Citrus Sinensis ID: 042931
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 471 | 2.2.26 [Sep-21-2011] | |||||||
| Q8VZG8 | 1045 | Probable LRR receptor-lik | yes | no | 0.743 | 0.334 | 0.352 | 8e-57 | |
| Q9LP24 | 1120 | Probable leucine-rich rep | no | no | 0.730 | 0.307 | 0.345 | 2e-54 | |
| Q9SHI2 | 1101 | Leucine-rich repeat recep | no | no | 0.753 | 0.322 | 0.335 | 1e-44 | |
| C0LGX3 | 993 | LRR receptor-like serine/ | no | no | 0.662 | 0.314 | 0.348 | 1e-40 | |
| Q9FZ59 | 1088 | Leucine-rich repeat recep | no | no | 0.711 | 0.307 | 0.315 | 1e-40 | |
| C0LGQ5 | 1249 | LRR receptor-like serine/ | no | no | 0.711 | 0.268 | 0.328 | 1e-38 | |
| O49318 | 1124 | Probable leucine-rich rep | no | no | 0.902 | 0.378 | 0.278 | 1e-38 | |
| C0LGF4 | 591 | LRR receptor-like serine/ | no | no | 0.626 | 0.499 | 0.330 | 1e-37 | |
| C0LGW6 | 966 | LRR receptor-like serine/ | no | no | 0.717 | 0.349 | 0.318 | 2e-37 | |
| P93194 | 1109 | Receptor-like protein kin | N/A | no | 0.692 | 0.293 | 0.307 | 3e-37 |
| >sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 | Back alignment and function desciption |
|---|
Score = 221 bits (564), Expect = 8e-57, Method: Compositional matrix adjust.
Identities = 139/394 (35%), Positives = 214/394 (54%), Gaps = 44/394 (11%)
Query: 108 LHLSRDYGSFEEPVQLSQLNFSCFPNLENLTFQSFPLAGSIPPEISALSKLQRLDLSSNR 167
L LS + + E P +S +N + L L+G IP I L+ L+ LDLSSNR
Sbjct: 507 LDLSSNRITGELPESISNIN-----RISKLQLNGNRLSGKIPSGIRLLTNLEYLDLSSNR 561
Query: 168 LTGSIPSEIGNLRNLVYLNISKNILTGTVPSTLGSLTNLKNMGLSYNQLSGPLPQEIGNL 227
+ IP + NL L Y+N+S+N L T+P L L+ L+ + LSYNQL G + + +L
Sbjct: 562 FSSEIPPTLNNLPRLYYMNLSRNDLDQTIPEGLTKLSQLQMLDLSYNQLDGEISSQFRSL 621
Query: 228 KNLMELDLGTNSLIGPIPSTLGRLTNLNYMSLSRNMFGGLLPQEIGNLKNLIELNVGSNS 287
+NL LDL N+L G IP + + L ++ +S N G +P + G+
Sbjct: 622 QNLERLDLSHNNLSGQIPPSFKDMLALTHVDVSHNNLQGPIPDNAAFRNAPPDAFEGNKD 681
Query: 288 LIGPIPSTLGLLTDLSYLDLSCNQFSSSIPN-DTTKLLY--------------------- 325
L G + +T GL C+ SS + D ++Y
Sbjct: 682 LCGSVNTTQGLK--------PCSITSSKKSHKDRNLIIYILVPIIGAIIILSVCAGIFIC 733
Query: 326 --KKPELKERATNSI---DVFSVWNYDGRIVYEDLIRATEDFDIRYCIGTGGYGSVYKAQ 380
K+ + E T+S + S++++DG++ Y+++I+AT +FD +Y IGTGG+G VYKA+
Sbjct: 734 FRKRTKQIEEHTDSESGGETLSIFSFDGKVRYQEIIKATGEFDPKYLIGTGGHGKVYKAK 793
Query: 381 LPNGKVFALKKLHTSETEELA---FIKSFRNEAQVLSQVLHRNIVKLYGFCLHRKCMFLI 437
LPN + A+KKL+ + ++ + F NE + L+++ HRN+VKL+GFC HR+ FL+
Sbjct: 794 LPNA-IMAVKKLNETTDSSISNPSTKQEFLNEIRALTEIRHRNVVKLFGFCSHRRNTFLV 852
Query: 438 YEYMEGGSLFCNLHNNEEAVELDWAKRVNIVKAM 471
YEYME GSL L N++EA +LDW KR+N+VK +
Sbjct: 853 YEYMERGSLRKVLENDDEAKKLDWGKRINVVKGV 886
|
Arabidopsis thaliana (taxid: 3702) EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1 |
| >sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|C0LGF4|FEI1_ARATH LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana GN=FEI1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 471 | ||||||
| 296085298 | 610 | unnamed protein product [Vitis vinifera] | 0.806 | 0.622 | 0.482 | 3e-99 | |
| 225452749 | 783 | PREDICTED: probable LRR receptor-like se | 0.898 | 0.540 | 0.369 | 2e-90 | |
| 147852997 | 661 | hypothetical protein VITISV_031965 [Viti | 0.717 | 0.511 | 0.473 | 2e-90 | |
| 225465647 | 820 | PREDICTED: probable LRR receptor-like se | 0.719 | 0.413 | 0.469 | 1e-89 | |
| 359488983 | 758 | PREDICTED: probable LRR receptor-like se | 0.836 | 0.519 | 0.372 | 3e-89 | |
| 225466223 | 736 | PREDICTED: probable leucine-rich repeat | 0.834 | 0.533 | 0.381 | 1e-87 | |
| 255563458 | 528 | serine-threonine protein kinase, plant-t | 0.845 | 0.753 | 0.406 | 2e-86 | |
| 357501761 | 762 | ATP binding/protein serine/threonine kin | 0.857 | 0.530 | 0.361 | 8e-84 | |
| 147834736 | 622 | hypothetical protein VITISV_033634 [Viti | 0.855 | 0.647 | 0.386 | 1e-83 | |
| 225452698 | 727 | PREDICTED: probable LRR receptor-like se | 0.855 | 0.554 | 0.386 | 1e-83 |
| >gi|296085298|emb|CBI29030.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 368 bits (945), Expect = 3e-99, Method: Compositional matrix adjust.
Identities = 209/433 (48%), Positives = 275/433 (63%), Gaps = 53/433 (12%)
Query: 86 NYSSDHCKWIGFTCNSAGSIIGLHLSRDYGSFEEPVQLSQLNFSCFPNLENLTFQSFPLA 145
N +S HC W G TCN+ G ++ + S G V+LS+L FS FP+L +L +
Sbjct: 3 NTTSHHCTWEGITCNTEGHVVRITYSYIDGKM---VELSKLKFSSFPSLLHLYVSHSSIY 59
Query: 146 GSIPPEISALSKL------------------------QRLDLSSNRLTGSIPSEIGNLRN 181
G IP EI L+KL + LDL+ N L+G IPS +G L+N
Sbjct: 60 GRIPDEIGMLTKLTYLRISECDVYGELPVSLGNLTLLEELDLAYNNLSGVIPSSLGYLKN 119
Query: 182 LVYLNISKNI-LTGTVPSTLGSLTNLKNMGLSYNQLSGPLPQEIGNLKNLMELDLGTNSL 240
L++L++S N L+G +P +LG L NLK + LS N+++G +P +IGNLKNL L L +NSL
Sbjct: 120 LIHLDLSFNYGLSGVIPPSLGYLKNLKYLDLSINEINGSIPSQIGNLKNLTHLYLVSNSL 179
Query: 241 IGPIPSTLGRLTNLNYMSLSRNMFGGLLPQEIGNLKNLIEL-NVGSNSLIGPIPSTLGLL 299
G IPS L L+NL Y+ L+ N G +P EIGNLKNL++L ++ N + G IPS + L
Sbjct: 180 SGVIPSPLANLSNLEYLFLNFNRINGSIPSEIGNLKNLVQLLDLSDNLIHGKIPSQVQNL 239
Query: 300 TDLSYLDLSCNQFSSSIPNDTTKLLYK--KP---------------ELKER-ATNSID-- 339
L YL+LS N+ S SIP T L+Y +P EL+ + + S D
Sbjct: 240 KRLVYLNLSHNKLSGSIP---TLLIYDHIRPSLDLSYNDLEGHIPFELQSKFSQGSFDNN 296
Query: 340 -VFSVWNYDGRIVYEDLIRATEDFDIRYCIGTGGYGSVYKAQLPNGKVFALKKLHTSETE 398
VWNYDG+I YED+I+ATEDFDI+YCIGTGGYGSVYKAQLP G V ALKKLH ET+
Sbjct: 297 KGLCVWNYDGKIAYEDIIKATEDFDIKYCIGTGGYGSVYKAQLPTGNVVALKKLHGWETD 356
Query: 399 ELAFIKSFRNEAQVLSQVLHRNIVKLYGFCLHRKCMFLIYEYMEGGSLFCNLHNNEEAVE 458
E ++KSF+NE Q+LS++ HRNIVKL G+CLH++CMFLIY YM GSL+C L N EA+E
Sbjct: 357 EATYLKSFQNEVQILSKIRHRNIVKLQGYCLHKRCMFLIYNYMGRGSLYCVLSNEVEALE 416
Query: 459 LDWAKRVNIVKAM 471
LDW KRVN+VK++
Sbjct: 417 LDWIKRVNVVKSI 429
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225452749|ref|XP_002277477.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147852997|emb|CAN79070.1| hypothetical protein VITISV_031965 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225465647|ref|XP_002270862.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359488983|ref|XP_002277433.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225466223|ref|XP_002267065.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710 [Vitis vinifera] gi|147859823|emb|CAN79273.1| hypothetical protein VITISV_014885 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255563458|ref|XP_002522731.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223537969|gb|EEF39582.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357501761|ref|XP_003621169.1| ATP binding/protein serine/threonine kinase [Medicago truncatula] gi|355496184|gb|AES77387.1| ATP binding/protein serine/threonine kinase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|147834736|emb|CAN59750.1| hypothetical protein VITISV_033634 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225452698|ref|XP_002276923.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 471 | ||||||
| TAIR|locus:2138268 | 1045 | AT4G08850 [Arabidopsis thalian | 0.573 | 0.258 | 0.355 | 2.1e-68 | |
| TAIR|locus:2011339 | 1120 | AT1G35710 [Arabidopsis thalian | 0.592 | 0.249 | 0.349 | 1.8e-67 | |
| TAIR|locus:2156349 | 1252 | GSO2 "GASSHO 2" [Arabidopsis t | 0.496 | 0.186 | 0.376 | 2.7e-50 | |
| TAIR|locus:2005507 | 976 | ER "ERECTA" [Arabidopsis thali | 0.447 | 0.216 | 0.356 | 4e-50 | |
| TAIR|locus:2182870 | 1192 | EMS1 "EXCESS MICROSPOROCYTES1" | 0.522 | 0.206 | 0.363 | 2.2e-49 | |
| UNIPROTKB|P93194 | 1109 | INRPK1 "Receptor-like protein | 0.522 | 0.221 | 0.348 | 9e-49 | |
| TAIR|locus:2020417 | 1101 | AT1G17230 [Arabidopsis thalian | 0.490 | 0.209 | 0.365 | 9e-48 | |
| TAIR|locus:2160791 | 1102 | AT5G63930 [Arabidopsis thalian | 0.409 | 0.175 | 0.362 | 1.3e-47 | |
| UNIPROTKB|Q8RZV7 | 1294 | P0413C03.22 "Putative extra sp | 0.452 | 0.164 | 0.364 | 1.9e-47 | |
| TAIR|locus:2042599 | 915 | AT2G16250 [Arabidopsis thalian | 0.575 | 0.296 | 0.360 | 3.4e-46 |
| TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 381 (139.2 bits), Expect = 2.1e-68, Sum P(2) = 2.1e-68
Identities = 101/284 (35%), Positives = 142/284 (50%)
Query: 38 LVWVVIFTCDNVAARTGTFVTASALSPLQLEAKALLNTGWWDSSFWTANYSSDHC-KWIG 96
L+ ++ +C A + T A+AL L+ ++ T S W +S C W G
Sbjct: 32 LIISIVLSCS--FAVSATVEEANAL--LKWKSTFTNQTSSSKLSSWVNPNTSSFCTSWYG 87
Query: 97 FTCNSAGSIIGLHLSRD--YGSFEEPVQLSQLNFSCFPNLENLTFQSFPLAGSIPPEISA 154
C S GSII L+L+ G+FE+ FS PNL + +G+I P
Sbjct: 88 VAC-SLGSIIRLNLTNTGIEGTFED------FPFSSLPNLTFVDLSMNRFSGTISPLWGR 140
Query: 155 LSKLQRLDLSSNRLTGSIPSEIGNLRNLVYLNISKNILTGTVPSTLGSLTNLKNMGLSYN 214
SKL+ DLS N+L G IP E+G+L NL L++ +N L G++PS +G LT + + + N
Sbjct: 141 FSKLEYFDLSINQLVGEIPPELGDLSNLDTLHLVENKLNGSIPSEIGRLTKVTEIAIYDN 200
Query: 215 QLSGPLPQEIGNLKNLMELDLGTNSLIGPIPSTLGRLTNLNYMSLSRNMFGGLLPQEIGN 274
L+GP+P GNL L+ L L NSL G IPS +G L NL + L RN G +P GN
Sbjct: 201 LLTGPIPSSFGNLTKLVNLYLFINSLSGSIPSEIGNLPNLRELCLDRNNLTGKIPSSFGN 260
Query: 275 LKNLIELNVGSNSLIGPIPXXXXXXXXXXXXXXXCNQFSSSIPN 318
LKN+ LN+ N L G IP N+ + IP+
Sbjct: 261 LKNVTLLNMFENQLSGEIPPEIGNMTALDTLSLHTNKLTGPIPS 304
|
|
| TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2005507 ER "ERECTA" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2182870 EMS1 "EXCESS MICROSPOROCYTES1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P93194 INRPK1 "Receptor-like protein kinase" [Ipomoea nil (taxid:35883)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2020417 AT1G17230 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8RZV7 P0413C03.22 "Putative extra sporogenous cells" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2042599 AT2G16250 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00020917001 | SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (665 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 471 | |||
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 6e-45 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-35 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-34 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-32 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 9e-31 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-29 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 3e-28 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 5e-28 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 5e-24 | |
| smart00220 | 254 | smart00220, S_TKc, Serine/Threonine protein kinase | 3e-20 | |
| cd00180 | 215 | cd00180, PKc, Catalytic domain of Protein Kinases | 3e-19 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 6e-18 | |
| smart00219 | 257 | smart00219, TyrKc, Tyrosine kinase, catalytic doma | 6e-17 | |
| smart00221 | 258 | smart00221, STYKc, Protein kinase; unclassified sp | 8e-17 | |
| pfam00069 | 260 | pfam00069, Pkinase, Protein kinase domain | 2e-16 | |
| pfam07714 | 258 | pfam07714, Pkinase_Tyr, Protein tyrosine kinase | 5e-16 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 6e-16 | |
| cd05122 | 253 | cd05122, PKc_STE, Catalytic domain of STE family P | 7e-16 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 1e-15 | |
| cd00192 | 262 | cd00192, PTKc, Catalytic domain of Protein Tyrosin | 5e-15 | |
| cd06606 | 260 | cd06606, STKc_MAPKKK, Catalytic domain of the Prot | 2e-14 | |
| cd06623 | 264 | cd06623, PKc_MAPKK_plant_like, Catalytic domain of | 1e-13 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 3e-13 | |
| COG0515 | 384 | COG0515, SPS1, Serine/threonine protein kinase [Ge | 4e-12 | |
| cd06613 | 262 | cd06613, STKc_MAP4K3_like, Catalytic domain of Mit | 4e-12 | |
| cd08215 | 258 | cd08215, STKc_Nek, Catalytic domain of the Protein | 4e-12 | |
| cd06626 | 264 | cd06626, STKc_MEKK4, Catalytic domain of the Prote | 4e-12 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 9e-12 | |
| cd07842 | 316 | cd07842, STKc_CDK8_like, Catalytic domain of Cycli | 2e-11 | |
| cd05123 | 250 | cd05123, STKc_AGC, Catalytic domain of AGC family | 2e-11 | |
| cd05580 | 290 | cd05580, STKc_PKA, Catalytic domain of the Protein | 3e-11 | |
| cd08217 | 265 | cd08217, STKc_Nek2, Catalytic domain of the Protei | 3e-11 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 1e-10 | |
| cd05049 | 280 | cd05049, PTKc_Trk, Catalytic domain of the Protein | 1e-10 | |
| cd06627 | 254 | cd06627, STKc_Cdc7_like, Catalytic domain of Cell | 1e-10 | |
| cd07829 | 282 | cd07829, STKc_CDK_like, Catalytic domain of Cyclin | 1e-10 | |
| cd06612 | 256 | cd06612, STKc_MST1_2, Catalytic domain of the Prot | 1e-10 | |
| cd05041 | 251 | cd05041, PTKc_Fes_like, Catalytic domain of Fes-li | 2e-10 | |
| cd05039 | 256 | cd05039, PTKc_Csk_like, Catalytic domain of C-term | 2e-10 | |
| cd06610 | 267 | cd06610, STKc_OSR1_SPAK, Catalytic domain of the P | 4e-10 | |
| cd06614 | 286 | cd06614, STKc_PAK, Catalytic domain of the Protein | 7e-10 | |
| cd05612 | 291 | cd05612, STKc_PRKX_like, Catalytic domain of PRKX- | 9e-10 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 1e-09 | |
| cd05059 | 256 | cd05059, PTKc_Tec_like, Catalytic domain of Tec-li | 2e-09 | |
| cd06605 | 265 | cd06605, PKc_MAPKK, Catalytic domain of the dual-s | 2e-09 | |
| cd07840 | 287 | cd07840, STKc_CDK9_like, Catalytic domain of Cycli | 2e-09 | |
| cd05579 | 265 | cd05579, STKc_MAST_like, Catalytic domain of Micro | 4e-09 | |
| cd05033 | 266 | cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec | 9e-09 | |
| cd05578 | 258 | cd05578, STKc_Yank1, Catalytic domain of the Prote | 1e-08 | |
| cd05057 | 279 | cd05057, PTKc_EGFR_like, Catalytic domain of Epide | 1e-08 | |
| cd05112 | 256 | cd05112, PTKc_Itk, Catalytic domain of the Protein | 2e-08 | |
| cd07838 | 287 | cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc | 2e-08 | |
| cd05060 | 257 | cd05060, PTKc_Syk_like, Catalytic domain of Spleen | 2e-08 | |
| cd06609 | 274 | cd06609, STKc_MST3_like, Catalytic domain of Mamma | 2e-08 | |
| cd05085 | 250 | cd05085, PTKc_Fer, Catalytic domain of the Protein | 3e-08 | |
| cd05048 | 283 | cd05048, PTKc_Ror, Catalytic Domain of the Protein | 4e-08 | |
| cd07832 | 286 | cd07832, STKc_CCRK, Catalytic domain of the Serine | 5e-08 | |
| cd08529 | 256 | cd08529, STKc_FA2-like, Catalytic domain of the Pr | 5e-08 | |
| cd05081 | 284 | cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) | 5e-08 | |
| cd05040 | 257 | cd05040, PTKc_Ack_like, Catalytic domain of the Pr | 8e-08 | |
| cd05051 | 296 | cd05051, PTKc_DDR, Catalytic domain of the Protein | 1e-07 | |
| cd07833 | 288 | cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep | 1e-07 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 2e-07 | |
| cd06611 | 280 | cd06611, STKc_SLK_like, Catalytic domain of Ste20- | 2e-07 | |
| cd05050 | 288 | cd05050, PTKc_Musk, Catalytic domain of the Protei | 2e-07 | |
| cd06917 | 277 | cd06917, STKc_NAK1_like, Catalytic domain of Funga | 2e-07 | |
| cd07830 | 283 | cd07830, STKc_MAK_like, Catalytic domain of Male g | 2e-07 | |
| cd06621 | 287 | cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of | 2e-07 | |
| cd05038 | 284 | cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai | 2e-07 | |
| cd05063 | 268 | cd05063, PTKc_EphR_A2, Catalytic domain of the Pro | 2e-07 | |
| cd05044 | 269 | cd05044, PTKc_c-ros, Catalytic domain of the Prote | 4e-07 | |
| cd05118 | 283 | cd05118, STKc_CMGC, Catalytic domain of CMGC famil | 4e-07 | |
| cd05052 | 263 | cd05052, PTKc_Abl, Catalytic domain of the Protein | 5e-07 | |
| cd06645 | 267 | cd06645, STKc_MAP4K3, Catalytic domain of the Prot | 5e-07 | |
| cd05094 | 291 | cd05094, PTKc_TrkC, Catalytic domain of the Protei | 5e-07 | |
| cd05581 | 280 | cd05581, STKc_PDK1, Catalytic domain of the Protei | 5e-07 | |
| cd05572 | 262 | cd05572, STKc_cGK_PKG, Catalytic domain of the Pro | 5e-07 | |
| cd05600 | 333 | cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun | 7e-07 | |
