07
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 4e-07
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 4e-07
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 4e-07
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 4e-07
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 5e-07
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 8e-07
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 1e-06
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-06
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 4e-06
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 5e-04
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 4e-06
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 4e-06
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 1e-04
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 4e-06
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 2e-05
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 6e-04
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 2e-05
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 5e-04
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 2e-05
3utm_A 351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 3e-05
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 2e-05
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 2e-05
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 2e-05
3uxg_A172 Crystal Structure Of Rfxank Length = 172 3e-05
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 4e-05
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 5e-05
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 6e-05
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 1e-04
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-04
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 9e-05
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 1e-04
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 1e-04
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 2e-04
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 2e-04
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-04
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-04
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-04
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 2e-04
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 3e-04
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 4e-04
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 4e-04
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 7e-04
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 7e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure

Iteration: 1

Score = 76.6 bits (187), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 101/381 (26%), Positives = 175/381 (45%), Gaps = 43/381 (11%) Query: 10 RNGDENKIKQLALRQNIFSTSSPGGNTVLHMAVRFRNQQVIREILRQQNFIALRLHYSLL 69 R G N +K L + ++ G+T LH+A R + + + +L ++ A + Sbjct: 89 RIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQA------CM 142 Query: 70 RQKNLMDETPLHIAARIGNRAIVSEIVKYVPAVNQAGPLPVLESLFRMRDIEGNTPLHNA 129 +K TPLH+AA+ G + +++ N AG G TPLH A Sbjct: 143 TKKGF---TPLHVAAKYGKVRVAELLLERDAHPNAAGK-------------NGLTPLHVA 186 Query: 130 VTNQHKRVIRILVEKDSVPSSYINKAYQTPLSIAIDARLNDSACFIIDKSPESLNTTRLP 189 V + + ++++L+ + P S Y TPL IA + A ++ S N + Sbjct: 187 VHHNNLDIVKLLLPRGGSPHSPAWNGY-TPLHIAAKQNQVEVARSLLQYG-GSANAESV- 243 Query: 190 DELTLLHFVVMRQNYDIMVKILGTNKELIDRLDWHQRNPLHYAAASGNVKMAQRLLEESK 249 +T LH ++ + MV +L + + + + PLH A G+V +A L++ Sbjct: 244 QGVTPLHLAA-QEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGV 302 Query: 250 QL-AYKRDCNGETPLHLAAENGKLKVLKLLINKYPDAIEIRDNSDRSILHVAAKHGNWNI 308 + A R G TPLH+A+ G +K++K L+ D + + S LH AA+ G+ +I Sbjct: 303 MVDATTR--MGYTPLHVASHYGNIKLVKFLLQHQAD-VNAKTKLGYSPLHQAAQQGHTDI 359 Query: 309 VSFILK---SPEMENLINLVDRNGNTPLHLAA-MGLHS--DVVFTLSRHKS-VNIRAKNR 361 V+ +LK SP N V +G TPL +A +G S DV+ ++ S V + K+R Sbjct: 360 VTLLLKNGASP------NEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHR 413 Query: 362 SARNNIALEIAEITRADGKEI 382 + EI +++ +G+E+ Sbjct: 414 MSFPETVDEILDVSEDEGEEL 434
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query415
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-40
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-37
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-33
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-30
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-35
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-29
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-21
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-17
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-34
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-32
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-27
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-25
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-20
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-19
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-33
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-24
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-32
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-31
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-22
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-32
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-21
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-21
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-19
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-32
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-32
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-31
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-23
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-21
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-32
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-28
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-21
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-31
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-30
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-26
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-30
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-27
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-28
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-24
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-23
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-23
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-19
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-28
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-24
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-21
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-15
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-28
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-23
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-13
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-04
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-27
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-14
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-13
2pnn_A273 Transient receptor potential cation channel subfa 3e-27
2pnn_A273 Transient receptor potential cation channel subfa 6e-24
2pnn_A273 Transient receptor potential cation channel subfa 4e-22
2pnn_A273 Transient receptor potential cation channel subfa 7e-21
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-27
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-23
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-26
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-26
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-21
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-17
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-16
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-26
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-23
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-20
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-17
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-04
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-26
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-23
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-26
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-25
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-25
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-23
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-18
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-18
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-17
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-06
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-25
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-24
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-21
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-19
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-17
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-24
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-24
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-22
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-17
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-24
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-05
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-24
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-18
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-06
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-05
2etb_A256 Transient receptor potential cation channel subfam 9e-24
2etb_A256 Transient receptor potential cation channel subfam 3e-20
2etb_A256 Transient receptor potential cation channel subfam 3e-08
2rfa_A232 Transient receptor potential cation channel subfa 2e-23
2rfa_A232 Transient receptor potential cation channel subfa 1e-20
2rfa_A232 Transient receptor potential cation channel subfa 5e-20
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-23
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-21
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-14
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-23
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-18
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-16
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-14
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-23
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-16
1sw6_A327 Regulatory protein SWI6; transcription regulation, 9e-23
1sw6_A327 Regulatory protein SWI6; transcription regulation, 9e-16
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-22
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-21
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-15
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-14
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-04
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-22
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-20
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-18
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-22
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-21
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-18
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-04
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-22
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-21
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-21
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-20
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-19
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-16
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-21
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-20
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 9e-18
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 9e-16
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 9e-15
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-21
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-15
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-13
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-04
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-21
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-21
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-17
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-04
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-20
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-17
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-14
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-06
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-20
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-18
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-17
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-14
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-20
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-15
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-18
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-18
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-17
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-10
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-17
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-17
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-16
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-15
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-15
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-16
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-14
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-14
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-15
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-14
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-13
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-13
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 8e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-04
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-06
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 8e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-04
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  148 bits (377), Expect = 1e-40
 Identities = 90/367 (24%), Positives = 150/367 (40%), Gaps = 48/367 (13%)