| cd05573 | 350 | cd05573, STKc_ROCK_NDR_like, Catalytic domain of R | 1e-06 | |
| PLN00009 | 294 | PLN00009, PLN00009, cyclin-dependent kinase A; Pro | 1e-06 | |
| cd05092 | 280 | cd05092, PTKc_TrkA, Catalytic domain of the Protei | 1e-06 | |
| cd05034 | 261 | cd05034, PTKc_Src_like, Catalytic domain of Src ki | 2e-06 | |
| cd07864 | 302 | cd07864, STKc_CDK12, Catalytic domain of the Serin | 2e-06 | |
| cd06646 | 267 | cd06646, STKc_MAP4K5, Catalytic domain of the Prot | 2e-06 | |
| cd06632 | 258 | cd06632, STKc_MEKK1_plant, Catalytic domain of the | 3e-06 | |
| PLN00034 | 353 | PLN00034, PLN00034, mitogen-activated protein kina | 4e-06 | |
| cd06630 | 268 | cd06630, STKc_MEKK1, Catalytic domain of the Prote | 4e-06 | |
| cd05623 | 332 | cd05623, STKc_MRCK_alpha, Catalytic domain of the | 4e-06 | |
| cd05114 | 256 | cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro | 4e-06 | |
| cd05036 | 277 | cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro | 5e-06 | |
| cd07835 | 283 | cd07835, STKc_CDK1_like, Catalytic domain of Cycli | 5e-06 | |
| cd06622 | 286 | cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of | 6e-06 | |
| PTZ00263 | 329 | PTZ00263, PTZ00263, protein kinase A catalytic sub | 6e-06 | |
| cd05065 | 269 | cd05065, PTKc_EphR_B, Catalytic domain of the Prot | 7e-06 | |
| cd05597 | 331 | cd05597, STKc_DMPK_like, Catalytic domain of Myoto | 7e-06 | |
| cd05093 | 288 | cd05093, PTKc_TrkB, Catalytic domain of the Protei | 7e-06 | |
| cd06625 | 263 | cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ | 7e-06 | |
| cd06608 | 275 | cd06608, STKc_myosinIII_like, Catalytic domain of | 8e-06 | |
| cd07860 | 284 | cd07860, STKc_CDK2_3, Catalytic domain of the Seri | 9e-06 | |
| cd05046 | 275 | cd05046, PTK_CCK4, Pseudokinase domain of the Prot | 1e-05 | |
| cd05084 | 252 | cd05084, PTKc_Fes, Catalytic domain of the Protein | 1e-05 | |
| cd05066 | 267 | cd05066, PTKc_EphR_A, Catalytic domain of the Prot | 1e-05 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 1e-05 | |
| cd05584 | 323 | cd05584, STKc_p70S6K, Catalytic domain of the Prot | 1e-05 | |
| cd05068 | 261 | cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re | 2e-05 | |
| cd05113 | 256 | cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro | 2e-05 | |
| cd07866 | 311 | cd07866, STKc_BUR1, Catalytic domain of the Serine | 2e-05 | |
| cd07839 | 284 | cd07839, STKc_CDK5, Catalytic domain of the Serine | 2e-05 | |
| cd08224 | 267 | cd08224, STKc_Nek6_Nek7, Catalytic domain of the P | 3e-05 | |
| cd06631 | 265 | cd06631, STKc_YSK4, Catalytic domain of the Protei | 3e-05 | |
| cd05599 | 364 | cd05599, STKc_NDR_like, Catalytic domain of Nuclea | 3e-05 | |
| cd05148 | 261 | cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro | 4e-05 | |
| cd05045 | 290 | cd05045, PTKc_RET, Catalytic domain of the Protein | 4e-05 | |
| cd07843 | 293 | cd07843, STKc_CDC2L1, Catalytic domain of the Seri | 4e-05 | |
| cd05574 | 316 | cd05574, STKc_phototropin_like, Catalytic domain o | 5e-05 | |
| cd05082 | 256 | cd05082, PTKc_Csk, Catalytic domain of the Protein | 6e-05 | |
| cd07861 | 285 | cd07861, STKc_CDK1_euk, Catalytic domain of the Se | 8e-05 | |
| cd07845 | 309 | cd07845, STKc_CDK10, Catalytic domain of the Serin | 9e-05 | |
| cd06648 | 285 | cd06648, STKc_PAK_II, Catalytic domain of the Prot | 9e-05 | |
| cd07846 | 286 | cd07846, STKc_CDKL2_3, Catalytic domain of the Ser | 1e-04 | |
| cd05577 | 277 | cd05577, STKc_GRK, Catalytic domain of the Protein | 1e-04 | |
| cd05611 | 260 | cd05611, STKc_Rim15_like, Catalytic domain of fung | 2e-04 | |
| cd05621 | 370 | cd05621, STKc_ROCK2, Catalytic domain of the Prote | 2e-04 | |
| cd06619 | 279 | cd06619, PKc_MKK5, Catalytic domain of the dual-sp | 2e-04 | |
| cd05078 | 258 | cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat | 2e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 3e-04 | |
| cd07865 | 310 | cd07865, STKc_CDK9, Catalytic domain of the Serine | 3e-04 | |
| PTZ00426 | 340 | PTZ00426, PTZ00426, cAMP-dependent protein kinase | 3e-04 | |
| cd06643 | 282 | cd06643, STKc_SLK, Catalytic domain of the Protein | 3e-04 | |
| cd08530 | 256 | cd08530, STKc_CNK2-like, Catalytic domain of the P | 3e-04 | |
| cd05072 | 261 | cd05072, PTKc_Lyn, Catalytic domain of the Protein | 4e-04 | |
| cd06629 | 272 | cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o | 4e-04 | |
| cd07841 | 298 | cd07841, STKc_CDK7, Catalytic domain of the Serine | 5e-04 | |
| cd05067 | 260 | cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro | 5e-04 | |
| cd07869 | 303 | cd07869, STKc_PFTAIRE1, Catalytic domain of the Se | 5e-04 | |
| cd05601 | 330 | cd05601, STKc_CRIK, Catalytic domain of the Protei | 5e-04 | |
| cd05629 | 377 | cd05629, STKc_NDR_like_fungal, Catalytic domain of | 6e-04 | |
| PRK13184 | 932 | PRK13184, pknD, serine/threonine-protein kinase; R | 6e-04 | |
| cd07862 | 290 | cd07862, STKc_CDK6, Catalytic domain of the Serine | 6e-04 | |
| cd07837 | 295 | cd07837, STKc_CdkB_plant, Catalytic domain of the | 6e-04 | |
| cd07870 | 291 | cd07870, STKc_PFTAIRE2, Catalytic domain of the Se | 6e-04 | |
| cd06642 | 277 | cd06642, STKc_STK25-YSK1, Catalytic domain of the | 7e-04 | |
| cd07852 | 337 | cd07852, STKc_MAPK15, Catalytic domain of the Seri | 7e-04 | |
| cd07863 | 288 | cd07863, STKc_CDK4, Catalytic domain of the Serine | 7e-04 | |
| cd06644 | 292 | cd06644, STKc_STK10_LOK, Catalytic domain of the P | 7e-04 | |
| cd05032 | 277 | cd05032, PTKc_InsR_like, Catalytic domain of Insul | 7e-04 | |
| cd05037 | 259 | cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom | 0.001 | |
| cd05624 | 331 | cd05624, STKc_MRCK_beta, Catalytic domain of the P | 0.001 | |
| cd06641 | 277 | cd06641, STKc_MST3, Catalytic domain of the Protei | 0.001 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 0.001 | |
| cd05077 | 262 | cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) do | 0.001 | |
| cd06640 | 277 | cd06640, STKc_MST4, Catalytic domain of the Protei | 0.001 | |
| cd05083 | 254 | cd05083, PTKc_Chk, Catalytic domain of the Protein | 0.001 | |
| cd08218 | 256 | cd08218, STKc_Nek1, Catalytic domain of the Protei | 0.002 | |
| cd08220 | 256 | cd08220, STKc_Nek8, Catalytic domain of the Protei | 0.002 | |
| cd05071 | 262 | cd05071, PTKc_Src, Catalytic domain of the Protein | 0.002 | |
| cd06657 | 292 | cd06657, STKc_PAK4, Catalytic domain of the Protei | 0.002 | |
| cd05628 | 363 | cd05628, STKc_NDR1, Catalytic domain of the Protei | 0.002 | |
| cd06636 | 282 | cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr | 0.002 | |
| cd05088 | 303 | cd05088, PTKc_Tie2, Catalytic domain of the Protei | 0.002 | |
| cd05613 | 290 | cd05613, STKc_MSK1_N, N-terminal catalytic domain | 0.003 | |
| cd05622 | 371 | cd05622, STKc_ROCK1, Catalytic domain of the Prote | 0.003 | |
| cd05627 | 360 | cd05627, STKc_NDR2, Catalytic domain of the Protei | 0.003 | |
| cd07847 | 286 | cd07847, STKc_CDKL1_4, Catalytic domain of the Ser | 0.003 | |
| cd06624 | 268 | cd06624, STKc_ASK, Catalytic domain of the Protein | 0.003 | |
| cd05070 | 260 | cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro | 0.003 | |
| cd05110 | 303 | cd05110, PTKc_HER4, Catalytic domain of the Protei | 0.003 | |
| cd07844 | 291 | cd07844, STKc_PCTAIRE_like, Catalytic domain of PC | 0.004 |
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Score = 168 bits (426), Expect = 6e-45
Identities = 109/301 (36%), Positives = 148/301 (49%), Gaps = 44/301 (14%)
Query: 65 LQLEAKALLNTGWWDSSFWTANYSSDHCKWIGFTCNSAGSIIGLHLSRDYGS-------F 117
L L K+ +N S W N S+D C W G TCN++ ++ + LS S F
Sbjct: 33 LLLSFKSSINDPLKYLSNW--NSSADVCLWQGITCNNSSRVVSIDLSGKNISGKISSAIF 90
Query: 118 EEP-----------------------------VQLSQLNFS------CFPNLENLTFQSF 142
P + LS NF+ PNLE L +
Sbjct: 91 RLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNN 150
Query: 143 PLAGSIPPEISALSKLQRLDLSSNRLTGSIPSEIGNLRNLVYLNISKNILTGTVPSTLGS 202
L+G IP +I + S L+ LDL N L G IP+ + NL +L +L ++ N L G +P LG
Sbjct: 151 MLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQ 210
Query: 203 LTNLKNMGLSYNQLSGPLPQEIGNLKNLMELDLGTNSLIGPIPSTLGRLTNLNYMSLSRN 262
+ +LK + L YN LSG +P EIG L +L LDL N+L GPIPS+LG L NL Y+ L +N
Sbjct: 211 MKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQN 270
Query: 263 MFGGLLPQEIGNLKNLIELNVGSNSLIGPIPSTLGLLTDLSYLDLSCNQFSSSIPNDTTK 322
G +P I +L+ LI L++ NSL G IP + L +L L L N F+ IP T
Sbjct: 271 KLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTS 330
Query: 323 L 323
L
Sbjct: 331 L 331
|
Length = 968 |
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain | Back alignment and domain information |
|---|
| >gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer | Back alignment and domain information |
|---|
| >gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes | Back alignment and domain information |
|---|
| >gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|173643 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 471 | |||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.92 | |
| KOG1187 | 361 | consensus Serine/threonine protein kinase [Signal | 99.9 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.78 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.75 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.73 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.73 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.72 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.71 | |
| KOG0192 | 362 | consensus Tyrosine kinase specific for activated ( | 99.66 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.66 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.64 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.62 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.62 | |
| KOG0595 | 429 | consensus Serine/threonine-protein kinase involved | 99.62 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.58 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.56 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.56 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.55 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.55 | |
| KOG0197 | 468 | consensus Tyrosine kinases [Signal transduction me | 99.54 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.52 | |
| KOG0194 | 474 | consensus Protein tyrosine kinase [Signal transduc | 99.52 | |
| KOG1026 | 774 | consensus Nerve growth factor receptor TRKA and re | 99.5 | |
| KOG0615 | 475 | consensus Serine/threonine protein kinase Chk2 and | 99.49 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.49 | |
| KOG0580 | 281 | consensus Serine/threonine protein kinase [Cell cy | 99.49 | |
| KOG0575 | 592 | consensus Polo-like serine/threonine protein kinas | 99.45 | |
| KOG1094 | 807 | consensus Discoidin domain receptor DDR1 [Signal t | 99.44 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.42 | |
| KOG0598 | 357 | consensus Ribosomal protein S6 kinase and related | 99.41 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.4 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.4 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.39 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.38 | |
| cd05064 | 266 | PTKc_EphR_A10 Catalytic domain of the Protein Tyro | 99.37 | |
| KOG0605 | 550 | consensus NDR and related serine/threonine kinases | 99.37 | |
| KOG0581 | 364 | consensus Mitogen-activated protein kinase kinase | 99.36 | |
| PHA02988 | 283 | hypothetical protein; Provisional | 99.36 | |
| KOG1095 | 1025 | consensus Protein tyrosine kinase [Signal transduc | 99.36 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 99.36 | |
| cd05114 | 256 | PTKc_Tec_Rlk Catalytic domain of the Protein Tyros | 99.36 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.35 | |
| KOG0611 | 668 | consensus Predicted serine/threonine protein kinas | 99.35 | |
| PF07714 | 259 | Pkinase_Tyr: Protein tyrosine kinase Protein kinas | 99.34 | |
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 99.33 | |
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 99.33 | |
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 99.33 | |
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 99.33 | |
| cd05096 | 304 | PTKc_DDR1 Catalytic domain of the Protein Tyrosine | 99.33 | |
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 99.32 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 99.32 | |
| cd05605 | 285 | STKc_GRK4_like Catalytic domain of G protein-coupl | 99.32 | |
| cd05631 | 285 | STKc_GRK4 Catalytic domain of the Protein Serine/T | 99.31 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 99.31 | |
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 99.31 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 99.3 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 99.3 | |
| KOG0591 | 375 | consensus NIMA (never in mitosis)-related G2-speci | 99.29 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 99.29 | |
| cd05033 | 266 | PTKc_EphR Catalytic domain of Ephrin Receptor Prot | 99.29 | |
| KOG0600 | 560 | consensus Cdc2-related protein kinase [Cell cycle | 99.28 | |
| cd06624 | 268 | STKc_ASK Catalytic domain of the Protein Serine/Th | 99.28 | |
| cd05113 | 256 | PTKc_Btk_Bmx Catalytic domain of the Protein Tyros | 99.28 | |
| cd05102 | 338 | PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi | 99.28 | |
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 99.28 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 99.28 | |
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 99.27 | |
| cd05072 | 261 | PTKc_Lyn Catalytic domain of the Protein Tyrosine | 99.27 | |
| cd05624 | 331 | STKc_MRCK_beta Catalytic domain of the Protein Ser | 99.27 | |
| KOG0616 | 355 | consensus cAMP-dependent protein kinase catalytic | 99.27 | |
| cd05597 | 331 | STKc_DMPK_like Catalytic domain of Myotonic Dystro | 99.27 | |
| cd05585 | 312 | STKc_YPK1_like Catalytic domain of Yeast Protein K | 99.26 | |
| cd08224 | 267 | STKc_Nek6_Nek7 Catalytic domain of the Protein Ser | 99.26 | |
| cd05571 | 323 | STKc_PKB Catalytic domain of the Protein Serine/Th | 99.26 | |
| cd05595 | 323 | STKc_PKB_beta Catalytic domain of the Protein Seri | 99.26 | |
| cd05068 | 261 | PTKc_Frk_like Catalytic domain of Fyn-related kina | 99.26 | |
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 99.25 | |
| cd05627 | 360 | STKc_NDR2 Catalytic domain of the Protein Serine/T | 99.25 | |
| cd05632 | 285 | STKc_GRK5 Catalytic domain of the Protein Serine/T | 99.25 | |
| cd05076 | 274 | PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th | 99.25 | |
| cd05601 | 330 | STKc_CRIK Catalytic domain of the Protein Serine/T | 99.25 | |
| KOG0597 | 808 | consensus Serine-threonine protein kinase FUSED [G | 99.25 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 99.25 | |
| cd05148 | 261 | PTKc_Srm_Brk Catalytic domain of the Protein Tyros | 99.24 | |
| cd05593 | 328 | STKc_PKB_gamma Catalytic domain of the Protein Ser | 99.24 | |
| cd08228 | 267 | STKc_Nek6 Catalytic domain of the Protein Serine/T | 99.24 | |
| cd05059 | 256 | PTKc_Tec_like Catalytic domain of Tec-like Protein | 99.24 | |
| cd05623 | 332 | STKc_MRCK_alpha Catalytic domain of the Protein Se | 99.24 | |
| KOG4278 | 1157 | consensus Protein tyrosine kinase [Signal transduc | 99.24 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 99.24 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 99.24 | |
| cd06615 | 308 | PKc_MEK Catalytic domain of the dual-specificity P | 99.24 | |
| cd05085 | 250 | PTKc_Fer Catalytic domain of the Protein Tyrosine | 99.23 | |
| cd05608 | 280 | STKc_GRK1 Catalytic domain of the Protein Serine/T | 99.23 | |