Query: 34  GNTVLHMAVRFRNQQVIREILRQQNFIALRLHYSLLRQKNLMDETPLHIAARIGNRAIVS 93
             T LH A R  +  +++ +L          + +          TPLHIAAR G+   V 
Sbjct: 80  DQTPLHCAARIGHTNMVKLLLE---------NNANPNLATTAGHTPLHIAAREGHVETVL 130

Query: 94  EIVKYVPAVNQAGPLPVLESLFRMRDIEGNTPLHNAVTNQHKRVIRILVEKDSVPSSYIN 153
            +++   +                   +G TPLH A      RV  +L+E+D+ P++   
Sbjct: 131 ALLEKEASQA-------------CMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNA-AG 176

Query: 154 KAYQTPLSIAIDARLNDSACFIIDK--SPESLNTTRLPDELTLLHFVVMRQNYDIMVKIL 211
           K   TPL +A+     D    ++ +  SP S       +  T LH    +   ++  + L
Sbjct: 177 KNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAW----NGYTPLHIAAKQNQVEV-ARSL 231

Query: 212 ---GTNKELIDRLDWHQRNPLHYAAASGNVKMAQRLLEESKQLAYKRDCNGETPLHLAAE 268
              G +             PLH AA  G+ +M   LL +        + +G TPLHL A+
Sbjct: 232 LQYGGSANAESVQGV---TPLHLAAQEGHAEMVALLLSKQANGN-LGNKSGLTPLHLVAQ 287

Query: 269 NGKLKVLKLLINKYPDAIEIRDNSDRSILHVAAKHGNWNIVSFILKSPEMENLINLVDRN 328
            G + V  +LI      ++       + LHVA+ +GN  +V F+L+    +  +N   + 
Sbjct: 288 EGHVPVADVLIKHGVM-VDATTRMGYTPLHVASHYGNIKLVKFLLQH---QADVNAKTKL 343

Query: 329 GNTPLHLAAMGLHSDVVFTLSRHK-SVNIRAKNRSARNNIALEIAEITRADGKEIQKHLT 387
           G +PLH AA   H+D+V  L ++  S N  + +        L IA   R     +   L 
Sbjct: 344 GYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSD----GTTPLAIA--KRLGYISVTDVLK 397

Query: 388 LKALKTA 394
           +   +T+
Sbjct: 398 VVTDETS 404


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query415
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.98
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.98
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.97
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.94
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.94
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.91
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.91
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.91
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.9
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.89
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.89
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.89
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.88
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.87
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.87
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.87
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.86
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.82
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.76
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.76
3gvo_A351 Pumilio 2, pumilio homolog 2; RNA-binding, PUF dom 84.08
1gp8_A40 Protein (scaffolding protein); coat protein-bindin 80.19
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=8.1e-65  Score=462.80  Aligned_cols=370  Identities=26%  Similarity=0.331  Sum_probs=341.2

Q ss_pred             hHHHHHHHcCChhHHHHHHhhccccccCCCCCCCHHHHHHHhCCHHHHHHHHhccchHHHHHHhHhhhcCCCCCCChHHH
Q 042906            3 QELLEVLRNGDENKIKQLALRQNIFSTSSPGGNTVLHMAVRFRNQQVIREILRQQNFIALRLHYSLLRQKNLMDETPLHI   82 (415)
Q Consensus         3 ~~L~~A~~~g~~~~v~~ll~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~g~t~L~~   82 (415)
                      ++||.|+..|++++|++|++.|.+++..+..|.||||+|+..|+.+++++|++.         +++++.++..|.||||+
T Consensus        16 t~L~~Aa~~g~~~~v~~Ll~~g~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~---------g~~~~~~~~~g~t~L~~   86 (437)
T 1n11_A           16 TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQN---------KAKVNAKAKDDQTPLHC   86 (437)
T ss_dssp             CHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHH---------TCCSSCCCTTSCCHHHH
T ss_pred             CHHHHHHHCCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhC---------CCCCCCCCCCCCCHHHH
Confidence            589999999999999999999999999999999999999999999999999997         67788899999999999


Q ss_pred             HHHhCcHHHHHHHHhhccccccCCCcchhhhhhhcccCCCChHHHHHHHcCCHHHHHHHHhCCCCCcccccccCCcHHHH
Q 042906           83 AARIGNRAIVSEIVKYVPAVNQAGPLPVLESLFRMRDIEGNTPLHNAVTNQHKRVIRILVEKDSVPSSYINKAYQTPLSI  162 (415)
Q Consensus        83 A~~~g~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~g~t~l~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~~~~l~~  162 (415)
                      |+..|+.+++++|+++|++++             ..+..|.||||+|+..|+.+++++|++.+.+.. ..+..|.||||+
T Consensus        87 A~~~g~~~~v~~Ll~~ga~~~-------------~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~-~~~~~g~t~L~~  152 (437)
T 1n11_A           87 AARIGHTNMVKLLLENNANPN-------------LATTAGHTPLHIAAREGHVETVLALLEKEASQA-CMTKKGFTPLHV  152 (437)
T ss_dssp             HHHHTCHHHHHHHHHHTCCTT-------------CCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSC-CCCTTSCCHHHH
T ss_pred             HHHCCCHHHHHHHHhCCCCCC-------------CCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCc-CCCCCCCCHHHH
Confidence            999999999999999999877             567889999999999999999999999998775 567889999999