| cd05573 | 350 | STKc_ROCK_NDR_like Catalytic domain of ROCK- and N | 99.23 | |
| cd05588 | 329 | STKc_aPKC Catalytic domain of the Protein Serine/T | 99.23 | |
| cd05066 | 267 | PTKc_EphR_A Catalytic domain of the Protein Tyrosi | 99.23 | |
| cd08229 | 267 | STKc_Nek7 Catalytic domain of the Protein Serine/T | 99.22 | |
| cd05594 | 325 | STKc_PKB_alpha Catalytic domain of the Protein Ser | 99.22 | |
| cd05607 | 277 | STKc_GRK7 Catalytic domain of the Protein Serine/T | 99.22 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 99.22 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 99.22 | |
| cd05090 | 283 | PTKc_Ror1 Catalytic domain of the Protein Tyrosine | 99.22 | |
| cd08529 | 256 | STKc_FA2-like Catalytic domain of the Protein Seri | 99.22 | |
| cd05081 | 284 | PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of | 99.22 | |
| cd05084 | 252 | PTKc_Fes Catalytic domain of the Protein Tyrosine | 99.21 | |
| cd05589 | 324 | STKc_PKN Catalytic domain of the Protein Serine/Th | 99.21 | |
| KOG0610 | 459 | consensus Putative serine/threonine protein kinase | 99.21 | |
| cd06646 | 267 | STKc_MAP4K5 Catalytic domain of the Protein Serine | 99.21 | |
| cd05067 | 260 | PTKc_Lck_Blk Catalytic domain of the Protein Tyros | 99.21 | |
| cd05034 | 261 | PTKc_Src_like Catalytic domain of Src kinase-like | 99.21 | |
| cd06631 | 265 | STKc_YSK4 Catalytic domain of the Protein Serine/T | 99.2 | |
| cd05087 | 269 | PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein | 99.2 | |
| cd05062 | 277 | PTKc_IGF-1R Catalytic domain of the Protein Tyrosi | 99.2 | |
| cd05580 | 290 | STKc_PKA Catalytic domain of the Protein Serine/Th | 99.2 | |
| cd05630 | 285 | STKc_GRK6 Catalytic domain of the Protein Serine/T | 99.2 | |
| cd05052 | 263 | PTKc_Abl Catalytic domain of the Protein Tyrosine | 99.19 | |
| cd05046 | 275 | PTK_CCK4 Pseudokinase domain of the Protein Tyrosi | 99.19 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.19 | |
| cd05065 | 269 | PTKc_EphR_B Catalytic domain of the Protein Tyrosi | 99.19 | |
| cd05063 | 268 | PTKc_EphR_A2 Catalytic domain of the Protein Tyros | 99.19 | |
| cd05036 | 277 | PTKc_ALK_LTK Catalytic domain of the Protein Tyros | 99.19 | |
| cd05050 | 288 | PTKc_Musk Catalytic domain of the Protein Tyrosine | 99.18 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 99.18 | |
| KOG0583 | 370 | consensus Serine/threonine protein kinase [Signal | 99.18 | |
| KOG2052 | 513 | consensus Activin A type IB receptor, serine/threo | 99.18 | |
| KOG0586 | 596 | consensus Serine/threonine protein kinase [General | 99.18 | |
| cd05097 | 295 | PTKc_DDR_like Catalytic domain of Discoidin Domain | 99.18 | |
| cd08227 | 327 | PK_STRAD_alpha Pseudokinase domain of STE20-relate | 99.18 | |
| cd05618 | 329 | STKc_aPKC_iota Catalytic domain of the Protein Ser | 99.17 | |
| cd05582 | 318 | STKc_RSK_N N-terminal catalytic domain of the Prot | 99.17 | |
| cd05609 | 305 | STKc_MAST Catalytic domain of the Protein Serine/T | 99.17 | |
| cd05615 | 323 | STKc_cPKC_alpha Catalytic domain of the Protein Se | 99.17 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.17 | |
| cd05073 | 260 | PTKc_Hck Catalytic domain of the Protein Tyrosine | 99.17 | |
| cd05049 | 280 | PTKc_Trk Catalytic domain of the Protein Tyrosine | 99.17 | |
| cd06620 | 284 | PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr | 99.17 | |
| cd08221 | 256 | STKc_Nek9 Catalytic domain of the Protein Serine/T | 99.17 | |
| cd05112 | 256 | PTKc_Itk Catalytic domain of the Protein Tyrosine | 99.17 | |
| cd05570 | 318 | STKc_PKC Catalytic domain of the Protein Serine/Th | 99.17 | |
| KOG0032 | 382 | consensus Ca2+/calmodulin-dependent protein kinase | 99.17 | |
| cd05043 | 280 | PTK_Ryk Pseudokinase domain of Ryk (Receptor relat | 99.17 | |
| cd05619 | 316 | STKc_nPKC_theta Catalytic domain of the Protein Se | 99.17 | |
| KOG0663 | 419 | consensus Protein kinase PITSLRE and related kinas | 99.17 | |
| cd05587 | 324 | STKc_cPKC Catalytic domain of the Protein Serine/T | 99.17 | |
| cd05578 | 258 | STKc_Yank1 Catalytic domain of the Protein Serine/ | 99.17 | |
| cd05039 | 256 | PTKc_Csk_like Catalytic domain of C-terminal Src k | 99.16 | |
| cd06622 | 286 | PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS | 99.16 | |
| cd05071 | 262 | PTKc_Src Catalytic domain of the Protein Tyrosine | 99.16 | |
| cd06641 | 277 | STKc_MST3 Catalytic domain of the Protein Serine/T | 99.16 | |
| cd05591 | 321 | STKc_nPKC_epsilon Catalytic domain of the Protein | 99.16 | |
| cd05088 | 303 | PTKc_Tie2 Catalytic domain of the Protein Tyrosine | 99.16 | |
| cd05103 | 343 | PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi | 99.16 | |
| cd05093 | 288 | PTKc_TrkB Catalytic domain of the Protein Tyrosine | 99.16 | |
| cd05070 | 260 | PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros | 99.16 | |
| cd05061 | 288 | PTKc_InsR Catalytic domain of the Protein Tyrosine | 99.15 | |
| cd05590 | 320 | STKc_nPKC_eta Catalytic domain of the Protein Seri | 99.15 | |
| cd05616 | 323 | STKc_cPKC_beta Catalytic domain of the Protein Ser | 99.15 | |
| cd06629 | 272 | STKc_MAPKKK_Bck1_like Catalytic domain of fungal B | 99.15 | |
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 99.15 | |
| cd05108 | 316 | PTKc_EGFR Catalytic domain of the Protein Tyrosine | 99.15 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 99.15 | |
| cd06632 | 258 | STKc_MEKK1_plant Catalytic domain of the Protein S | 99.14 | |
| cd05575 | 323 | STKc_SGK Catalytic domain of the Protein Serine/Th | 99.14 | |
| cd06611 | 280 | STKc_SLK_like Catalytic domain of Ste20-like kinas | 99.14 | |
| cd05098 | 307 | PTKc_FGFR1 Catalytic domain of the Protein Tyrosin | 99.14 | |
| cd05069 | 260 | PTKc_Yes Catalytic domain of the Protein Tyrosine | 99.14 | |
| cd05040 | 257 | PTKc_Ack_like Catalytic domain of the Protein Tyro | 99.14 | |
| cd05617 | 327 | STKc_aPKC_zeta Catalytic domain of the Protein Ser | 99.14 | |
| cd07841 | 298 | STKc_CDK7 Catalytic domain of the Serine/Threonine | 99.14 | |
| cd08225 | 257 | STKc_Nek5 Catalytic domain of the Protein Serine/T | 99.14 | |
| cd05038 | 284 | PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P | 99.14 | |
| cd05045 | 290 | PTKc_RET Catalytic domain of the Protein Tyrosine | 99.14 | |
| cd05094 | 291 | PTKc_TrkC Catalytic domain of the Protein Tyrosine | 99.13 | |
| cd05042 | 269 | PTKc_Aatyk Catalytic domain of the Protein Tyrosin | 99.13 | |
| cd05048 | 283 | PTKc_Ror Catalytic Domain of the Protein Tyrosine | 99.13 | |
| cd07836 | 284 | STKc_Pho85 Catalytic domain of the Serine/Threonin | 99.13 | |
| cd05603 | 321 | STKc_SGK2 Catalytic domain of the Protein Serine/T | 99.13 | |
| cd06630 | 268 | STKc_MEKK1 Catalytic domain of the Protein Serine/ | 99.13 | |
| cd05610 | 669 | STKc_MASTL Catalytic domain of the Protein Serine/ | 99.13 | |
| cd05574 | 316 | STKc_phototropin_like Catalytic domain of Phototro | 99.13 | |
| cd05584 | 323 | STKc_p70S6K Catalytic domain of the Protein Serine | 99.13 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 99.13 | |
| cd05079 | 284 | PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the | 99.13 | |
| cd05053 | 293 | PTKc_FGFR Catalytic domain of the Protein Tyrosine | 99.12 | |
| cd05604 | 325 | STKc_SGK3 Catalytic domain of the Protein Serine/T | 99.12 | |
| cd06610 | 267 | STKc_OSR1_SPAK Catalytic domain of the Protein Ser | 99.12 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 99.12 | |
| cd05577 | 277 | STKc_GRK Catalytic domain of the Protein Serine/Th | 99.12 | |
| cd08218 | 256 | STKc_Nek1 Catalytic domain of the Protein Serine/T | 99.12 | |
| KOG0193 | 678 | consensus Serine/threonine protein kinase RAF [Sig | 99.12 | |
| cd05095 | 296 | PTKc_DDR2 Catalytic domain of the Protein Tyrosine | 99.12 | |
| cd07846 | 286 | STKc_CDKL2_3 Catalytic domain of the Serine/Threon | 99.12 | |
| cd05037 | 259 | PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the | 99.11 | |
| cd05592 | 316 | STKc_nPKC_theta_delta Catalytic domain of the Prot | 99.11 | |
| cd06637 | 272 | STKc_TNIK Catalytic domain of the Protein Serine/T | 99.11 | |
| cd05032 | 277 | PTKc_InsR_like Catalytic domain of Insulin Recepto | 99.11 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.11 | |
| cd07848 | 287 | STKc_CDKL5 Catalytic domain of the Serine/Threonin | 99.11 | |
| cd06652 | 265 | STKc_MEKK2 Catalytic domain of the Protein Serine/ | 99.11 | |
| cd06642 | 277 | STKc_STK25-YSK1 Catalytic domain of the Protein Se | 99.11 | |
| cd05051 | 296 | PTKc_DDR Catalytic domain of the Protein Tyrosine | 99.11 | |
| cd05101 | 304 | PTKc_FGFR2 Catalytic domain of the Protein Tyrosin | 99.11 | |
| cd06625 | 263 | STKc_MEKK3_like Catalytic domain of MAP/ERK kinase | 99.1 | |
| KOG0659 | 318 | consensus Cdk activating kinase (CAK)/RNA polymera | 99.1 | |
| cd07861 | 285 | STKc_CDK1_euk Catalytic domain of the Serine/Threo | 99.1 | |
| cd05092 | 280 | PTKc_TrkA Catalytic domain of the Protein Tyrosine | 99.1 | |
| KOG0582 | 516 | consensus Ste20-like serine/threonine protein kina | 99.1 | |
| cd06614 | 286 | STKc_PAK Catalytic domain of the Protein Serine/Th | 99.1 | |
| cd05089 | 297 | PTKc_Tie1 Catalytic domain of the Protein Tyrosine | 99.1 | |
| cd05078 | 258 | PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain | 99.1 | |
| cd06623 | 264 | PKc_MAPKK_plant_like Catalytic domain of Plant dua | 99.1 | |
| cd05077 | 262 | PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th | 99.1 | |
| cd05041 | 251 | PTKc_Fes_like Catalytic domain of Fes-like Protein | 99.1 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 99.1 | |
| KOG0198 | 313 | consensus MEKK and related serine/threonine protei | 99.1 | |
| KOG0592 | 604 | consensus 3-phosphoinositide-dependent protein kin | 99.09 | |
| cd05057 | 279 | PTKc_EGFR_like Catalytic domain of Epidermal Growt | 99.09 | |
| cd08220 | 256 | STKc_Nek8 Catalytic domain of the Protein Serine/T | 99.09 | |
| PF00069 | 260 | Pkinase: Protein kinase domain Protein kinase; unc | 99.09 | |
| cd06643 | 282 | STKc_SLK Catalytic domain of the Protein Serine/Th | 99.09 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 99.09 | |
| cd05614 | 332 | STKc_MSK2_N N-terminal catalytic domain of the Pro | 99.09 | |
| cd07832 | 286 | STKc_CCRK Catalytic domain of the Serine/Threonine | 99.09 | |
| cd07871 | 288 | STKc_PCTAIRE3 Catalytic domain of the Serine/Threo | 99.09 | |
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 99.09 | |
| cd06645 | 267 | STKc_MAP4K3 Catalytic domain of the Protein Serine | 99.08 | |
| cd06609 | 274 | STKc_MST3_like Catalytic domain of Mammalian Ste20 | 99.08 | |
| cd08219 | 255 | STKc_Nek3 Catalytic domain of the Protein Serine/T | 99.08 | |
| cd05115 | 257 | PTKc_Zap-70 Catalytic domain of the Protein Tyrosi | 99.08 | |
| cd06621 | 287 | PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek | 99.08 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 99.08 | |
| cd06612 | 256 | STKc_MST1_2 Catalytic domain of the Protein Serine | 99.08 | |
| cd06626 | 264 | STKc_MEKK4 Catalytic domain of the Protein Serine/ | 99.08 | |
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 99.08 | |
| cd05044 | 269 | PTKc_c-ros Catalytic domain of the Protein Tyrosin | 99.08 | |
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 99.08 | |
| cd05581 | 280 | STKc_PDK1 Catalytic domain of the Protein Serine/T | 99.08 | |
| cd05572 | 262 | STKc_cGK_PKG Catalytic domain of the Protein Serin | 99.08 | |
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 99.08 | |
| KOG4257 | 974 | consensus Focal adhesion tyrosine kinase FAK, cont | 99.08 | |
| cd06640 | 277 | STKc_MST4 Catalytic domain of the Protein Serine/T | 99.07 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 99.07 | |
| cd05086 | 268 | PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi | 99.07 | |
| cd05579 | 265 | STKc_MAST_like Catalytic domain of Microtubule-ass | 99.07 | |
| cd05056 | 270 | PTKc_FAK Catalytic domain of the Protein Tyrosine | 99.07 | |
| cd00192 | 262 | PTKc Catalytic domain of Protein Tyrosine Kinases. | 99.07 | |
| cd05620 | 316 | STKc_nPKC_delta Catalytic domain of the Protein Se | 99.07 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 99.07 | |
| cd06628 | 267 | STKc_MAPKKK_Byr2_like Catalytic domain of fungal B | 99.07 | |
| cd07847 | 286 | STKc_CDKL1_4 Catalytic domain of the Serine/Threon | 99.07 | |
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 99.07 | |
| KOG4250 | 732 | consensus TANK binding protein kinase TBK1 [Signal | 99.07 | |
| cd05111 | 279 | PTK_HER3 Pseudokinase domain of the Protein Tyrosi | 99.06 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 99.06 | |
| cd05060 | 257 | PTKc_Syk_like Catalytic domain of Spleen Tyrosine | 99.06 | |
| cd08217 | 265 | STKc_Nek2 Catalytic domain of the Protein Serine/T | 99.06 | |
| cd05116 | 257 | PTKc_Syk Catalytic domain of the Protein Tyrosine | 99.06 | |
| cd06606 | 260 | STKc_MAPKKK Catalytic domain of the Protein Serine | 99.06 | |
| cd06917 | 277 | STKc_NAK1_like Catalytic domain of Fungal Nak1-lik | 99.06 | |
| cd08528 | 269 | STKc_Nek10 Catalytic domain of the Protein Serine/ | 99.05 | |
| KOG0588 | 786 | consensus Serine/threonine protein kinase [Cell cy | 99.05 | |
| cd06647 | 293 | STKc_PAK_I Catalytic domain of the Protein Serine/ | 99.05 | |
| cd06651 | 266 | STKc_MEKK3 Catalytic domain of the Protein Serine/ | 99.05 | |
| cd06655 | 296 | STKc_PAK2 Catalytic domain of the Protein Serine/T | 99.05 | |
| KOG3653 | 534 | consensus Transforming growth factor beta/activin | 99.05 | |
| cd06617 | 283 | PKc_MKK3_6 Catalytic domain of the dual-specificit | 99.05 | |
| cd05035 | 273 | PTKc_Axl_like Catalytic Domain of Axl-like Protein | 99.05 | |
| cd05054 | 337 | PTKc_VEGFR Catalytic domain of the Protein Tyrosin | 99.05 | |
| cd06605 | 265 | PKc_MAPKK Catalytic domain of the dual-specificity | 99.04 | |
| cd06619 | 279 | PKc_MKK5 Catalytic domain of the dual-specificity | 99.04 | |
| KOG0593 | 396 | consensus Predicted protein kinase KKIAMRE [Genera | 99.04 | |
| smart00219 | 258 | TyrKc Tyrosine kinase, catalytic domain. Phosphotr | 99.04 | |
| KOG0661 | 538 | consensus MAPK related serine/threonine protein ki | 99.04 | |
| cd05080 | 283 | PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the | 99.04 | |
| cd05091 | 283 | PTKc_Ror2 Catalytic domain of the Protein Tyrosine | 99.04 | |
| cd05602 | 325 | STKc_SGK1 Catalytic domain of the Protein Serine/T | 99.03 | |
| cd05082 | 256 | PTKc_Csk Catalytic domain of the Protein Tyrosine | 99.03 | |
| cd05047 | 270 | PTKc_Tie Catalytic domain of Tie Protein Tyrosine | 99.03 | |
| cd07860 | 284 | STKc_CDK2_3 Catalytic domain of the Serine/Threoni | 99.03 | |
| cd05109 | 279 | PTKc_HER2 Catalytic domain of the Protein Tyrosine | 99.03 | |
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 99.03 | |
| cd07843 | 293 | STKc_CDC2L1 Catalytic domain of the Serine/Threoni | 99.03 | |
| KOG0201 | 467 | consensus Serine/threonine protein kinase [Signal | 99.03 | |
| KOG0589 | 426 | consensus Serine/threonine protein kinase [General | 99.03 | |
| cd06627 | 254 | STKc_Cdc7_like Catalytic domain of Cell division c | 99.02 | |
| cd06608 | 275 | STKc_myosinIII_like Catalytic domain of Class III | 99.02 | |
| cd08223 | 257 | STKc_Nek4 Catalytic domain of the Protein Serine/T | 99.02 | |
| KOG0585 | 576 | consensus Ca2+/calmodulin-dependent protein kinase | 99.02 | |
| cd07873 | 301 | STKc_PCTAIRE1 Catalytic domain of the Serine/Threo | 99.01 | |
| KOG1025 | 1177 | consensus Epidermal growth factor receptor EGFR an | 99.01 | |
| cd05083 | 254 | PTKc_Chk Catalytic domain of the Protein Tyrosine | 99.01 | |