Q ss_pred             HHHcCChhHHHHHhhhCCCCccCCCCCcchhHHHHHHHcCCHHHHHHHHhcChhhhcccccCCCCHHHHHHhcCCHHHHH
Q 042906          163 AIDARLNDSACFIIDKSPESLNTTRLPDELTLLHFVVMRQNYDIMVKILGTNKELIDRLDWHQRNPLHYAAASGNVKMAQ  242 (415)
Q Consensus       163 a~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~  242 (415)
                      |+..|+.+++++|++.+.+....  +..|.|||+.|+..++.+++++|+..+.. ++..+..|.||||+|+..++.++++
T Consensus       153 A~~~g~~~~v~~Ll~~g~~~~~~--~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~-~~~~~~~g~t~L~~A~~~~~~~~~~  229 (437)
T 1n11_A          153 AAKYGKVRVAELLLERDAHPNAA--GKNGLTPLHVAVHHNNLDIVKLLLPRGGS-PHSPAWNGYTPLHIAAKQNQVEVAR  229 (437)
T ss_dssp             HHHTTCHHHHHHHHHTTCCTTCC--CSSCCCHHHHHHHTTCHHHHHHHGGGTCC-SCCCCTTCCCHHHHHHHTTCHHHHH
T ss_pred             HHHcCCHHHHHHHHhCCCCCCCC--CCCCCCHHHHHHHcCCHHHHHHHHhCCCC-CCCcCCCCCCHHHHHHHcCCHHHHH
Confidence            99999999999999987765443  36788999999999999999999998876 6777888999999999999999999


Q ss_pred             HHHHhchhhhhccCCCCCCHHHHHHHcCCHHHHHHHHHhCCCccccccCCCCcHHHHHHhcCCHHHHHHHhhCCCccccc
Q 042906          243 RLLEESKQLAYKRDCNGETPLHLAAENGKLKVLKLLINKYPDAIEIRDNSDRSILHVAAKHGNWNIVSFILKSPEMENLI  322 (415)
Q Consensus       243 ~Ll~~~~~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~t~l~~A~~~~~~~~~~~Ll~~~~~~~~~  322 (415)
                      +|++.|.+.+ ..+..|.||||+|+..++.+++++|++++++ ++..+..|.||||+|+..++.+++++|+++|.+   +
T Consensus       230 ~Ll~~g~~~~-~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~-~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~---~  304 (437)
T 1n11_A          230 SLLQYGGSAN-AESVQGVTPLHLAAQEGHAEMVALLLSKQAN-GNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVM---V  304 (437)
T ss_dssp             HHHHTTCCTT-CCCTTCCCHHHHHHHTTCHHHHHHHHTTTCC-TTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCC---T
T ss_pred             HHHHcCCCCC-CCCCCCCCHHHHHHHCCCHHHHHHHHhcCCC-CCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCcc---C
Confidence            9999999887 5788999999999999999999999999998 599999999999999999999999999999887   8


Q ss_pred             ccCCCCCCcHHHHHHhcCChHHHHHHhhccCcCccccccccccchhHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHhhcH
Q 042906          323 NLVDRNGNTPLHLAAMGLHSDVVFTLSRHKSVNIRAKNRSARNNIALEIAEITRADGKEIQKHLTLKALKTAYAKRALSA  402 (415)
Q Consensus       323 ~~~~~~g~t~l~~A~~~~~~~~~~~Ll~~~g~~~~~~d~~g~~~t~l~~a~~~~~~~~~~~~~~~~~~L~~~Ga~~~~~~  402 (415)
                      +.++..|+||||+|+..|+.+++++|+++ |++++.+|..|  +||||+|++       .++.+++++|+++||+++..+
T Consensus       305 ~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~-gad~n~~~~~g--~t~L~~A~~-------~g~~~iv~~Ll~~ga~~~~~~  374 (437)
T 1n11_A          305 DATTRMGYTPLHVASHYGNIKLVKFLLQH-QADVNAKTKLG--YSPLHQAAQ-------QGHTDIVTLLLKNGASPNEVS  374 (437)
T ss_dssp             TCCCSSCCCHHHHHHHSSCSHHHHHHHHT-TCCTTCCCTTS--CCHHHHHHH-------TTCHHHHHHHHHTTCCSCCCC
T ss_pred             CCCCCCCCCHHHHHHHcCcHHHHHHHHhc-CCCCCCCCCCC--CCHHHHHHH-------CChHHHHHHHHHCcCCCCCCC
Confidence            99999999999999999999999999986 99999999999  999999999       578899999999999998888