| cd07859 | 338 | STKc_TDY_MAPK_plant Catalytic domain of the Serine | 99.01 | |
| KOG0574 | 502 | consensus STE20-like serine/threonine kinase MST [ | 99.01 | |
| cd05075 | 272 | PTKc_Axl Catalytic domain of the Protein Tyrosine | 99.01 | |
| cd06653 | 264 | STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina | 99.0 | |
| cd07844 | 291 | STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like | 99.0 | |
| cd07853 | 372 | STKc_NLK Catalytic domain of the Serine/Threonine | 99.0 | |
| cd05586 | 330 | STKc_Sck1_like Catalytic domain of Suppressor of l | 98.99 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 98.99 | |
| KOG0199 | 1039 | consensus ACK and related non-receptor tyrosine ki | 98.99 | |
| cd06613 | 262 | STKc_MAP4K3_like Catalytic domain of Mitogen-activ | 98.99 | |
| cd07835 | 283 | STKc_CDK1_like Catalytic domain of Cyclin-Dependen | 98.99 | |
| cd05122 | 253 | PKc_STE Catalytic domain of STE family Protein Kin | 98.99 | |
| cd05613 | 290 | STKc_MSK1_N N-terminal catalytic domain of the Pro | 98.98 | |
| cd06636 | 282 | STKc_MAP4K4_6 Catalytic domain of the Protein Seri | 98.98 | |
| cd05058 | 262 | PTKc_Met_Ron Catalytic domain of the Protein Tyros | 98.98 | |
| KOG0694 | 694 | consensus Serine/threonine protein kinase [Signal | 98.97 | |
| cd07870 | 291 | STKc_PFTAIRE2 Catalytic domain of the Serine/Threo | 98.97 | |
| cd08215 | 258 | STKc_Nek Catalytic domain of the Protein Serine/Th | 98.97 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 98.96 | |
| cd07840 | 287 | STKc_CDK9_like Catalytic domain of Cyclin-Dependen | 98.96 | |
| cd06659 | 297 | STKc_PAK6 Catalytic domain of the Protein Serine/T | 98.96 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 98.96 | |
| cd07833 | 288 | STKc_CDKL Catalytic domain of Cyclin-Dependent pro | 98.96 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.96 | |
| cd08530 | 256 | STKc_CNK2-like Catalytic domain of the Protein Ser | 98.95 | |
| KOG0577 | 948 | consensus Serine/threonine protein kinase [Signal | 98.95 | |
| cd07864 | 302 | STKc_CDK12 Catalytic domain of the Serine/Threonin | 98.95 | |
| cd05611 | 260 | STKc_Rim15_like Catalytic domain of fungal Rim15-l | 98.95 | |
| cd05633 | 279 | STKc_GRK3 Catalytic domain of the Protein Serine/T | 98.95 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 98.94 | |
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 98.94 | |
| cd05583 | 288 | STKc_MSK_N N-terminal catalytic domain of the Prot | 98.94 | |
| cd07862 | 290 | STKc_CDK6 Catalytic domain of the Serine/Threonine | 98.93 | |
| KOG0658 | 364 | consensus Glycogen synthase kinase-3 [Carbohydrate | 98.93 | |
| cd08226 | 328 | PK_STRAD_beta Pseudokinase domain of STE20-related | 98.93 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.93 | |
| cd07837 | 295 | STKc_CdkB_plant Catalytic domain of the Serine/Thr | 98.93 | |
| cd05123 | 250 | STKc_AGC Catalytic domain of AGC family Protein Se | 98.93 | |
| cd05110 | 303 | PTKc_HER4 Catalytic domain of the Protein Tyrosine | 98.92 | |
| cd06657 | 292 | STKc_PAK4 Catalytic domain of the Protein Serine/T | 98.92 | |
| cd06648 | 285 | STKc_PAK_II Catalytic domain of the Protein Serine | 98.92 | |
| cd07842 | 316 | STKc_CDK8_like Catalytic domain of Cyclin-Dependen | 98.92 | |
| PLN00009 | 294 | cyclin-dependent kinase A; Provisional | 98.91 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 98.91 | |
| KOG4717 | 864 | consensus Serine/threonine protein kinase [Signal | 98.91 | |
| cd05606 | 278 | STKc_beta_ARK Catalytic domain of the Protein Seri | 98.91 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 98.9 | |
| cd07839 | 284 | STKc_CDK5 Catalytic domain of the Serine/Threonine | 98.9 | |
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 98.9 | |
| cd05074 | 273 | PTKc_Tyro3 Catalytic domain of the Protein Tyrosin | 98.9 | |
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 98.89 | |
| cd07831 | 282 | STKc_MOK Catalytic domain of the Serine/Threonine | 98.89 | |
| KOG1989 | 738 | consensus ARK protein kinase family [Signal transd | 98.88 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.88 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 98.88 | |
| cd07830 | 283 | STKc_MAK_like Catalytic domain of Male germ cell-A | 98.88 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 98.88 | |
| KOG0587 | 953 | consensus Traf2- and Nck-interacting kinase and re | 98.87 | |
| KOG4721 | 904 | consensus Serine/threonine protein kinase, contain | 98.87 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.86 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 98.85 | |
| cd08222 | 260 | STKc_Nek11 Catalytic domain of the Protein Serine/ | 98.85 | |
| smart00221 | 225 | STYKc Protein kinase; unclassified specificity. Ph | 98.85 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.85 | |
| cd07829 | 282 | STKc_CDK_like Catalytic domain of Cyclin-Dependent | 98.84 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 98.84 | |
| cd07838 | 287 | STKc_CDK4_6_like Catalytic domain of Cyclin-Depend | 98.84 | |
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 98.83 | |
| PHA03390 | 267 | pk1 serine/threonine-protein kinase 1; Provisional | 98.83 | |
| cd07852 | 337 | STKc_MAPK15 Catalytic domain of the Serine/Threoni | 98.83 | |
| KOG0033 | 355 | consensus Ca2+/calmodulin-dependent protein kinase | 98.83 | |
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 98.83 | |
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 98.82 | |
| KOG0578 | 550 | consensus p21-activated serine/threonine protein k | 98.81 | |
| KOG4236 | 888 | consensus Serine/threonine protein kinase PKC mu/P | 98.81 | |
| KOG0607 | 463 | consensus MAP kinase-interacting kinase and relate | 98.81 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 98.8 | |
| cd07867 | 317 | STKc_CDC2L6 Catalytic domain of Serine/Threonine K | 98.8 | |
| cd07865 | 310 | STKc_CDK9 Catalytic domain of the Serine/Threonine | 98.79 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 98.79 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 98.79 | |
| cd07863 | 288 | STKc_CDK4 Catalytic domain of the Serine/Threonine | 98.78 | |
| cd05118 | 283 | STKc_CMGC Catalytic domain of CMGC family Serine/T | 98.77 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 98.75 | |
| cd07868 | 317 | STKc_CDK8 Catalytic domain of the Serine/Threonine | 98.75 | |
| KOG0690 | 516 | consensus Serine/threonine protein kinase [Signal | 98.75 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.75 | |
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 98.74 | |
| cd06616 | 288 | PKc_MKK4 Catalytic domain of the dual-specificity | 98.74 | |
| cd07834 | 330 | STKc_MAPK Catalytic domain of the Serine/Threonine | 98.74 | |
| cd08216 | 314 | PK_STRAD Pseudokinase domain of STE20-related kina | 98.73 | |
| KOG0662 | 292 | consensus Cyclin-dependent kinase CDK5 [Intracellu | 98.73 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 98.73 | |
| cd00180 | 215 | PKc Catalytic domain of Protein Kinases. Protein K | 98.72 | |
| KOG0594 | 323 | consensus Protein kinase PCTAIRE and related kinas | 98.72 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 98.72 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 98.71 | |
| PTZ00284 | 467 | protein kinase; Provisional | 98.7 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 98.7 | |
| KOG4279 | 1226 | consensus Serine/threonine protein kinase [Signal | 98.7 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.7 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 98.69 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 98.68 | |
| cd07866 | 311 | STKc_BUR1 Catalytic domain of the Serine/Threonine | 98.67 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 98.67 | |
| PRK10345 | 210 | hypothetical protein; Provisional | 98.66 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.62 | |
| cd05147 | 190 | RIO1_euk RIO kinase family; eukaryotic RIO1, catal | 98.62 | |
| KOG0576 | 829 | consensus Mitogen-activated protein kinase kinase | 98.62 | |
| KOG0667 | 586 | consensus Dual-specificity tyrosine-phosphorylatio | 98.59 | |
| KOG2345 | 302 | consensus Serine/threonine protein kinase/TGF-beta | 98.58 | |
| smart00220 | 244 | S_TKc Serine/Threonine protein kinases, catalytic | 98.56 | |
| PRK14879 | 211 | serine/threonine protein kinase; Provisional | 98.55 | |
| cd07857 | 332 | STKc_MPK1 Catalytic domain of the Serine/Threonine | 98.55 | |
| KOG0200 | 609 | consensus Fibroblast/platelet-derived growth facto | 98.55 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 98.54 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 98.52 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.51 | |
| cd05576 | 237 | STKc_RPK118_like Catalytic domain of the Protein S | 98.51 | |
| KOG1151 | 775 | consensus Tousled-like protein kinase [Signal tran | 98.5 | |
| KOG0660 | 359 | consensus Mitogen-activated protein kinase [Signal | 98.49 | |
| PRK10359 | 232 | lipopolysaccharide core biosynthesis protein; Prov | 98.49 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.47 | |
| cd05145 | 190 | RIO1_like RIO kinase family; RIO1, RIO3 and simila | 98.47 | |
| KOG1152 | 772 | consensus Signal transduction serine/threonine kin | 98.47 | |
| KOG4645 | 1509 | consensus MAPKKK (MAP kinase kinase kinase) SSK2 a | 98.45 | |
| KOG0986 | 591 | consensus G protein-coupled receptor kinase [Signa | 98.44 | |
| KOG0666 | 438 | consensus Cyclin C-dependent kinase CDK8 [Transcri | 98.43 | |
| KOG0579 | 1187 | consensus Ste20-like serine/threonine protein kina | 98.42 | |
| KOG0599 | 411 | consensus Phosphorylase kinase gamma subunit [Carb | 98.41 | |
| TIGR03724 | 199 | arch_bud32 Kae1-associated kinase Bud32. Members o | 98.41 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.41 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.4 | |
| KOG0584 | 632 | consensus Serine/threonine protein kinase [General | 98.38 | |
| KOG0696 | 683 | consensus Serine/threonine protein kinase [Signal | 98.36 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.36 | |
| PRK09605 | 535 | bifunctional UGMP family protein/serine/threonine | 98.34 | |
| KOG1006 | 361 | consensus Mitogen-activated protein kinase (MAPK) | 98.27 | |
| KOG0608 | 1034 | consensus Warts/lats-like serine threonine kinases | 98.23 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 98.22 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.22 | |
| KOG0596 | 677 | consensus Dual specificity; serine/threonine and t | 98.14 | |
| cd05144 | 198 | RIO2_C RIO kinase family; RIO2, C-terminal catalyt | 98.12 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.1 | |
| KOG0695 | 593 | consensus Serine/threonine protein kinase [Signal | 98.08 | |
| smart00090 | 237 | RIO RIO-like kinase. | 98.05 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 98.05 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 98.03 | |
| KOG0604 | 400 | consensus MAP kinase-activated protein kinase 2 [S | 98.02 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.02 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.97 | |
| KOG0983 | 391 | consensus Mitogen-activated protein kinase (MAPK) | 97.96 | |
| cd05120 | 155 | APH_ChoK_like Aminoglycoside 3'-phosphotransferase | 97.94 | |
| PF08263 | 43 | LRRNT_2: Leucine rich repeat N-terminal domain; In | 97.93 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.9 | |
| KOG0668 | 338 | consensus Casein kinase II, alpha subunit [Signal | 97.89 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.84 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.84 | |
| KOG1027 | 903 | consensus Serine/threonine protein kinase and endo | 97.8 | |
| PHA02882 | 294 | putative serine/threonine kinase; Provisional | 97.77 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.72 | |
| TIGR01982 | 437 | UbiB 2-polyprenylphenol 6-hydroxylase. This model | 97.7 | |
| cd05119 | 187 | RIO RIO kinase family, catalytic domain. The RIO k | 97.69 | |
| KOG0984 | 282 | consensus Mitogen-activated protein kinase (MAPK) | 97.68 | |
| PRK04750 | 537 | ubiB putative ubiquinone biosynthesis protein UbiB | 97.62 | |
| PRK12274 | 218 | serine/threonine protein kinase; Provisional | 97.6 | |
| KOG0669 | 376 | consensus Cyclin T-dependent kinase CDK9 [Cell cyc | 97.56 | |
| COG0515 | 384 | SPS1 Serine/threonine protein kinase [General func | 97.55 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.54 | |
| KOG1167 | 418 | consensus Serine/threonine protein kinase of the C | 97.52 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.49 | |
| KOG0603 | 612 | consensus Ribosomal protein S6 kinase [Signal tran | 97.49 | |
| KOG1024 | 563 | consensus Receptor-like protein tyrosine kinase RY | 97.4 | |
| KOG1290 | 590 | consensus Serine/threonine protein kinase [Signal | 97.38 | |
| KOG0614 | 732 | consensus cGMP-dependent protein kinase [Signal tr | 97.31 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.27 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.22 | |
| KOG1345 | 378 | consensus Serine/threonine kinase [Signal transduc | 97.21 | |
| cd05154 | 223 | ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an | 97.21 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.18 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.18 | |
| KOG0671 | 415 | consensus LAMMER dual specificity kinases [Signal | 97.17 | |
| KOG1164 | 322 | consensus Casein kinase (serine/threonine/tyrosine | 97.15 | |
| PRK01723 | 239 | 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed | 97.11 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.1 | |
| KOG1163 | 341 | consensus Casein kinase (serine/threonine/tyrosine | 97.07 | |
| KOG1166 | 974 | consensus Mitotic checkpoint serine/threonine prot | 96.89 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.82 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 96.79 | |
| KOG0664 | 449 | consensus Nemo-like MAPK-related serine/threonine | 96.78 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.75 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.72 | |
| cd05151 | 170 | ChoK Choline Kinase (ChoK). The ChoK subfamily is | 96.49 | |
| KOG0670 | 752 | consensus U4/U6-associated splicing factor PRP4 [R | 96.4 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 96.38 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 96.36 | |
| COG2112 | 201 | Predicted Ser/Thr protein kinase [Signal transduct | 95.92 | |
| KOG1165 | 449 | consensus Casein kinase (serine/threonine/tyrosine | 95.72 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.57 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.45 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.43 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.25 | |
| PF13095 | 207 | FTA2: Kinetochore Sim4 complex subunit FTA2 | 94.14 | |
| KOG3741 | 655 | consensus Poly(A) ribonuclease subunit [RNA proces | 93.1 | |
| PF03109 | 119 | ABC1: ABC1 family; InterPro: IPR004147 This entry | 93.04 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 92.87 | |
| KOG0603 | 612 | consensus Ribosomal protein S6 kinase [Signal tran | 92.86 |
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=6e-43 Score=396.32 Aligned_cols=247 Identities=40% Similarity=0.640 Sum_probs=180.2
Q ss_pred cccchHHHHHHHhcCCCCCCCCCCCCCCCCCCcccceeeCCCCCEEEEEcCCC--CCCCCcc------------------
Q 042931 61 ALSPLQLEAKALLNTGWWDSSFWTANYSSDHCKWIGFTCNSAGSIIGLHLSRD--YGSFEEP------------------ 120 (471)
Q Consensus 61 ~~~~~~~~~~~l~~~~~~~~~~w~~~~~~~~C~w~gv~C~~~~~v~~l~l~~~--~~~~~~~------------------ 120 (471)
+..++..+++++. .+...+.+| +.+.+||.|.||+|+..++|+.|++++. .+.+++.
T Consensus 30 ~~~~l~~~~~~~~-~~~~~~~~w--~~~~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~ 106 (968)
T PLN00113 30 ELELLLSFKSSIN-DPLKYLSNW--NSSADVCLWQGITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLS 106 (968)
T ss_pred HHHHHHHHHHhCC-CCcccCCCC--CCCCCCCcCcceecCCCCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccC
Confidence 3345666666653 233446788 4567899999999997789999998742 2222110
Q ss_pred -----------ccccccc-----------cCCCCCCCEEEcCCCCCCccCchhccCCCCCCEEeccCCCCCCcCCcccCC
Q 042931 121 -----------VQLSQLN-----------FSCFPNLENLTFQSFPLAGSIPPEISALSKLQRLDLSSNRLTGSIPSEIGN 178 (471)
Q Consensus 121 -----------~~l~~l~-----------l~~l~~L~~L~L~~n~l~g~ip~~l~~L~~L~~L~Ls~N~l~g~iP~~l~~ 178 (471)
..|+.++ .+.+++|++|+|++|.+.+.+|..++++++|++|+|++|.+.+.+|..+++
T Consensus 107 ~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~ 186 (968)
T PLN00113 107 GPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTN 186 (968)
T ss_pred CcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhh
Confidence 0111111 123555666666666666677777778888888888888887778888888
Q ss_pred CCCCcEEEcccCCCCCCCCCccCCCCCcCEEEccCCCCCCCCcccccCCCCCCEEeCCCCccccccccccCCCCCCCEEE
Q 042931 179 LRNLVYLNISKNILTGTVPSTLGSLTNLKNMGLSYNQLSGPLPQEIGNLKNLMELDLGTNSLIGPIPSTLGRLTNLNYMS 258 (471)
Q Consensus 179 L~~L~~L~L~~N~l~g~~p~~l~~l~~L~~L~L~~N~l~g~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~l~~L~~L~ 258 (471)
+++|++|+|++|.+++.+|..++++++|++|+|++|.+++.+|..++++++|++|++++|.+++.+|..++++++|+.|+
T Consensus 187 l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~ 266 (968)
T PLN00113 187 LTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLF 266 (968)
T ss_pred CcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEE
Confidence 88888888888888888888888888888888888888888888888888888888888888888888888888888888
Q ss_pred CCCCcCCCCCcccccCCCCCCEEeccCCcCcCCCchhhhcCCCCCcccCCCC
Q 042931 259 LSRNMFGGLLPQEIGNLKNLIELNVGSNSLIGPIPSTLGLLTDLSYLDLSCN 310 (471)
Q Consensus 259 L~~N~l~g~~p~~l~~l~~L~~L~L~~N~l~g~ip~~l~~l~~L~~L~l~~N 310 (471)
+++|.+++.+|..+.++++|++|++++|.+.+.+|..+..+++|+.|++++|
T Consensus 267 L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n 318 (968)
T PLN00113 267 LYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSN 318 (968)
T ss_pred CcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCC
Confidence 8888888888888888888999999888887766655544444444443333
|
|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer | Back alignment and domain information |
|---|
| >cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 | Back alignment and domain information |
|---|
| >cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes | Back alignment and domain information |
|---|
| >cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 | Back alignment and domain information |
|---|
| >cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0586 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha | Back alignment and domain information |
|---|
| >cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 | Back alignment and domain information |
|---|
| >cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 | Back alignment and domain information |
|---|
| >cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases | Back alignment and domain information |
|---|
| >cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 | Back alignment and domain information |
|---|
| >KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 | Back alignment and domain information |
|---|
| >cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 | Back alignment and domain information |
|---|
| >cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa | Back alignment and domain information |
|---|
| >cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase | Back alignment and domain information |
|---|
| >cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 | Back alignment and domain information |
|---|
| >KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] | Back alignment and domain information |
|---|
| >smart00219 TyrKc Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0589 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 | Back alignment and domain information |
|---|
| >KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl | Back alignment and domain information |
|---|
| >cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05122 PKc_STE Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PLN00009 cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase | Back alignment and domain information |
|---|
| >KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 | Back alignment and domain information |
|---|
| >smart00221 STYKc Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >PHA03390 pk1 serine/threonine-protein kinase 1; Provisional | Back alignment and domain information |
|---|
| >cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 | Back alignment and domain information |
|---|
| >cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 | Back alignment and domain information |
|---|
| >cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 | Back alignment and domain information |
|---|
| >KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein | Back alignment and domain information |
|---|
| >KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd00180 PKc Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >PRK10345 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain | Back alignment and domain information |
|---|
| >KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >PRK14879 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins | Back alignment and domain information |
|---|
| >KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10359 lipopolysaccharide core biosynthesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain | Back alignment and domain information |
|---|
| >KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] | Back alignment and domain information |
|---|
| >KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03724 arch_bud32 Kae1-associated kinase Bud32 | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0584 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated | Back alignment and domain information |
|---|
| >KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00090 RIO RIO-like kinase | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family | Back alignment and domain information |
|---|
| >PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02882 putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase | Back alignment and domain information |
|---|
| >cd05119 RIO RIO kinase family, catalytic domain | Back alignment and domain information |
|---|
| >KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed | Back alignment and domain information |
|---|
| >PRK12274 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd05151 ChoK Choline Kinase (ChoK) | Back alignment and domain information |
|---|
| >KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 | Back alignment and domain information |
|---|
| >KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 471 | ||||
| 3riz_A | 772 | Crystal Structure Of The Plant Steroid Receptor Bri | 5e-24 | ||
| 3rgx_A | 768 | Structural Insight Into Brassinosteroid Perception | 6e-24 | ||
| 1ogq_A | 313 | The Crystal Structure Of Pgip (Polygalacturonase In | 3e-18 | ||
| 1ogq_A | 313 | The Crystal Structure Of Pgip (Polygalacturonase In | 7e-07 | ||
| 3uim_A | 326 | Structural Basis For The Impact Of Phosphorylation | 5e-14 | ||
| 3tl8_A | 349 | The Avrptob-Bak1 Complex Reveals Two Structurally S | 2e-13 | ||
| 3hgk_A | 327 | Crystal Structure Of Effect Protein Avrptob Complex | 2e-11 | ||
| 2qkw_B | 321 | Structural Basis For Activation Of Plant Immunity B | 2e-11 | ||
| 4gs6_A | 315 | Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz | 8e-11 | ||
| 2eva_A | 307 | Structural Basis For The Interaction Of Tak1 Kinase | 1e-10 | ||
| 3coh_A | 268 | Crystal Structure Of Aurora-A In Complex With A Pen | 2e-09 | ||
| 2wtv_A | 285 | Aurora-A Inhibitor Structure Length = 285 | 7e-09 | ||
| 2bmc_A | 306 | Aurora-2 T287d T288d Complexed With Pha-680632 Leng | 7e-09 | ||
| 2j4z_A | 306 | Structure Of Aurora-2 In Complex With Pha-680626 Le | 8e-09 | ||
| 2wtw_A | 285 | Aurora-A Inhibitor Structure (2nd Crystal Form) Len | 8e-09 | ||
| 3daj_A | 272 | Crystal Structure Of Aurora A Complexed With An Inh | 9e-09 | ||
| 3d14_A | 272 | Crystal Structure Of Mouse Aurora A (Asn186->gly, L | 9e-09 | ||
| 2bfy_A | 284 | Complex Of Aurora-B With Incenp And Hesperidin. Len | 1e-08 | ||
| 3r21_A | 271 | Design, Synthesis, And Biological Evaluation Of Pyr | 1e-08 | ||
| 3qbn_A | 281 | Structure Of Human Aurora A In Complex With A Diami | 1e-08 | ||
| 2vrx_A | 285 | Structure Of Aurora B Kinase In Complex With Zm4474 | 1e-08 | ||
| 2bfx_B | 284 | Mechanism Of Aurora-B Activation By Incenp And Inhi | 1e-08 | ||
| 1muo_A | 297 | Crystal Structure Of Aurora-2, An Oncogenic Serine- | 1e-08 | ||
| 3h0y_A | 268 | Aurora A In Complex With A Bisanilinopyrimidine Len | 1e-08 | ||
| 2xne_A | 272 | Structure Of Aurora-A Bound To An Imidazopyrazine I | 1e-08 | ||
| 3o50_A | 267 | Crystal Structure Of Benzamide 9 Bound To Auroraa L | 1e-08 | ||
| 3e5a_A | 268 | Crystal Structure Of Aurora A In Complex With Vx-68 | 1e-08 | ||
| 1mq4_A | 272 | Crystal Structure Of Aurora-A Protein Kinase Length | 1e-08 | ||
| 3ha6_A | 268 | Crystal Structure Of Aurora A In Complex With Tpx2 | 1e-08 | ||
| 2j50_A | 280 | Structure Of Aurora-2 In Complex With Pha-739358 Le | 1e-08 | ||
| 2xru_A | 280 | Aurora-A T288e Complexed With Pha-828300 Length = 2 | 1e-08 | ||
| 2xng_A | 283 | Structure Of Aurora-A Bound To A Selective Imidazop | 1e-08 | ||
| 3nrm_A | 283 | Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito | 1e-08 | ||
| 3lau_A | 287 | Crystal Structure Of Aurora2 Kinase In Complex With | 1e-08 | ||
| 3unz_A | 279 | Aurora A In Complex With Rpm1679 Length = 279 | 1e-08 | ||
| 3fdn_A | 279 | Structure-Based Drug Design Of Novel Aurora Kinase | 1e-08 | ||
| 2x6d_A | 285 | Aurora-A Bound To An Inhibitor Length = 285 | 1e-08 | ||
| 2w1d_A | 275 | Structure Determination Of Aurora Kinase In Complex | 1e-08 | ||
| 1ol6_A | 282 | Structure Of Unphosphorylated D274n Mutant Of Auror | 1e-08 | ||
| 2w1c_A | 275 | Structure Determination Of Aurora Kinase In Complex | 1e-08 | ||
| 1ol5_A | 282 | Structure Of Aurora-A 122-403, Phosphorylated On Th | 1e-08 | ||
| 2c6d_A | 275 | Aurora A Kinase Activated Mutant (T287d) In Complex | 1e-08 | ||
| 2c6e_A | 283 | Aurora A Kinase Activated Mutant (T287d) In Complex | 1e-08 | ||
| 2dwb_A | 285 | Aurora-A Kinase Complexed With Amppnp Length = 285 | 1e-08 | ||
| 2wqe_A | 262 | Structure Of S155r Aurora-A Somatic Mutant Length = | 2e-08 | ||
| 4af3_A | 292 | Human Aurora B Kinase In Complex With Incenp And Vx | 4e-08 | ||
| 1ob3_A | 288 | Structure Of P. Falciparum Pfpk5 Length = 288 | 8e-08 | ||
| 1v0o_A | 288 | Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho | 8e-08 | ||
| 1v0b_A | 288 | Crystal Structure Of The T198a Mutant Of Pfpk5 Leng | 8e-08 | ||
| 2oib_A | 301 | Crystal Structure Of Irak4 Kinase Domain Apo Form L | 2e-07 | ||
| 2nry_A | 307 | Crystal Structure Of Irak-4 Length = 307 | 2e-07 | ||
| 2nru_A | 307 | Crystal Structure Of Irak-4 Length = 307 | 2e-07 | ||
| 1fot_A | 318 | Structure Of The Unliganded Camp-Dependent Protein | 2e-07 | ||
| 3dtc_A | 271 | Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp | 3e-07 | ||
| 4aqc_A | 301 | Triazolopyridine-Based Inhibitor Of Janus Kinase 2 | 8e-07 | ||
| 2qkr_A | 313 | Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 | 1e-06 | ||
| 3niz_A | 311 | Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 | 1e-06 | ||
| 2omt_A | 462 | Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt | 1e-06 | ||
| 3uto_A | 573 | Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- | 1e-06 | ||
| 2omu_A | 462 | Crystal Structure Of Inla G194s+s Y369s/hec1 Comple | 1e-06 | ||
| 1koa_A | 491 | Twitchin Kinase Fragment (C.Elegans), Autoregulated | 2e-06 | ||
| 2omx_A | 462 | Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX | 2e-06 | ||
| 3v5q_A | 297 | Discovery Of A Selective Trk Inhibitor With Efficac | 2e-06 | ||
| 1mqb_A | 333 | Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro | 2e-06 | ||
| 3p86_A | 309 | Crystal Structure Of Ctr1 Kinase Domain Mutant D676 | 2e-06 | ||
| 3rvg_A | 303 | Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido | 2e-06 | ||
| 3ppz_A | 309 | Crystal Structure Of Ctr1 Kinase Domain In Complex | 3e-06 | ||
| 4hge_A | 300 | Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 | 3e-06 | ||
| 2w1i_A | 326 | Structure Determination Of Aurora Kinase In Complex | 3e-06 | ||
| 3tjc_A | 298 | Co-Crystal Structure Of Jak2 With Thienopyridine 8 | 3e-06 | ||
| 3lpb_A | 295 | Crystal Structure Of Jak2 Complexed With A Potent 2 | 3e-06 | ||
| 3e62_A | 293 | Fragment Based Discovery Of Jak-2 Inhibitors Length | 3e-06 | ||
| 3ugc_A | 295 | Structural Basis Of Jak2 Inhibition By The Type Ii | 3e-06 | ||
| 3q32_A | 301 | Structure Of Janus Kinase 2 With A Pyrrolotriazine | 3e-06 | ||
| 2b7a_A | 293 | The Structural Basis Of Janus Kinase 2 Inhibition B | 3e-06 | ||
| 4e4m_A | 302 | Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 | 3e-06 | ||
| 3jy9_A | 311 | Janus Kinase 2 Inhibitors Length = 311 | 3e-06 | ||
| 3io7_A | 313 | 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel | 3e-06 | ||
| 4bbe_A | 298 | Aminoalkylpyrimidine Inhibitor Complexes With Jak2 | 3e-06 | ||
| 4b8c_D | 727 | Nuclease Module Of The Yeast Ccr4-Not Complex Lengt | 4e-06 | ||
| 4b8c_D | 727 | Nuclease Module Of The Yeast Ccr4-Not Complex Lengt | 2e-05 | ||
| 3miy_A | 266 | X-Ray Crystal Structure Of Itk Complexed With Sunit | 4e-06 | ||
| 1sm2_A | 264 | Crystal Structure Of The Phosphorylated Interleukin | 4e-06 | ||
| 2o8y_A | 298 | Apo Irak4 Kinase Domain Length = 298 | 4e-06 | ||
| 3v5j_A | 266 | Crystal Structure Of Interleukin-2 Inducible T-Cell | 4e-06 | ||
| 4hct_A | 269 | Crystal Structure Of Itk In Complex With Compound 5 | 4e-06 | ||
| 2omy_A | 461 | Crystal Structure Of Inla S192n/hec1 Complex Length | 5e-06 | ||
| 2jav_A | 279 | Human Kinase With Pyrrole-Indolinone Ligand Length | 5e-06 | ||
| 2w5a_A | 279 | Human Nek2 Kinase Adp-Bound Length = 279 | 5e-06 | ||
| 4a4x_A | 279 | Nek2-Ede Bound To Cct248662 Length = 279 | 5e-06 | ||
| 2omv_A | 461 | Crystal Structure Of Inla S192n Y369s/hec1 Complex | 5e-06 | ||
| 3rfs_A | 272 | Design Of A Binding Scaffold Based On Variable Lymp | 5e-06 | ||
| 2qof_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f | 6e-06 | ||
| 2gsf_A | 373 | The Human Epha3 Receptor Tyrosine Kinase And Juxtam | 6e-06 | ||
| 3qgw_A | 286 | Crystal Structure Of Itk Kinase Bound To An Inhibit | 6e-06 | ||
| 3fxx_A | 371 | Human Epha3 Kinase And Juxtamembrane Region Bound T | 6e-06 | ||
| 2r2p_A | 295 | Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep | 6e-06 | ||
| 2xa4_A | 298 | Inhibitors Of Jak2 Kinase Domain Length = 298 | 7e-06 | ||
| 4f0i_A | 300 | Crystal Structure Of Apo Trka Length = 300 | 9e-06 | ||
| 4gt5_A | 306 | Crystal Structure Of The Inactive Trka Kinase Domai | 9e-06 | ||
| 4e6d_A | 298 | Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W | 1e-05 | ||
| 4f1m_A | 287 | Crystal Structure Of The G1179s Roco4 Kinase Domain | 1e-05 | ||
| 4aoj_A | 329 | Human Trka In Complex With The Inhibitor Az-23 Leng | 1e-05 | ||
| 3a62_A | 327 | Crystal Structure Of Phosphorylated P70s6k1 Length | 1e-05 | ||
| 3a60_A | 327 | Crystal Structure Of Unphosphorylated P70s6k1 (Form | 1e-05 | ||
| 3dzq_A | 361 | Human Epha3 Kinase Domain In Complex With Inhibitor | 1e-05 | ||
| 2qoc_A | 344 | Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp | 1e-05 | ||
| 4f0f_A | 287 | Crystal Structure Of The Roco4 Kinase Domain Bound | 1e-05 | ||
| 2qoo_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 1e-05 | ||
| 4f1o_A | 287 | Crystal Structure Of The L1180t Mutant Roco4 Kinase | 1e-05 | ||
| 2qoi_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 1e-05 | ||
| 2qol_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596:y | 1e-05 | ||
| 2qok_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 1e-05 | ||
| 2qod_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y602f | 1e-05 | ||
| 3cd3_A | 377 | Crystal Structure Of Phosphorylated Human Feline Sa | 1e-05 | ||
| 1o6s_A | 466 | Internalin (Listeria Monocytogenes) E-Cadherin (Hum | 1e-05 | ||
| 3bkb_A | 377 | Crystal Structure Of Human Feline Sarcoma Viral Onc | 1e-05 | ||
| 3e6j_A | 229 | Crystal Structure Of Variable Lymphocyte Receptor ( | 2e-05 | ||
| 3t9t_A | 267 | Crystal Structure Of Btk Mutant (F435t,K596r) Compl | 2e-05 | ||
| 1opk_A | 495 | Structural Basis For The Auto-Inhibition Of C-Abl T | 2e-05 | ||
| 2omz_A | 466 | Crystal Structure Of Inla Y369a/hec1 Complex Length | 2e-05 | ||
| 2fo0_A | 495 | Organization Of The Sh3-Sh2 Unit In Active And Inac | 2e-05 | ||
| 3omv_A | 307 | Crystal Structure Of C-Raf (Raf-1) Length = 307 | 2e-05 | ||
| 1opl_A | 537 | Structural Basis For The Auto-Inhibition Of C-Abl T | 2e-05 | ||
| 3qrj_A | 277 | The Crystal Structure Of Human Abl1 Kinase Domain T | 3e-05 | ||
| 2v7a_A | 286 | Crystal Structure Of The T315i Abl Mutant In Comple | 3e-05 | ||
| 2f4j_A | 287 | Structure Of The Kinase Domain Of An Imatinib-Resis | 3e-05 | ||
| 3dk7_A | 277 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 3e-05 | ||
| 2gqg_A | 278 | X-Ray Crystal Structure Of Dasatinib (Bms-354825) B | 3e-05 | ||
| 1fpu_A | 293 | Crystal Structure Of Abl Kinase Domain In Complex W | 3e-05 | ||
| 3qri_A | 277 | The Crystal Structure Of Human Abl1 Kinase Domain I | 3e-05 | ||
| 3c4c_A | 280 | B-Raf Kinase In Complex With Plx4720 Length = 280 | 3e-05 | ||
| 2g2f_A | 287 | A Src-Like Inactive Conformation In The Abl Tyrosin | 3e-05 | ||
| 2e2b_A | 293 | Crystal Structure Of The C-Abl Kinase Domain In Com | 3e-05 | ||
| 2hel_A | 306 | Crystal Structure Of A Mutant Epha4 Kinase Domain ( | 3e-05 | ||
| 4fk3_A | 292 | B-Raf Kinase V600e Oncogenic Mutant In Complex With | 3e-05 | ||
| 2hzi_A | 277 | Abl Kinase Domain In Complex With Pd180970 Length = | 3e-05 | ||
| 4asz_A | 299 | Crystal Structure Of Apo Trkb Kinase Domain Length | 3e-05 | ||
| 2z60_A | 288 | Crystal Structure Of The T315i Mutant Of Abl Kinase | 3e-05 | ||
| 3oy3_A | 284 | Crystal Structure Of Abl T315i Mutant Kinase Domain | 3e-05 | ||
| 3dk3_A | 293 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 3e-05 | ||
| 3k54_A | 283 | Structures Of Human Bruton's Tyrosine Kinase In Act | 3e-05 | ||
| 2hiw_A | 287 | Crystal Structure Of Inactive Conformation Abl Kina | 3e-05 | ||
| 1luf_A | 343 | Crystal Structure Of The Musk Tyrosine Kinase: Insi | 3e-05 | ||
| 2o6q_A | 270 | Structural Diversity Of The Hagfish Variable Lympho | 3e-05 | ||
| 2hyy_A | 273 | Human Abl Kinase Domain In Complex With Imatinib (S | 3e-05 | ||
| 3oxz_A | 284 | Crystal Structure Of Abl Kinase Domain Bound With A | 4e-05 | ||
| 3gen_A | 283 | The 1.6 A Crystal Structure Of Human Bruton's Tyros | 4e-05 | ||
| 2qoh_A | 288 | Crystal Structure Of Abl Kinase Bound With Ppy-a Le | 4e-05 | ||
| 2hz0_A | 270 | Abl Kinase Domain In Complex With Nvp-Aeg082 Length | 4e-05 | ||
| 2g1t_A | 287 | A Src-Like Inactive Conformation In The Abl Tyrosin | 4e-05 | ||
| 3pyy_A | 298 | Discovery And Characterization Of A Cell-Permeable, | 4e-05 | ||
| 2xyu_A | 285 | Crystal Structure Of Epha4 Kinase Domain In Complex | 4e-05 | ||
| 3p08_A | 267 | Crystal Structure Of The Human Btk Kinase Domain Le | 4e-05 | ||
| 3oct_A | 265 | Crystal Structure Of Bruton's Tyrosine Kinase Mutan | 4e-05 | ||
| 3ocs_A | 271 | Crystal Structure Of Bruton's Tyrosine Kinase In Co | 4e-05 | ||
| 3pix_A | 274 | Crystal Structure Of Btk Kinase Domain Complexed Wi | 4e-05 | ||
| 1k2p_A | 263 | Crystal Structure Of Bruton's Tyrosine Kinase Domai | 4e-05 | ||
| 2y6m_A | 291 | Crystal Structure Of Epha4 Kinase Domain Length = 2 | 5e-05 | ||
| 2qo7_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Dephos | 5e-05 | ||
| 4aw2_A | 437 | Crystal Structure Of Cdc42 Binding Protein Kinase A | 5e-05 | ||
| 3gvu_A | 292 | The Crystal Structure Of Human Abl2 In Complex With | 5e-05 | ||
| 2j51_A | 325 | Crystal Structure Of Human Ste20-Like Kinase Bound | 6e-05 | ||
| 2jfm_A | 325 | Crystal Structure Of Human Ste20-Like Kinase (Unlig | 6e-05 | ||
| 2jfl_A | 325 | Crystal Structure Of Human Ste20-Like Kinase ( Diph | 6e-05 | ||
| 3og7_A | 289 | B-Raf Kinase V600e Oncogenic Mutant In Complex With | 6e-05 | ||
| 2rei_A | 318 | Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep | 6e-05 | ||
| 4eqm_A | 294 | Structural Analysis Of Staphylococcus Aureus Serine | 7e-05 | ||
| 3m19_A | 251 | Crystal Structure Of Variable Lymphocyte Receptor V | 8e-05 | ||
| 1jpa_A | 312 | Crystal Structure Of Unphosphorylated Ephb2 Recepto | 8e-05 | ||
| 3m18_A | 251 | Crystal Structure Of Variable Lymphocyte Receptor V | 8e-05 | ||
| 3gbz_A | 329 | Structure Of The Cmgc Cdk Kinase From Giardia Lambl | 8e-05 | ||
| 2qob_A | 344 | Human Epha3 Kinase Domain, Base Structure Length = | 9e-05 | ||
| 2qon_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 9e-05 | ||
| 2hen_A | 286 | Crystal Structure Of The Ephb2 Receptor Kinase Doma | 9e-05 | ||
| 3dk6_A | 293 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 9e-05 | ||
| 3kul_B | 325 | Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep | 1e-04 | ||
| 2fb8_A | 281 | Structure Of The B-Raf Kinase Domain Bound To Sb-59 | 1e-04 | ||
| 4dbn_A | 284 | Crystal Structure Of The Kinase Domain Of Human B-R | 1e-04 | ||
| 3ku2_A | 507 | Crystal Structure Of Inactivated Form Of Cdpk1 From | 1e-04 | ||
| 4h58_A | 275 | Braf In Complex With Compound 3 Length = 275 | 1e-04 | ||
| 3q96_A | 282 | B-Raf Kinase Domain In Complex With A Tetrahydronap | 1e-04 | ||
| 3hx4_A | 508 | Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg | 1e-04 | ||
| 3i79_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 1e-04 | ||
| 1uwj_A | 276 | The Complex Of Mutant V599e B-raf And Bay439006 Len | 1e-04 | ||
| 3kul_A | 325 | Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep | 1e-04 | ||
| 3d4q_A | 307 | Pyrazole-Based Inhibitors Of B-Raf Kinase Length = | 1e-04 | ||
| 3ii5_A | 306 | The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi | 1e-04 | ||
| 3idp_A | 300 | B-Raf V600e Kinase Domain In Complex With An Aminoi | 1e-04 | ||
| 4g9r_A | 307 | B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr | 1e-04 | ||
| 4fnw_A | 327 | Crystal Structure Of The Apo F1174l Anaplastic Lymp | 1e-04 | ||
| 2yjr_A | 342 | Structure Of F1174l Mutant Anaplastic Lymphoma Kina | 2e-04 | ||
| 2vwu_A | 302 | Ephb4 Kinase Domain Inhibitor Complex Length = 302 | 2e-04 | ||
| 2uv2_A | 287 | Crystal Structure Of Human Ste20-Like Kinase Bound | 2e-04 | ||
| 3ma6_A | 298 | Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr | 2e-04 | ||
| 4aw5_A | 291 | Complex Of The Ephb4 Kinase Domain With An Oxindole | 2e-04 | ||
| 3v47_A | 455 | Crystal Structure Of The N-Tetminal Fragment Of Zeb | 2e-04 | ||
| 3q5i_A | 504 | Crystal Structure Of Pbanka_031420 Length = 504 | 2e-04 | ||
| 1zy4_A | 303 | Crystal Structure Of Eif2alpha Protein Kinase Gcn2: | 2e-04 | ||
| 1uwh_A | 276 | The Complex Of Wild Type B-Raf And Bay439006 Length | 2e-04 | ||
| 2y94_A | 476 | Structure Of An Active Form Of Mammalian Ampk Lengt | 2e-04 | ||
| 3a4o_X | 286 | Lyn Kinase Domain Length = 286 | 2e-04 | ||
| 4fnx_A | 327 | Crystal Structure Of The Apo R1275q Anaplastic Lymp | 2e-04 | ||
| 4aaa_A | 331 | Crystal Structure Of The Human Cdkl2 Kinase Domain | 2e-04 | ||
| 4fnz_A | 327 | Crystal Structure Of Human Anaplastic Lymphoma Kina | 2e-04 | ||
| 2yfx_A | 327 | Structure Of L1196m Mutant Anaplastic Lymphoma Kina | 2e-04 | ||
| 3i7c_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 2e-04 | ||
| 2yhv_A | 342 | Structure Of L1196m Mutant Anaplastic Lymphoma Kina | 2e-04 | ||
| 2xb7_A | 315 | Structure Of Human Anaplastic Lymphoma Kinase In Co | 2e-04 | ||
| 2xp2_A | 327 | Structure Of The Human Anaplastic Lymphoma Kinase I | 2e-04 | ||
| 4dce_A | 333 | Crystal Structure Of Human Anaplastic Lymphoma Kina | 2e-04 | ||
| 2yjs_A | 342 | Structure Of C1156y Mutant Anaplastic Lymphoma Kina | 3e-04 | ||
| 3l9p_A | 367 | Crystal Structure Of The Anaplastic Lymphoma Kinase | 3e-04 | ||
| 3aox_A | 344 | X-Ray Crystal Structure Of Human Anaplastic Lymphom | 3e-04 | ||
| 3lct_A | 344 | Crystal Structure Of The Anaplastic Lymphoma Kinase | 3e-04 | ||
| 4fob_A | 353 | Crystal Structure Of Human Anaplastic Lymphoma Kina | 3e-04 | ||
| 2x4f_A | 373 | The Crystal Structure Of The Human Myosin Light Cha | 3e-04 | ||
| 3dxn_A | 287 | Crystal Structure Of The Calcium-dependent Kinase F | 3e-04 | ||
| 2f2u_A | 402 | Crystal Structure Of The Rho-Kinase Kinase Domain L | 3e-04 | ||
| 4bc6_A | 293 | Crystal Structure Of Human Serine Threonine Kinase- | 4e-04 | ||
| 3tku_A | 433 | Mrck Beta In Complex With Fasudil Length = 433 | 4e-04 | ||
| 3qfv_A | 415 | Mrck Beta In Complex With Tpca-1 Length = 415 | 4e-04 | ||
| 2bdw_A | 362 | Crystal Structure Of The Auto-Inhibited Kinase Doma | 4e-04 | ||
| 3hzt_A | 467 | Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 | 5e-04 | ||
| 3com_A | 314 | Crystal Structure Of Mst1 Kinase Length = 314 | 5e-04 | ||
| 2j7t_A | 302 | Crystal Structure Of Human Serine Threonine Kinase- | 5e-04 | ||
| 2o6s_A | 208 | Structural Diversity Of The Hagfish Variable Lympho | 5e-04 | ||
| 4eoj_A | 302 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma | 6e-04 | ||
| 4eok_A | 300 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma | 6e-04 | ||
| 2iw6_A | 302 | Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com | 6e-04 | ||
| 1h1p_A | 303 | Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP | 6e-04 | ||
| 2iw8_A | 302 | Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 | 6e-04 | ||
| 4eom_A | 301 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum | 6e-04 | ||
| 3a79_B | 562 | Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len | 6e-04 | ||
| 4eop_A | 300 | Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 | 6e-04 | ||
| 4eoi_A | 299 | Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc | 6e-04 | ||
| 1ogu_A | 302 | Structure Of Human Thr160-phospho Cdk2/cyclin A Com | 6e-04 | ||
| 4erw_A | 306 | Cdk2 In Complex With Staurosporine Length = 306 | 6e-04 | ||
| 2id5_A | 477 | Crystal Structure Of The Lingo-1 Ectodomain Length | 6e-04 | ||
| 4eos_A | 300 | Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co | 6e-04 | ||
| 4eoq_A | 301 | Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co | 6e-04 | ||
| 4eon_A | 300 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum | 6e-04 | ||
| 4bcq_A | 301 | Structure Of Cdk2 In Complex With Cyclin A And A 2- | 6e-04 | ||
| 1e9h_A | 297 | Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex | 6e-04 | ||
| 3ezr_A | 300 | Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ | 6e-04 | ||
| 4eoo_A | 299 | Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 | 6e-04 | ||