Q ss_pred             HHHHHHHhhhh
Q 042906          403 EELQQKRQVSK  413 (415)
Q Consensus       403 ~~~~~~~~~~~  413 (415)
                      ..+.++.++++
T Consensus       375 ~~g~t~l~~A~  385 (437)
T 1n11_A          375 SDGTTPLAIAK  385 (437)
T ss_dssp             SSSCCHHHHHH
T ss_pred             CCCCCHHHHHH
Confidence            77777776654



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3gvo_A Pumilio 2, pumilio homolog 2; RNA-binding, PUF domain, RNA binding protein; HET: DTD; 1.60A {Mus musculus} SCOP: a.118.1.8 PDB: 3gvt_A 3q0q_A 3q0r_A 3q0s_A 1ib2_A 1m8w_A 1m8x_A 1m8y_A 1m8z_A 3q0l_A 3q0m_A 3q0n_A 3q0o_A 3q0p_A 2yjy_A 3bsx_A 3bsb_A 3h3d_X Back     alignment and structure
>1gp8_A Protein (scaffolding protein); coat protein-binding domain, helix- loop-helix motif, viral protein; NMR {Enterobacteria phage P22} SCOP: j.58.1.1 PDB: 2gp8_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 415
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-28
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-27
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-24
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-19
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-17
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-24
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-20
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-15
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-21
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-19
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-16
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.003
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-21
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-13
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-12
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-11
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-19
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-17
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-15
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-12
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-18
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-12
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-17
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-17
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.002
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-16
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-15
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-11
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-15
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-11
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-10
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-12
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-09
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-09
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 7e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 4e-09
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 6e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 8e-09
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.001
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 8e-09
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 9e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.001
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 1e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  113 bits (283), Expect = 2e-28
 Identities = 92/383 (24%), Positives = 155/383 (40%), Gaps = 41/383 (10%)

Query: 10  RNGDENKIKQLALRQNIFSTSSPGGNTVLHMAVRFRNQQVIREILRQQNFIALRLHYSLL 69
             G    +K L  R    + S+    T LHMA R  + +V + +L+         + + +
Sbjct: 9   FMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQ---------NKAKV 59

Query: 70  RQKNLMDETPLHIAARIGNRAIVSEIVKYVPAVNQAGPLPV------------------- 110
             K   D+TPLH AARIG+  +V  +++     N A                        
Sbjct: 60  NAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALL 119

Query: 111 -LESLFRMRDIEGNTPLHNAVTNQHKRVIRILVEKDSVPSSYINKAYQTPLSIAIDARLN 169
             E+       +G TPLH A      RV  +L+E+D+ P++   K   TPL +A+     
Sbjct: 120 EKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNA-AGKNGLTPLHVAVHHNNL 178

Query: 170 DSACFIIDKSPESLNTTRLPDELTLLHFVVMRQNYDIMVKILGTNKELIDRLDWHQRNPL 229
           D    ++ +       +   +  T LH    +   ++   +L       +        PL
Sbjct: 179 DIVKLLLPRGGSP--HSPAWNGYTPLHIAAKQNQVEVARSLLQYGGS-ANAESVQGVTPL 235

Query: 230 HYAAASGNVKMAQRLLEESKQLAYKRDCNGETPLHLAAENGKLKVLKLLINKYPDAIEIR 289
           H AA  G+ +M   LL +        + +G TPLHL A+ G + V  +LI      ++  
Sbjct: 236 HLAAQEGHAEMVALLLSKQANG-NLGNKSGLTPLHLVAQEGHVPVADVLIKHGVM-VDAT 293