| 1gz8_A | 299 | Human Cyclin Dependent Kinase 2 Complexed With The | 6e-04 | ||
| 1vzo_A | 355 | The Structure Of The N-Terminal Kinase Domain Of Ms | 6e-04 | ||
| 1w98_A | 298 | The Structural Basis Of Cdk2 Activation By Cyclin E | 6e-04 | ||
| 3bht_A | 300 | Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN | 6e-04 | ||
| 1qmz_A | 299 | Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com | 7e-04 | ||
| 1vyw_A | 309 | Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = | 7e-04 | ||
| 1pf8_A | 298 | Crystal Structure Of Human Cyclin-dependent Kinase | 7e-04 | ||
| 3pxf_A | 306 | Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N | 7e-04 | ||
| 1oit_A | 299 | Imidazopyridines: A Potent And Selective Class Of C | 7e-04 | ||
| 2jgz_A | 289 | Crystal Structure Of Phospho-Cdk2 In Complex With C | 7e-04 | ||
| 2w17_A | 299 | Cdk2 In Complex With The Imidazole Pyrimidine Amide | 7e-04 | ||
| 3pj8_A | 299 | Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] | 7e-04 | ||
| 1fin_A | 298 | Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = | 7e-04 | ||
| 1jst_A | 298 | Phosphorylated Cyclin-Dependent Kinase-2 Bound To C | 7e-04 | ||
| 4i3z_A | 296 | Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES | 7e-04 | ||
| 3qhr_A | 298 | Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic | 7e-04 | ||
| 2w96_B | 306 | Crystal Structure Of Cdk4 In Complex With A D-Type | 8e-04 | ||
| 2zv7_A | 279 | Lyn Tyrosine Kinase Domain, Apo Form Length = 279 | 8e-04 | ||
| 2vd5_A | 412 | Structure Of Human Myotonic Dystrophy Protein Kinas | 8e-04 | ||
| 1bi8_A | 326 | Mechanism Of G1 Cyclin Dependent Kinase Inhibition | 8e-04 | ||
| 2w99_B | 306 | Crystal Structure Of Cdk4 In Complex With A D-Type | 8e-04 | ||
| 3kl8_A | 269 | Camkiintide Inhibitor Complex Length = 269 | 9e-04 | ||
| 3kk8_A | 284 | Camkii Substrate Complex A Length = 284 | 9e-04 | ||
| 3cok_A | 278 | Crystal Structure Of Plk4 Kinase Length = 278 | 9e-04 | ||
| 2hak_A | 328 | Catalytic And Ubiqutin-Associated Domains Of Mark1P | 9e-04 |
| >pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 | Back alignment and structure |
|
| >pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 | Back alignment and structure |
| >pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 | Back alignment and structure |
| >pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 | Back alignment and structure |
| >pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 | Back alignment and structure |
| >pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 | Back alignment and structure |
| >pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 | Back alignment and structure |
| >pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 | Back alignment and structure |
| >pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 | Back alignment and structure |
| >pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 | Back alignment and structure |
| >pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 | Back alignment and structure |
| >pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 | Back alignment and structure |
| >pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 | Back alignment and structure |
| >pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 | Back alignment and structure |
| >pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 | Back alignment and structure |
| >pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 | Back alignment and structure |
| >pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 | Back alignment and structure |
| >pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 | Back alignment and structure |
| >pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 | Back alignment and structure |
| >pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 | Back alignment and structure |
| >pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 | Back alignment and structure |
| >pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 | Back alignment and structure |
| >pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 | Back alignment and structure |
| >pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 | Back alignment and structure |
| >pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 | Back alignment and structure |
| >pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 | Back alignment and structure |
| >pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 | Back alignment and structure |
| >pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 | Back alignment and structure |
| >pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 | Back alignment and structure |
| >pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 | Back alignment and structure |
| >pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 | Back alignment and structure |
| >pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 | Back alignment and structure |
| >pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 | Back alignment and structure |
| >pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 | Back alignment and structure |
| >pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 | Back alignment and structure |
| >pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 | Back alignment and structure |
| >pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 | Back alignment and structure |
| >pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 | Back alignment and structure |
| >pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 | Back alignment and structure |
| >pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 | Back alignment and structure |
| >pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 | Back alignment and structure |
| >pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 | Back alignment and structure |
| >pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 | Back alignment and structure |
| >pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 | Back alignment and structure |
| >pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 | Back alignment and structure |
| >pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 | Back alignment and structure |
| >pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 | Back alignment and structure |
| >pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 | Back alignment and structure |
| >pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 | Back alignment and structure |
| >pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 | Back alignment and structure |
| >pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 | Back alignment and structure |
| >pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 | Back alignment and structure |
| >pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 | Back alignment and structure |
| >pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 | Back alignment and structure |
| >pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 | Back alignment and structure |
| >pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 | Back alignment and structure |
| >pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 | Back alignment and structure |
| >pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 | Back alignment and structure |
| >pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 | Back alignment and structure |
| >pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 | Back alignment and structure |
| >pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 | Back alignment and structure |
| >pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 | Back alignment and structure |
| >pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 | Back alignment and structure |
| >pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 | Back alignment and structure |
| >pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 | Back alignment and structure |
| >pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 | Back alignment and structure |
| >pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 | Back alignment and structure |
| >pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 | Back alignment and structure |
| >pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 | Back alignment and structure |
| >pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 | Back alignment and structure |
| >pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 | Back alignment and structure |
| >pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 | Back alignment and structure |
| >pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 | Back alignment and structure |
| >pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 | Back alignment and structure |
| >pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 | Back alignment and structure |
| >pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 | Back alignment and structure |
| >pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 | Back alignment and structure |
| >pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 | Back alignment and structure |
| >pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 | Back alignment and structure |
| >pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 | Back alignment and structure |
| >pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 | Back alignment and structure |
| >pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 | Back alignment and structure |
| >pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 | Back alignment and structure |
| >pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 | Back alignment and structure |
| >pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 | Back alignment and structure |
| >pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 | Back alignment and structure |
| >pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 | Back alignment and structure |
| >pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 | Back alignment and structure |
| >pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 | Back alignment and structure |
| >pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 | Back alignment and structure |
| >pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 | Back alignment and structure |
| >pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 | Back alignment and structure |
| >pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 | Back alignment and structure |
| >pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 | Back alignment and structure |
| >pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 | Back alignment and structure |
| >pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 | Back alignment and structure |
| >pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 | Back alignment and structure |
| >pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 | Back alignment and structure |
| >pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 | Back alignment and structure |
| >pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 | Back alignment and structure |
| >pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 | Back alignment and structure |
| >pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 | Back alignment and structure |
| >pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 | Back alignment and structure |
| >pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 | Back alignment and structure |
| >pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 | Back alignment and structure |
| >pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 | Back alignment and structure |
| >pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 | Back alignment and structure |
| >pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 | Back alignment and structure |
| >pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 | Back alignment and structure |
| >pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 | Back alignment and structure |
| >pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 | Back alignment and structure |
| >pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 | Back alignment and structure |
| >pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 | Back alignment and structure |
| >pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 | Back alignment and structure |
| >pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 | Back alignment and structure |
| >pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 | Back alignment and structure |
| >pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 | Back alignment and structure |
| >pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 | Back alignment and structure |
| >pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 | Back alignment and structure |
| >pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 | Back alignment and structure |
| >pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 | Back alignment and structure |
| >pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 | Back alignment and structure |
| >pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 | Back alignment and structure |
| >pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 | Back alignment and structure |
| >pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 | Back alignment and structure |
| >pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 | Back alignment and structure |
| >pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 | Back alignment and structure |
| >pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 | Back alignment and structure |
| >pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 | Back alignment and structure |
| >pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 | Back alignment and structure |
| >pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 | Back alignment and structure |
| >pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 | Back alignment and structure |
| >pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 | Back alignment and structure |
| >pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 | Back alignment and structure |
| >pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 | Back alignment and structure |
| >pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 | Back alignment and structure |
| >pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 | Back alignment and structure |
| >pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 | Back alignment and structure |
| >pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 | Back alignment and structure |
| >pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 | Back alignment and structure |
| >pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 | Back alignment and structure |
| >pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 | Back alignment and structure |
| >pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 | Back alignment and structure |
| >pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 | Back alignment and structure |
| >pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 | Back alignment and structure |
| >pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 | Back alignment and structure |
| >pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 | Back alignment and structure |
| >pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 | Back alignment and structure |
| >pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 | Back alignment and structure |
| >pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 | Back alignment and structure |
| >pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 | Back alignment and structure |
| >pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 | Back alignment and structure |
| >pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 | Back alignment and structure |
| >pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 | Back alignment and structure |
| >pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 | Back alignment and structure |
| >pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 | Back alignment and structure |
| >pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 | Back alignment and structure |
| >pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 | Back alignment and structure |
| >pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 | Back alignment and structure |
| >pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 | Back alignment and structure |
| >pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 | Back alignment and structure |
| >pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 | Back alignment and structure |
| >pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 | Back alignment and structure |
| >pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 | Back alignment and structure |
| >pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 | Back alignment and structure |
| >pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 | Back alignment and structure |
| >pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 | Back alignment and structure |
| >pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 | Back alignment and structure |
| >pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 | Back alignment and structure |
| >pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 | Back alignment and structure |
| >pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 | Back alignment and structure |
| >pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 | Back alignment and structure |
| >pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 | Back alignment and structure |
| >pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 | Back alignment and structure |
| >pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 | Back alignment and structure |
| >pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 | Back alignment and structure |
| >pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 | Back alignment and structure |
| >pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 | Back alignment and structure |
| >pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 | Back alignment and structure |
| >pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 | Back alignment and structure |
| >pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 | Back alignment and structure |
| >pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 | Back alignment and structure |
| >pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 | Back alignment and structure |
| >pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 | Back alignment and structure |
| >pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 | Back alignment and structure |
| >pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 | Back alignment and structure |
| >pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 | Back alignment and structure |
| >pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 | Back alignment and structure |
| >pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 | Back alignment and structure |
| >pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 | Back alignment and structure |
| >pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 | Back alignment and structure |
| >pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 | Back alignment and structure |
| >pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 | Back alignment and structure |
| >pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 | Back alignment and structure |
| >pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 | Back alignment and structure |
| >pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 | Back alignment and structure |
| >pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 | Back alignment and structure |
| >pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 | Back alignment and structure |
| >pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 | Back alignment and structure |
| >pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 | Back alignment and structure |
| >pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 | Back alignment and structure |
| >pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 | Back alignment and structure |
| >pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 | Back alignment and structure |
| >pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 | Back alignment and structure |
| >pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 | Back alignment and structure |
| >pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 | Back alignment and structure |
| >pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 | Back alignment and structure |
| >pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 | Back alignment and structure |
| >pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 | Back alignment and structure |
| >pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 | Back alignment and structure |
| >pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 | Back alignment and structure |
| >pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 | Back alignment and structure |
| >pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 | Back alignment and structure |
| >pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 | Back alignment and structure |
| >pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 | Back alignment and structure |
| >pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 | Back alignment and structure |
| >pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 | Back alignment and structure |
| >pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 | Back alignment and structure |
| >pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 | Back alignment and structure |
| >pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 | Back alignment and structure |
| >pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 | Back alignment and structure |
| >pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 | Back alignment and structure |
| >pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 | Back alignment and structure |
| >pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 | Back alignment and structure |
| >pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 | Back alignment and structure |
| >pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 | Back alignment and structure |
| >pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 | Back alignment and structure |
| >pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 | Back alignment and structure |
| >pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 | Back alignment and structure |
| >pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 | Back alignment and structure |
| >pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 | Back alignment and structure |
| >pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 | Back alignment and structure |
| >pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 | Back alignment and structure |
| >pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 | Back alignment and structure |
| >pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 | Back alignment and structure |
| >pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 | Back alignment and structure |
| >pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 | Back alignment and structure |
| >pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 | Back alignment and structure |
| >pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 | Back alignment and structure |
| >pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 | Back alignment and structure |
| >pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 | Back alignment and structure |
| >pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 | Back alignment and structure |
| >pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 | Back alignment and structure |
| >pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 | Back alignment and structure |
| >pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 | Back alignment and structure |
| >pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 | Back alignment and structure |
| >pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 | Back alignment and structure |
| >pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 | Back alignment and structure |
| >pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 | Back alignment and structure |
| >pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 | Back alignment and structure |
| >pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
Score = 238 bits (610), Expect = 2e-75
Identities = 75/248 (30%), Positives = 120/248 (48%), Gaps = 14/248 (5%)
Query: 83 WTANYSSDHCKWIGFTCNSAG---SIIGLHLSRD--YGSFEEPVQLSQLNFSCFPNLENL 137
W + W+G C++ + L LS + P L+ L P L L
Sbjct: 27 WLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANL-----PYLNFL 81
Query: 138 TFQSFP-LAGSIPPEISALSKLQRLDLSSNRLTGSIPSEIGNLRNLVYLNISKNILTGTV 196
L G IPP I+ L++L L ++ ++G+IP + ++ LV L+ S N L+GT+
Sbjct: 82 YIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTL 141
Query: 197 PSTLGSLTNLKNMGLSYNQLSGPLPQEIGNLKNLME-LDLGTNSLIGPIPSTLGRLTNLN 255
P ++ SL NL + N++SG +P G+ L + + N L G IP T L NL
Sbjct: 142 PPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL-NLA 200
Query: 256 YMSLSRNMFGGLLPQEIGNLKNLIELNVGSNSLIGPIPSTLGLLTDLSYLDLSCNQFSSS 315
++ LSRNM G G+ KN ++++ NSL + +GL +L+ LDL N+ +
Sbjct: 201 FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGK-VGLSKNLNGLDLRNNRIYGT 259
Query: 316 IPNDTTKL 323
+P T+L
Sbjct: 260 LPQGLTQL 267
|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 | Back alignment and structure |
|---|
| >4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 | Back alignment and structure |
|---|
| >3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 | Back alignment and structure |
|---|
| >3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 | Back alignment and structure |
|---|
| >1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 | Back alignment and structure |
|---|
| >3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 471 | |||
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 100.0 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 100.0 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 100.0 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 100.0 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.97 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.96 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.96 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.96 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.95 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.94 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.94 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.94 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.94 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.93 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.93 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.93 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.93 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.92 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.92 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.92 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.92 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.92 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.91 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.91 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.91 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.91 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.91 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.91 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.91 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.9 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.9 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.9 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.9 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.9 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.9 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.9 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.9 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.9 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.9 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.9 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.9 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.89 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.89 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.89 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.89 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.89 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.89 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.89 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.89 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.89 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.88 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.88 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.88 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.88 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.88 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.88 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.88 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.88 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.88 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.88 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.88 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.88 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.87 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.87 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.87 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.87 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.86 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.86 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.86 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.86 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.85 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.85 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.85 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.84 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.84 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.84 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.84 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.84 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.83 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.83 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.83 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.83 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.83 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.83 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.83 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.83 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.82 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.82 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.82 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.82 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.81 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.81 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.81 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.81 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.81 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.81 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.8 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.79 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.79 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.78 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.78 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 99.78 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.78 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.78 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.78 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.77 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.77 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 99.77 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.77 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.76 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.76 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 99.76 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.76 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.75 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.75 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.74 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.73 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.72 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.72 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.72 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.72 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.71 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 99.7 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.7 | |
| 3hmm_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.69 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.69 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.68 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.68 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.68 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 99.67 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.66 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.66 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 99.65 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 99.65 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 99.63 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.63 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.63 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.62 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 99.61 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 99.6 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 99.59 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.59 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.59 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.58 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 99.54 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.54 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.54 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 99.53 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.52 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.51 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 99.49 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 99.49 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 99.47 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.47 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 99.46 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 99.45 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 99.45 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 99.44 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 99.44 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 99.43 | |
| 4hcu_A | 269 | Tyrosine-protein kinase ITK/TSK; transferase-trans | 99.42 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 99.42 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.42 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 99.41 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 99.41 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 99.41 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 99.4 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 99.4 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 99.4 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 99.39 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 99.39 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 99.39 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.39 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.38 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.38 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.38 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 99.38 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 99.38 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.37 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 99.37 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 99.37 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 99.37 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 99.37 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 99.37 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 99.37 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 99.37 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 99.36 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 99.36 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 99.36 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 99.36 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.36 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 99.36 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 99.36 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 99.36 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 99.36 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 99.35 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 99.35 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 99.35 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 99.35 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 99.35 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 99.35 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.35 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 99.35 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 99.35 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 99.35 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 99.34 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 99.34 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 99.34 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 99.34 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 99.34 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.34 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 99.34 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 99.34 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 99.34 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.34 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 99.33 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 99.33 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 99.33 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 99.33 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 99.33 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 99.33 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 99.33 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 99.33 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 99.33 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.33 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 99.33 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 99.33 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.33 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 99.32 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 99.32 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.32 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 99.32 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 99.32 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 99.32 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 99.32 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 99.32 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 99.31 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 99.31 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 99.31 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 99.31 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 99.31 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.31 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 99.31 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 99.31 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 99.31 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 99.31 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 99.31 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 99.31 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.31 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 99.3 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 99.3 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 99.3 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.3 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 99.3 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.3 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 99.3 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 99.3 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 99.29 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 99.29 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 99.29 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 99.29 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 99.29 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 99.29 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 99.29 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 99.28 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 99.28 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 99.28 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.28 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 99.28 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 99.28 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 99.28 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 99.28 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 99.28 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 99.28 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 99.27 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 99.27 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 99.27 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 99.27 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 99.27 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.27 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 99.27 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 99.26 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 99.26 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 99.26 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 99.26 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 99.26 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 99.26 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 99.26 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.26 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 99.26 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 99.26 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 99.25 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 99.25 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.25 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 99.25 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 99.25 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 99.25 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 99.25 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.25 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 99.25 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 99.25 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 99.24 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 99.24 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 99.24 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 99.23 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 99.23 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 99.22 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.22 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 99.22 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 99.22 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 99.22 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.21 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 99.21 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 99.21 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 99.21 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 99.21 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 99.2 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 99.2 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 99.2 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 99.2 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 99.2 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.2 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.19 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 99.19 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 99.19 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 99.19 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 99.18 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 99.18 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 99.18 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.18 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 99.18 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.18 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 99.18 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 99.17 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 99.17 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 99.17 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 99.17 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 99.16 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 99.16 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 99.15 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 99.15 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 99.15 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 99.14 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 99.14 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 99.14 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 99.14 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 99.13 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 99.13 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 99.13 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 99.12 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 99.11 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 99.11 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 99.11 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 99.11 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 99.1 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 99.1 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 99.1 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 99.1 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 99.1 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 99.09 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 99.08 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 99.08 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 99.08 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 99.08 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 99.07 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 99.06 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 99.06 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 99.06 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 99.06 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 99.06 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 99.06 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 99.06 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 99.05 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 99.05 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 99.04 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 99.04 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 99.03 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 99.02 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 99.01 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 99.01 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 99.01 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 99.0 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 99.0 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 98.99 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 98.99 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 98.97 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 98.97 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.95 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 98.95 | |
| 4hgt_A | 296 | Casein kinase I isoform delta; CK1D, inhibitor, tr | 98.94 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 98.93 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.92 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 98.92 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 98.9 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.9 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 98.88 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 98.88 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.86 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 98.85 | |
| 1zar_A | 282 | RIO2 kinase; serine kinase, winged-helix, RIO doma | 98.73 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 98.55 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.53 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.44 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.43 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 98.31 | |
| 1zth_A | 258 | RIO1 serine protein kinase; ribosome biogenesis, r | 98.2 | |
| 4gyi_A | 397 | RIO2 kinase; protein kinase, ADP complex, phosphoa | 97.84 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 97.74 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.53 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 97.49 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.49 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 97.41 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 97.28 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 97.2 | |
| 1nd4_A | 264 | Aminoglycoside 3'-phosphotransferase; protein kina | 97.19 | |
| 3tm0_A | 263 | Aminoglycoside 3'-phosphotransferase; protein kina | 97.18 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 97.13 | |
| 3d1u_A | 288 | Putative fructosamine-3-kinase; YP_290396.1, struc | 96.86 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.74 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 96.5 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.46 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 96.18 | |
| 3dxp_A | 359 | Putative acyl-COA dehydrogenase; protein kinase-li | 95.52 | |
| 3jr1_A | 312 | Putative fructosamine-3-kinase; YP_719053.1, struc | 93.0 | |
| 3f7w_A | 288 | Putative fructosamine-3-kinase; YP_290396.1, struc | 91.86 | |
| 4gkh_A | 272 | Aminoglycoside 3'-phosphotransferase APHA1-IAB; py | 90.99 | |
| 2olc_A | 397 | MTR kinase, methylthioribose kinase; kinase ADP-2H | 89.75 | |
| 3r70_A | 320 | Aminoglycoside phosphotransferase; structural geno | 89.63 | |
| 3ovc_A | 362 | Hygromycin-B 4-O-kinase; aminoglycoside phosphotra | 87.92 | |
| 3tdw_A | 306 | Gentamicin resistance protein; kinase, phosphoryl | 85.21 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 84.1 | |
| 3ats_A | 357 | Putative uncharacterized protein; hypothetical pro | 80.67 |
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-36 Score=300.21 Aligned_cols=249 Identities=31% Similarity=0.511 Sum_probs=209.4
Q ss_pred cchHHHHHHHhcCCCCCCCCCCCCCCCCCCc--ccceeeCCC---CCEEEEEcCC--CCC--CCCccccccccccCCCCC
Q 042931 63 SPLQLEAKALLNTGWWDSSFWTANYSSDHCK--WIGFTCNSA---GSIIGLHLSR--DYG--SFEEPVQLSQLNFSCFPN 133 (471)
Q Consensus 63 ~~~~~~~~~l~~~~~~~~~~w~~~~~~~~C~--w~gv~C~~~---~~v~~l~l~~--~~~--~~~~~~~l~~l~l~~l~~ 133 (471)
.++.++|+++.+ +. .+.+| +.+.|||. |.||+|+.. ++|+.|++++ ..+ .+++ .++++++
T Consensus 9 ~aL~~~k~~~~~-~~-~l~~W--~~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~-------~l~~l~~ 77 (313)
T 1ogq_A 9 QALLQIKKDLGN-PT-TLSSW--LPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPS-------SLANLPY 77 (313)
T ss_dssp HHHHHHHHHTTC-CG-GGTTC--CTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCG-------GGGGCTT
T ss_pred HHHHHHHHhcCC-cc-cccCC--CCCCCCCcCCCcceEeCCCCCCceEEEEECCCCCccCCcccCh-------hHhCCCC
Confidence 445566666532 22 46788 44678998 999999854 7999999985 333 3333 2788899
Q ss_pred CCEEEcCC-CCCCccCchhccCCCCCCEEeccCCCCCCcCCcccCCCCCCcEEEcccCCCCCCCCCccCCCCCcCEEEcc
Q 042931 134 LENLTFQS-FPLAGSIPPEISALSKLQRLDLSSNRLTGSIPSEIGNLRNLVYLNISKNILTGTVPSTLGSLTNLKNMGLS 212 (471)
Q Consensus 134 L~~L~L~~-n~l~g~ip~~l~~L~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~L~~N~l~g~~p~~l~~l~~L~~L~L~ 212 (471)
|++|++++ |.+.+.+|..++++++|++|+|++|.+++.+|..++++++|++|++++|.+++.+|..+.++++|++|+++
T Consensus 78 L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~ 157 (313)
T 1ogq_A 78 LNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFD 157 (313)
T ss_dssp CSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECC
T ss_pred CCeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECc
Confidence 99999995 89999999999999999999999999998999999999999999999999999999999999999999999
Q ss_pred CCCCCCCCcccccCCC-CCCEEeCCCCccccccccccCCCCCCCEEECCCCcCCCCCcccccCCCCCCEEeccCCcCcCC
Q 042931 213 YNQLSGPLPQEIGNLK-NLMELDLGTNSLIGPIPSTLGRLTNLNYMSLSRNMFGGLLPQEIGNLKNLIELNVGSNSLIGP 291 (471)
Q Consensus 213 ~N~l~g~~p~~l~~l~-~L~~L~Ls~N~l~g~ip~~l~~l~~L~~L~L~~N~l~g~~p~~l~~l~~L~~L~L~~N~l~g~ 291 (471)
+|.++|.+|..+++++ +|++|++++|.+++.+|..+..++ |+.|++++|.+++.+|..+..+++|+.|++++|.+++.