Query: 290 DNSDRSILHVAAKHGNWNIVSFILKSPEMENLINLVDRNGNTPLHLAAMGLHSDVVFTLS 349
                + LHVA+ +GN  +V F+    + +  +N   + G +PLH AA   H+D+V  L 
Sbjct: 294 TRMGYTPLHVASHYGNIKLVKFL---LQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLL 350

Query: 350 RHKSVNIRAKNRSARNNIALEIA 372
           ++   +    +        L IA
Sbjct: 351 KNG-ASPNEVSSDGTT--PLAIA 370


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query415
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.96
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.95
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.92
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.92
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.89
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.6e-54  Score=388.44  Aligned_cols=363  Identities=26%  Similarity=0.310  Sum_probs=325.1

Q ss_pred             hHHHHHHHcCChhHHHHHHhhccccccCCCCCCCHHHHHHHhCCHHHHHHHHhccchHHHHHHhHhhhcCCCCCCChHHH
Q 042906            3 QELLEVLRNGDENKIKQLALRQNIFSTSSPGGNTVLHMAVRFRNQQVIREILRQQNFIALRLHYSLLRQKNLMDETPLHI   82 (415)
Q Consensus         3 ~~L~~A~~~g~~~~v~~ll~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~g~t~L~~   82 (415)
                      ++||.|+..|++++|++|++.|++++..|..|+||||+|+..|+.+++++|+++         |++++.++..|+||||+
T Consensus         2 TpL~~Aa~~g~~~~v~~Ll~~g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~---------gadi~~~~~~g~t~L~~   72 (408)
T d1n11a_           2 TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQN---------KAKVNAKAKDDQTPLHC   72 (408)
T ss_dssp             CHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHH---------TCCSSCCCTTSCCHHHH
T ss_pred             ChHHHHHHCcCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHC---------cCCCCCCCCCCCCHHHH
Confidence            589999999999999999999999999999999999999999999999999997         57788999999999999


Q ss_pred             HHHhCcHHHHHHHHhhccccccCCCcch--------------------hhhhhhcccCCCChHHHHHHHcCCHHHHHHHH
Q 042906           83 AARIGNRAIVSEIVKYVPAVNQAGPLPV--------------------LESLFRMRDIEGNTPLHNAVTNQHKRVIRILV  142 (415)
Q Consensus        83 A~~~g~~~~v~~Ll~~~~~~~~~~~~~~--------------------~~~~~~~~~~~g~t~l~~A~~~~~~~~v~~Ll  142 (415)
                      |+..|+.+++++|+..+++.........                    ........+..+.++++.|+..++.+++++|+
T Consensus        73 A~~~g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll  152 (408)
T d1n11a_          73 AARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLL  152 (408)
T ss_dssp             HHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHH
T ss_pred             HHHcCCHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHH
Confidence            9999999999999998876553222111                    01123446778999999999999999999999


Q ss_pred             hCCCCCcccccccCCcHHHHHHHcCChhHHHHHhhhCCCCccCCCCCcchhHHHHHHHcCCHHHHHHHHhcChhhhcccc
Q 042906          143 EKDSVPSSYINKAYQTPLSIAIDARLNDSACFIIDKSPESLNTTRLPDELTLLHFVVMRQNYDIMVKILGTNKELIDRLD  222 (415)
Q Consensus       143 ~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~ll~~~~~~~~~~~  222 (415)
                      +.+.++. ..+..+.+||++|+..++.+++++|+..+.+....  +..+.+|++.+......+....++..... ....+
T Consensus       153 ~~~~~~~-~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~--~~~~~t~l~~~~~~~~~~~~~~l~~~~~~-~~~~~  228 (408)
T d1n11a_         153 ERDAHPN-AAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSP--AWNGYTPLHIAAKQNQVEVARSLLQYGGS-ANAES  228 (408)
T ss_dssp             HTTCCTT-CCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCC--CTTCCCHHHHHHHTTCHHHHHHHHHTTCC-TTCCC
T ss_pred             HcCCCCC-cCCCcCchHHHHHHHcCCHHHHHHHHhcCCccccc--CCCCCCcchhhhccchhhhhhhhhhcccc-ccccC
Confidence            9999876 67888999999999999999999999988765443  36788999999999999999999887765 55667