T Consensus 158 ~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~l~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~ 236 (313)
T 1ogq_A 158 GNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFD 236 (313)
T ss_dssp SSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCB
T ss_pred CCcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhCCc-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceeee
Confidence 9999989999999988 899999999999988998888887 99999999998888888888888888888888888877
Q ss_pred CchhhhcCCCCCcccCCCCcCcccccccccccc
Q 042931 292 IPSTLGLLTDLSYLDLSCNQFSSSIPNDTTKLL 324 (471)
Q Consensus 292 ip~~l~~l~~L~~L~l~~N~l~g~ip~~~~~l~ 324 (471)
+|. +..+++|++|++++|+++|.+|..+..+.
T Consensus 237 ~~~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~ 268 (313)
T 1ogq_A 237 LGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLK 268 (313)
T ss_dssp GGG-CCCCTTCCEEECCSSCCEECCCGGGGGCT
T ss_pred cCc-ccccCCCCEEECcCCcccCcCChHHhcCc
Confidence 766 77788888888888888888887766543
|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
| >1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* | Back alignment and structure |
|---|
| >4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 | Back alignment and structure |
|---|
| >3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} | Back alignment and structure |
|---|
| >3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} | Back alignment and structure |
|---|
| >4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* | Back alignment and structure |
|---|
| >2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* | Back alignment and structure |
|---|
| >3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
| >3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 471 | ||||
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 3e-26 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 9e-26 | |
| d1u5ra_ | 309 | d.144.1.7 (A:) Serine/threonine protein kinase TAO | 1e-25 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 2e-25 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 2e-25 | |
| d2java1 | 269 | d.144.1.7 (A:3-271) Serine/threonine-protein kinas | 3e-25 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 3e-25 | |
| d2j4za1 | 263 | d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur | 9e-25 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 1e-24 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 1e-24 | |
| d1koba_ | 352 | d.144.1.7 (A:) Twitchin, kinase domain {California | 1e-24 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 2e-24 | |
| d1koaa2 | 350 | d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C | 4e-24 | |
| d1o6ya_ | 277 | d.144.1.7 (A:) Mycobacterial protein kinase PknB, | 5e-24 | |
| d1a06a_ | 307 | d.144.1.7 (A:) Calmodulin-dependent protein kinase | 1e-23 | |
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 1e-23 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 1e-23 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 3e-23 | |
| d1nvra_ | 271 | d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { | 1e-22 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 2e-22 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 2e-22 | |
| d1xbba_ | 277 | d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human | 3e-22 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 3e-22 | |
| d1tkia_ | 321 | d.144.1.7 (A:) Titin, kinase domain {Human (Homo s | 3e-22 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 5e-22 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 7e-22 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 8e-22 | |
| d1yhwa1 | 293 | d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ | 9e-22 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 1e-21 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 1e-21 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 2e-21 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 3e-21 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 5e-20 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 5e-20 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 5e-20 | |
| d1ob3a_ | 286 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod | 6e-20 | |
| d1phka_ | 277 | d.144.1.7 (A:) gamma-subunit of glycogen phosphory | 8e-20 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 1e-19 | |
| d1vjya_ | 303 | d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human | 4e-19 | |
| d1ua2a_ | 299 | d.144.1.7 (A:) Cell division protein kinase 7, CDK | 1e-18 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 1e-18 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 1e-18 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 4e-15 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 2e-14 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 6e-11 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 2e-18 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 3e-18 | |
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 3e-18 | |
| d1xwsa_ | 273 | d.144.1.7 (A:) Proto-oncogene serine/threonine-pro | 3e-18 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 4e-18 | |
| d1q5ka_ | 350 | d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs | 5e-18 | |
| d1gz8a_ | 298 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H | 6e-18 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 1e-17 | |
| d2ozaa1 | 335 | d.144.1.7 (A:51-385) MAP kinase activated protein | 2e-17 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-17 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 6e-17 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 5e-13 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-07 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 5e-06 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-04 | |
| d1pmea_ | 345 | d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien | 4e-17 | |
| d1cm8a_ | 346 | d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s | 9e-17 | |
| d3bqca1 | 328 | d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu | 1e-16 | |
| d3blha1 | 318 | d.144.1.7 (A:8-325) Cell division protein kinase 9 | 3e-16 | |
| d1unla_ | 292 | d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H | 4e-16 | |
| d2b1pa1 | 355 | d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 | 4e-16 | |
| d2gfsa1 | 348 | d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa | 1e-15 | |
| d1blxa_ | 305 | d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H | 5e-15 | |
| d1ckia_ | 299 | d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n | 6e-15 | |
| d1ywna1 | 299 | d.144.1.7 (A:818-1166) Vascular endothelial growth | 2e-14 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 4e-13 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 6e-12 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 2e-10 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 2e-09 | |
| d1csna_ | 293 | d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast | 8e-12 | |
| d1zara2 | 191 | d.144.1.9 (A:91-281) Rio2 serine protein kinase C- | 2e-11 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 3e-11 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 2e-09 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 3e-04 | |
| d1q8ya_ | 362 | d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces | 4e-10 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 4e-10 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 0.003 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 3e-09 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 1e-08 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 1e-08 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-09 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-08 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 6e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.003 | |
| d1w8aa_ | 192 | c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga | 9e-09 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 4e-07 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-06 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-06 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 6e-06 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 8e-06 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 3e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 8e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 2e-06 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 7e-06 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 2e-04 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 6e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 6e-06 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 3e-05 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 6e-05 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 8e-05 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 9e-06 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 8e-05 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 1e-05 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 2e-04 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 0.001 | |
| d2omxa2 | 199 | c.10.2.1 (A:37-235) Internalin B {Listeria monocyt | 0.001 | |
| d2omxa2 | 199 | c.10.2.1 (A:37-235) Internalin B {Listeria monocyt | 0.003 | |
| d2omxa2 | 199 | c.10.2.1 (A:37-235) Internalin B {Listeria monocyt | 0.003 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 0.001 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 0.003 | |
| d2ifga3 | 156 | c.10.2.7 (A:36-191) High affinity nerve growth fac | 0.003 |
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Bruton's tyrosine kinase (Btk) species: Human (Homo sapiens) [TaxId: 9606]
Score = 104 bits (261), Expect = 3e-26
Identities = 28/112 (25%), Positives = 47/112 (41%), Gaps = 6/112 (5%)
Query: 360 EDFDIRYCIGTGGYGSVYKAQLPNGKVFALKKLHTSETEELAFIKSFRNEAQVLSQVLHR 419
+D +GTG +G V + A+K + E F EA+V+ + H
Sbjct: 4 KDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSE----DEFIEEAKVMMNLSHE 59
Query: 420 NIVKLYGFCLHRKCMFLIYEYMEGGSLFCNLHNNEEAVELDWAKRVNIVKAM 471
+V+LYG C ++ +F+I EYM G L L + + + K +
Sbjct: 60 KLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRH--RFQTQQLLEMCKDV 109
|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 471 | |||
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 100.0 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.91 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.89 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.87 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.87 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.87 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.85 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.78 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.77 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.74 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.73 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.73 | |
| d1sm2a_ | 263 | Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie | 99.71 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.71 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 99.69 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.69 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.69 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.68 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.68 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.68 | |
| d1k2pa_ | 258 | Bruton's tyrosine kinase (Btk) {Human (Homo sapien | 99.68 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 99.67 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 99.67 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.66 | |
| d2j4za1 | 263 | Aurora-related kinase 1 (aurora-2) {Human (Homo sa | 99.65 | |
| d1byga_ | 262 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.64 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 99.64 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.63 | |
| d1nvra_ | 271 | Cell cycle checkpoint kinase chk1 {Human (Homo sap | 99.63 | |
| d2java1 | 269 | Serine/threonine-protein kinase Nek2 {Human (Homo | 99.62 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 99.62 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 99.62 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 99.62 | |
| d1uwha_ | 276 | B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d1xbba_ | 277 | Tyrosine-protein kinase SYK {Human (Homo sapiens) | 99.61 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 99.61 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 99.6 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 99.6 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 99.59 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 99.59 | |
| d1mqba_ | 283 | epha2 receptor tyrosine kinase {Human (Homo sapien | 99.59 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 99.59 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 99.58 | |
| d1phka_ | 277 | gamma-subunit of glycogen phosphorylase kinase (Ph | 99.58 | |
| d1t4ha_ | 270 | Protein kinase wnk1 {Human (Homo sapiens) [TaxId: | 99.58 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 99.57 | |
| d1vjya_ | 303 | Type I TGF-beta receptor R4 {Human (Homo sapiens) | 99.57 | |
| d1o6ya_ | 277 | Mycobacterial protein kinase PknB, catalytic domai | 99.56 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 99.56 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 99.56 | |
| d1u46a_ | 273 | Activated CDC42 kinase 1, ACK1 {Human (Homo sapien | 99.55 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 99.55 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 99.55 | |
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 99.55 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.55 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 99.55 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.54 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.53 | |
| d1mp8a_ | 273 | Focal adhesion kinase 1 (fak) {Human (Homo sapiens | 99.53 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 99.53 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.53 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.52 | |
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 99.51 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 99.49 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 99.48 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 99.47 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 99.45 | |
| d1ob3a_ | 286 | Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) | 99.43 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 99.43 | |
| d1ua2a_ | 299 | Cell division protein kinase 7, CDK7 {Human (Homo | 99.41 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.4 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 99.38 | |
| d1unla_ | 292 | Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T | 99.37 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.36 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.36 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.35 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 99.34 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.33 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.31 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 99.31 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 99.28 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 99.28 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 99.27 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.27 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.27 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 99.27 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 99.24 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 99.23 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 99.21 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.19 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 99.17 | |
| d1csna_ | 293 | Casein kinase-1, CK1 {Fission yeast (Schizosacchar | 99.15 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.1 | |
| d1ckia_ | 299 | Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax | 99.06 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.83 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.62 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 98.6 | |
| d1zara2 | 191 | Rio2 serine protein kinase C-terminal domain {Arch | 98.47 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.35 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.31 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.48 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.45 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.62 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.53 | |
| d1nd4a_ | 255 | Aminoglycoside 3'-phosphotransferase IIa (Kanamyci | 90.13 | |
| d1j7la_ | 263 | Type IIIa 3',5"-aminoglycoside phosphotransferase | 87.31 |
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Polygalacturonase inhibiting protein PGIP domain: Polygalacturonase inhibiting protein PGIP species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00 E-value=6.8e-36 Score=292.21 Aligned_cols=244 Identities=30% Similarity=0.490 Sum_probs=202.9
Q ss_pred cchHHHHHHHhcCCCCCCCCCCCCCCCCCC--cccceeeCCC---CCEEEEEcCCC--CCC--CCccccccccccCCCCC
Q 042931 63 SPLQLEAKALLNTGWWDSSFWTANYSSDHC--KWIGFTCNSA---GSIIGLHLSRD--YGS--FEEPVQLSQLNFSCFPN 133 (471)
Q Consensus 63 ~~~~~~~~~l~~~~~~~~~~w~~~~~~~~C--~w~gv~C~~~---~~v~~l~l~~~--~~~--~~~~~~l~~l~l~~l~~ 133 (471)
.++.++|+++.++. .+++| +.++||| .|.||+|+.. +||++|++.+. .|. +++. +++|++
T Consensus 9 ~aLl~~k~~~~~~~--~l~sW--~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~-------l~~L~~ 77 (313)
T d1ogqa_ 9 QALLQIKKDLGNPT--TLSSW--LPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSS-------LANLPY 77 (313)
T ss_dssp HHHHHHHHHTTCCG--GGTTC--CTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGG-------GGGCTT
T ss_pred HHHHHHHHHCCCCC--cCCCC--CCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChH-------HhcCcc
Confidence 34555555543332 36788 4578999 4999999854 48999999753 332 3332 889999
Q ss_pred CCEEEcCC-CCCCccCchhccCCCCCCEEeccCCCCCCcCCcccCCCCCCcEEEcccCCCCCCCCCccCCCCCcCEEEcc
Q 042931 134 LENLTFQS-FPLAGSIPPEISALSKLQRLDLSSNRLTGSIPSEIGNLRNLVYLNISKNILTGTVPSTLGSLTNLKNMGLS 212 (471)
Q Consensus 134 L~~L~L~~-n~l~g~ip~~l~~L~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~L~~N~l~g~~p~~l~~l~~L~~L~L~ 212 (471)
|++|+|++ |+++|.+|++|++|++|++|+|++|++.+..|..+.++.+|+++++++|.+.+.+|..+.++++|++++++
T Consensus 78 L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~ 157 (313)
T d1ogqa_ 78 LNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFD 157 (313)
T ss_dssp CSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECC
T ss_pred ccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeecc
Confidence 99999997 89999999999999999999999999999899989999999999999999999999999999999999999
Q ss_pred CCCCCCCCcccccCCCCC-CEEeCCCCccccc-----------------------cccccCCCCCCCEEECCCCcCCCCC
Q 042931 213 YNQLSGPLPQEIGNLKNL-MELDLGTNSLIGP-----------------------IPSTLGRLTNLNYMSLSRNMFGGLL 268 (471)
Q Consensus 213 ~N~l~g~~p~~l~~l~~L-~~L~Ls~N~l~g~-----------------------ip~~l~~l~~L~~L~L~~N~l~g~~ 268 (471)
+|.++|.+|..+..+.++ +.+++++|+++|. +|..++.+++++.+++++|.+++.+
T Consensus 158 ~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~ 237 (313)
T d1ogqa_ 158 GNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDL 237 (313)
T ss_dssp SSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBG
T ss_pred cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence 999999999988888776 6777777766554 4555666778888888888888765
Q ss_pred cccccCCCCCCEEeccCCcCcCCCchhhhcCCCCCcccCCCCcCcccccc
Q 042931 269 PQEIGNLKNLIELNVGSNSLIGPIPSTLGLLTDLSYLDLSCNQFSSSIPN 318 (471)
Q Consensus 269 p~~l~~l~~L~~L~L~~N~l~g~ip~~l~~l~~L~~L~l~~N~l~g~ip~ 318 (471)
| .++.+++|+.|++++|+++|.+|+.++++++|++|+|++|+++|.+|+
T Consensus 238 ~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~ 286 (313)
T d1ogqa_ 238 G-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ 286 (313)
T ss_dssp G-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC
T ss_pred c-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC
Confidence 5 578888899999999999999999999999999999999999998885
|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|