Q ss_pred             cCCCCHHHHHHhcCCHHHHHHHHHhchhhhhccCCCCCCHHHHHHHcCCHHHHHHHHHhCCCccccccCCCCcHHHHHHh
Q 042906          223 WHQRNPLHYAAASGNVKMAQRLLEESKQLAYKRDCNGETPLHLAAENGKLKVLKLLINKYPDAIEIRDNSDRSILHVAAK  302 (415)
Q Consensus       223 ~~~~t~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~t~l~~A~~  302 (415)
                      ..+.||++.|+..+..+++++++..+.... ..+..|.||++.|+..++.+++++|+++|++ ++..+..+.||||.++.
T Consensus       229 ~~~~t~l~~a~~~~~~~~~~~~~~~~~~~~-~~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~-~~~~~~~~~t~L~~~~~  306 (408)
T d1n11a_         229 VQGVTPLHLAAQEGHAEMVALLLSKQANGN-LGNKSGLTPLHLVAQEGHVPVADVLIKHGVM-VDATTRMGYTPLHVASH  306 (408)
T ss_dssp             TTCCCHHHHHHHTTCHHHHHHHHTTTCCTT-CCCTTCCCHHHHHHHHTCHHHHHHHHHHTCC-TTCCCSSCCCHHHHHHH
T ss_pred             CCCCCHHHHHHHhCcHhHhhhhhccccccc-cccCCCCChhhhhhhcCcHHHHHHHHHCCCc-cccccccccccchhhcc
Confidence            788999999999999999999999988776 5788999999999999999999999999999 59999999999999999


Q ss_pred             cCCHHHHHHHhhCCCcccccccCCCCCCcHHHHHHhcCChHHHHHHhhccCcCccccccccccchhHHHHHHhhhhhHHH
Q 042906          303 HGNWNIVSFILKSPEMENLINLVDRNGNTPLHLAAMGLHSDVVFTLSRHKSVNIRAKNRSARNNIALEIAEITRADGKEI  382 (415)
Q Consensus       303 ~~~~~~~~~Ll~~~~~~~~~~~~~~~g~t~l~~A~~~~~~~~~~~Ll~~~g~~~~~~d~~g~~~t~l~~a~~~~~~~~~~  382 (415)
                      .++.++++++++.|++   ++.+|..|+||||+|++.|+.+++++|+++ |+|++++|.+|  +||||+|++       .
T Consensus       307 ~~~~~~~~~ll~~g~~---in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~-GAd~n~~d~~G--~t~L~~A~~-------~  373 (408)
T d1n11a_         307 YGNIKLVKFLLQHQAD---VNAKTKLGYSPLHQAAQQGHTDIVTLLLKN-GASPNEVSSDG--TTPLAIAKR-------L  373 (408)
T ss_dssp             SSCSHHHHHHHHTTCC---TTCCCTTSCCHHHHHHHTTCHHHHHHHHHT-TCCSCCCCSSS--CCHHHHHHH-------T
T ss_pred             cCcceeeeeecccccc---ccccCCCCCCHHHHHHHcCCHHHHHHHHHC-CCCCCCCCCCC--CCHHHHHHH-------c
Confidence            9999999999999987   999999999999999999999999999986 99999999999  999999999       4


Q ss_pred             HHHHHHHHHHH
Q 042906          383 QKHLTLKALKT  393 (415)
Q Consensus       383 ~~~~~~~~L~~  393 (415)
                      ++.++|++|..
T Consensus       374 ~~~~iv~~L~~  384 (408)
T d1n11a_         374 GYISVTDVLKV  384 (408)
T ss_dssp             TCHHHHHHHHH
T ss_pred             CCHHHHHHHHH
Confidence            66677776643



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure