Citrus Sinensis ID: 042985
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 122 | ||||||
| 224136894 | 333 | predicted protein [Populus trichocarpa] | 0.991 | 0.363 | 0.622 | 2e-36 | |
| 297797183 | 327 | hypothetical protein ARALYDRAFT_496395 [ | 0.983 | 0.366 | 0.553 | 8e-33 | |
| 15241725 | 327 | carboxyesterase 20 [Arabidopsis thaliana | 0.967 | 0.360 | 0.55 | 2e-32 | |
| 255539621 | 325 | Gibberellin receptor GID1, putative [Ric | 0.991 | 0.372 | 0.56 | 1e-31 | |
| 359490219 | 245 | PREDICTED: probable carboxylesterase 120 | 0.959 | 0.477 | 0.544 | 4e-30 | |
| 82697959 | 312 | CXE carboxylesterase, partial [Actinidia | 0.975 | 0.381 | 0.557 | 6e-30 | |
| 225468141 | 326 | PREDICTED: probable carboxylesterase 120 | 0.983 | 0.368 | 0.523 | 2e-29 | |
| 225455637 | 312 | PREDICTED: probable carboxylesterase 120 | 0.959 | 0.375 | 0.520 | 3e-29 | |
| 296084083 | 295 | unnamed protein product [Vitis vinifera] | 0.959 | 0.396 | 0.520 | 5e-29 | |
| 122236529 | 335 | RecName: Full=Carboxylesterase 1; Short= | 0.959 | 0.349 | 0.558 | 6e-29 |
| >gi|224136894|ref|XP_002322442.1| predicted protein [Populus trichocarpa] gi|222869438|gb|EEF06569.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 155 bits (393), Expect = 2e-36, Method: Compositional matrix adjust.
Identities = 76/122 (62%), Positives = 93/122 (76%), Gaps = 1/122 (0%)
Query: 2 FIVNADGTITRDYSNYPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQAL-DSST 60
I N DGTITRD + YP+++ +PDP D T +SKD+ VNQS KTWVRIFLPRQ + DSS+
Sbjct: 21 IIPNHDGTITRDPNRYPNSSPSPDPKDPTPVLSKDIIVNQSEKTWVRIFLPRQTIVDSSS 80
Query: 61 KTKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDA 120
+KLPLIVY HGG I SA++ ++HD CS + + VIVSVDYRLAPEHRLPAAY DA
Sbjct: 81 TSKLPLIVYFHGGGFINCSASSTVFHDFCSSMVLDLHVVIVSVDYRLAPEHRLPAAYDDA 140
Query: 121 LE 122
+E
Sbjct: 141 ME 142
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297797183|ref|XP_002866476.1| hypothetical protein ARALYDRAFT_496395 [Arabidopsis lyrata subsp. lyrata] gi|297312311|gb|EFH42735.1| hypothetical protein ARALYDRAFT_496395 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15241725|ref|NP_201024.1| carboxyesterase 20 [Arabidopsis thaliana] gi|75180635|sp|Q9LVB8.1|CXE20_ARATH RecName: Full=Probable carboxylesterase 120; AltName: Full=AtCXE20 gi|8809631|dbj|BAA97182.1| HSR203J protein-like protein [Arabidopsis thaliana] gi|332010195|gb|AED97578.1| carboxyesterase 20 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|255539621|ref|XP_002510875.1| Gibberellin receptor GID1, putative [Ricinus communis] gi|223549990|gb|EEF51477.1| Gibberellin receptor GID1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359490219|ref|XP_003634052.1| PREDICTED: probable carboxylesterase 120-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|82697959|gb|ABB89014.1| CXE carboxylesterase, partial [Actinidia arguta] | Back alignment and taxonomy information |
|---|
| >gi|225468141|ref|XP_002267455.1| PREDICTED: probable carboxylesterase 120 [Vitis vinifera] gi|297741146|emb|CBI31877.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225455637|ref|XP_002271453.1| PREDICTED: probable carboxylesterase 120-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296084083|emb|CBI24471.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|122236529|sp|Q0ZPV7.1|CXE1_ACTER RecName: Full=Carboxylesterase 1; Short=AeCXE1 gi|82697957|gb|ABB89013.1| CXE carboxylesterase [Actinidia eriantha] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 122 | ||||||
| TAIR|locus:2174033 | 327 | CXE20 "carboxyesterase 20" [Ar | 0.967 | 0.360 | 0.55 | 1.1e-32 | |
| TAIR|locus:2043644 | 329 | AT2G45600 [Arabidopsis thalian | 0.877 | 0.325 | 0.478 | 5.3e-24 | |
| TAIR|locus:2146097 | 344 | CXE17 "AT5G16080" [Arabidopsis | 0.893 | 0.316 | 0.426 | 2.1e-18 | |
| TAIR|locus:2043654 | 324 | AT2G45610 [Arabidopsis thalian | 0.967 | 0.364 | 0.391 | 2.8e-18 | |
| TAIR|locus:2171681 | 335 | CXE18 "carboxyesterase 18" [Ar | 0.909 | 0.331 | 0.379 | 2.7e-17 | |
| TAIR|locus:2012196 | 315 | AT1G49640 [Arabidopsis thalian | 0.942 | 0.365 | 0.385 | 1.4e-15 | |
| TAIR|locus:2144083 | 329 | AT5G06570 [Arabidopsis thalian | 0.909 | 0.337 | 0.373 | 1.4e-15 | |
| TAIR|locus:2114480 | 329 | CXE13 "carboxyesterase 13" [Ar | 0.959 | 0.355 | 0.377 | 2.4e-15 | |
| TAIR|locus:2012227 | 319 | CXE5 "carboxyesterase 5" [Arab | 0.901 | 0.344 | 0.380 | 9.9e-15 | |
| TAIR|locus:2202190 | 318 | AT1G19190 [Arabidopsis thalian | 0.844 | 0.323 | 0.359 | 1.3e-14 |
| TAIR|locus:2174033 CXE20 "carboxyesterase 20" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 357 (130.7 bits), Expect = 1.1e-32, P = 1.1e-32
Identities = 66/120 (55%), Positives = 87/120 (72%)
Query: 5 NADGTITRDYSNYPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDSS--TKT 62
N DG+ITRD SN+P TAATPDP+ AVSKD+PVNQ TW+R++LP A++ +
Sbjct: 19 NPDGSITRDLSNFPCTAATPDPSPLNPAVSKDLPVNQLKSTWLRLYLPSSAVNEGNVSSQ 78
Query: 63 KLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALE 122
KLP++VY HGG IL S +++HD CS++A + A++VS YRLAPEHRLPAAY D +E
Sbjct: 79 KLPIVVYYHGGGFILCSVDMQLFHDFCSEVARDLNAIVVSPSYRLAPEHRLPAAYDDGVE 138
|
|
| TAIR|locus:2043644 AT2G45600 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2146097 CXE17 "AT5G16080" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043654 AT2G45610 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171681 CXE18 "carboxyesterase 18" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2012196 AT1G49640 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2144083 AT5G06570 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2114480 CXE13 "carboxyesterase 13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2012227 CXE5 "carboxyesterase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2202190 AT1G19190 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pm.C_LG_XV000431 | hypothetical protein (333 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| fgenesh4_pm.C_scaffold_123000024 | • | 0.412 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 122 | |||
| pfam07859 | 207 | pfam07859, Abhydrolase_3, alpha/beta hydrolase fol | 4e-21 | |
| COG0657 | 312 | COG0657, Aes, Esterase/lipase [Lipid metabolism] | 6e-15 | |
| COG2272 | 491 | COG2272, PnbA, Carboxylesterase type B [Lipid meta | 1e-07 | |
| pfam00135 | 510 | pfam00135, COesterase, Carboxylesterase family | 2e-06 | |
| PRK10162 | 318 | PRK10162, PRK10162, acetyl esterase; Provisional | 3e-06 | |
| cd00312 | 493 | cd00312, Esterase_lipase, Esterases and lipases (i | 3e-05 | |
| pfam03403 | 372 | pfam03403, PAF-AH_p_II, Platelet-activating factor | 8e-04 |
| >gnl|CDD|219611 pfam07859, Abhydrolase_3, alpha/beta hydrolase fold | Back alignment and domain information |
|---|
Score = 83.4 bits (207), Expect = 4e-21
Identities = 31/56 (55%), Positives = 36/56 (64%), Gaps = 2/56 (3%)
Query: 67 IVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALE 122
+VY HGG +L SA T + LC +AA AV+VSVDYRLAPEH PAA DA
Sbjct: 1 LVYFHGGGFVLGSADT--HDRLCRRLAAAAGAVVVSVDYRLAPEHPFPAAIEDAYA 54
|
This catalytic domain is found in a very wide range of enzymes. Length = 207 |
| >gnl|CDD|223730 COG0657, Aes, Esterase/lipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225181 COG2272, PnbA, Carboxylesterase type B [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215741 pfam00135, COesterase, Carboxylesterase family | Back alignment and domain information |
|---|
| >gnl|CDD|236660 PRK10162, PRK10162, acetyl esterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238191 cd00312, Esterase_lipase, Esterases and lipases (includes fungal lipases, cholinesterases, etc | Back alignment and domain information |
|---|
| >gnl|CDD|217536 pfam03403, PAF-AH_p_II, Platelet-activating factor acetylhydrolase, isoform II | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 122 | |||
| KOG1515 | 336 | consensus Arylacetamide deacetylase [Defense mecha | 99.97 | |
| COG0657 | 312 | Aes Esterase/lipase [Lipid metabolism] | 99.81 | |
| PRK10162 | 318 | acetyl esterase; Provisional | 99.8 | |
| PF07859 | 211 | Abhydrolase_3: alpha/beta hydrolase fold A web pag | 99.67 | |
| COG2272 | 491 | PnbA Carboxylesterase type B [Lipid metabolism] | 99.61 | |
| PF00135 | 535 | COesterase: Carboxylesterase family The prints ent | 99.46 | |
| cd00312 | 493 | Esterase_lipase Esterases and lipases (includes fu | 99.44 | |
| KOG4388 | 880 | consensus Hormone-sensitive lipase HSL [Lipid tran | 99.42 | |
| KOG4627 | 270 | consensus Kynurenine formamidase [Amino acid trans | 99.2 | |
| KOG1516 | 545 | consensus Carboxylesterase and related proteins [G | 99.11 | |
| KOG4389 | 601 | consensus Acetylcholinesterase/Butyrylcholinestera | 99.03 | |
| PF10340 | 374 | DUF2424: Protein of unknown function (DUF2424); In | 98.98 | |
| PLN00021 | 313 | chlorophyllase | 98.26 | |
| COG1506 | 620 | DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept | 98.19 | |
| TIGR01840 | 212 | esterase_phb esterase, PHB depolymerase family. Th | 97.95 | |
| PRK10115 | 686 | protease 2; Provisional | 97.65 | |
| TIGR02821 | 275 | fghA_ester_D S-formylglutathione hydrolase. This m | 97.48 | |
| PRK10566 | 249 | esterase; Provisional | 97.47 | |
| KOG2564 | 343 | consensus Predicted acetyltransferases and hydrola | 97.2 | |
| PLN02442 | 283 | S-formylglutathione hydrolase | 97.17 | |
| PLN02385 | 349 | hydrolase; alpha/beta fold family protein | 97.1 | |
| PLN02652 | 395 | hydrolase; alpha/beta fold family protein | 97.04 | |
| PF03403 | 379 | PAF-AH_p_II: Platelet-activating factor acetylhydr | 97.03 | |
| PLN02298 | 330 | hydrolase, alpha/beta fold family protein | 97.01 | |
| TIGR03101 | 266 | hydr2_PEP hydrolase, ortholog 2, exosortase system | 96.97 | |
| PF10503 | 220 | Esterase_phd: Esterase PHB depolymerase | 96.92 | |
| PF05448 | 320 | AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 | 96.9 | |
| PF12146 | 79 | Hydrolase_4: Putative lysophospholipase; InterPro: | 96.79 | |
| PF12740 | 259 | Chlorophyllase2: Chlorophyllase enzyme; InterPro: | 96.75 | |
| PF12695 | 145 | Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 | 96.74 | |
| PRK05077 | 414 | frsA fermentation/respiration switch protein; Revi | 96.7 | |
| PHA02857 | 276 | monoglyceride lipase; Provisional | 96.67 | |
| TIGR03100 | 274 | hydr1_PEP hydrolase, ortholog 1, exosortase system | 96.66 | |
| PRK10985 | 324 | putative hydrolase; Provisional | 96.46 | |
| PRK00870 | 302 | haloalkane dehalogenase; Provisional | 96.41 | |
| PLN02511 | 388 | hydrolase | 96.24 | |
| KOG4391 | 300 | consensus Predicted alpha/beta hydrolase BEM46 [Ge | 96.06 | |
| KOG3847 | 399 | consensus Phospholipase A2 (platelet-activating fa | 95.97 | |
| COG3509 | 312 | LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda | 95.84 | |
| COG4099 | 387 | Predicted peptidase [General function prediction o | 95.79 | |
| TIGR00976 | 550 | /NonD putative hydrolase, CocE/NonD family. This m | 95.7 | |
| KOG1455 | 313 | consensus Lysophospholipase [Lipid transport and m | 95.61 | |
| PF12715 | 390 | Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 | 95.54 | |
| TIGR01250 | 288 | pro_imino_pep_2 proline-specific peptidases, Bacil | 95.15 | |
| PRK10673 | 255 | acyl-CoA esterase; Provisional | 95.11 | |
| PLN02211 | 273 | methyl indole-3-acetate methyltransferase | 95.1 | |
| cd00707 | 275 | Pancreat_lipase_like Pancreatic lipase-like enzyme | 94.9 | |
| PF07224 | 307 | Chlorophyllase: Chlorophyllase; InterPro: IPR01082 | 94.83 | |
| TIGR03343 | 282 | biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die | 94.79 | |
| PF01738 | 218 | DLH: Dienelactone hydrolase family; InterPro: IPR0 | 94.62 | |
| PRK10749 | 330 | lysophospholipase L2; Provisional | 94.59 | |
| KOG2100 | 755 | consensus Dipeptidyl aminopeptidase [Posttranslati | 94.53 | |
| PLN02872 | 395 | triacylglycerol lipase | 94.52 | |
| PF00756 | 251 | Esterase: Putative esterase; InterPro: IPR000801 T | 94.5 | |
| PRK10439 | 411 | enterobactin/ferric enterobactin esterase; Provisi | 94.32 | |
| COG0412 | 236 | Dienelactone hydrolase and related enzymes [Second | 94.27 | |
| PLN02824 | 294 | hydrolase, alpha/beta fold family protein | 94.2 | |
| TIGR03611 | 257 | RutD pyrimidine utilization protein D. This protei | 94.02 | |
| PLN02894 | 402 | hydrolase, alpha/beta fold family protein | 93.98 | |
| TIGR01836 | 350 | PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth | 93.97 | |
| COG0429 | 345 | Predicted hydrolase of the alpha/beta-hydrolase fo | 93.83 | |
| PF12697 | 228 | Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 | 93.77 | |
| KOG3101 | 283 | consensus Esterase D [General function prediction | 93.71 | |
| TIGR03695 | 251 | menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene | 93.65 | |
| KOG2281 | 867 | consensus Dipeptidyl aminopeptidases/acylaminoacyl | 93.64 | |
| TIGR03056 | 278 | bchO_mg_che_rel putative magnesium chelatase acces | 93.54 | |
| TIGR02427 | 251 | protocat_pcaD 3-oxoadipate enol-lactonase. Members | 93.25 | |
| PLN03084 | 383 | alpha/beta hydrolase fold protein; Provisional | 93.01 | |
| COG3458 | 321 | Acetyl esterase (deacetylase) [Secondary metabolit | 92.76 | |
| PLN02965 | 255 | Probable pheophorbidase | 92.43 | |
| PF07082 | 250 | DUF1350: Protein of unknown function (DUF1350); In | 92.13 | |
| PF02129 | 272 | Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam | 92.08 | |
| TIGR03502 | 792 | lipase_Pla1_cef extracellular lipase, Pla-1/cef fa | 92.07 | |
| TIGR01738 | 245 | bioH putative pimeloyl-BioC--CoA transferase BioH. | 91.93 | |
| PRK13604 | 307 | luxD acyl transferase; Provisional | 91.75 | |
| COG2936 | 563 | Predicted acyl esterases [General function predict | 91.56 | |
| COG4188 | 365 | Predicted dienelactone hydrolase [General function | 91.36 | |
| PRK11126 | 242 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl | 91.35 | |
| PF04083 | 63 | Abhydro_lipase: Partial alpha/beta-hydrolase lipas | 91.17 | |
| TIGR02240 | 276 | PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer | 91.11 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 91.02 | |
| PF10142 | 367 | PhoPQ_related: PhoPQ-activated pathogenicity-relat | 90.73 | |
| PRK06489 | 360 | hypothetical protein; Provisional | 90.64 | |
| PRK10349 | 256 | carboxylesterase BioH; Provisional | 90.39 | |
| KOG1838 | 409 | consensus Alpha/beta hydrolase [General function p | 90.34 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 90.25 | |
| COG2267 | 298 | PldB Lysophospholipase [Lipid metabolism] | 89.34 | |
| PRK03592 | 295 | haloalkane dehalogenase; Provisional | 89.21 | |
| COG2382 | 299 | Fes Enterochelin esterase and related enzymes [Ino | 89.12 | |
| KOG1552 | 258 | consensus Predicted alpha/beta hydrolase [General | 88.55 | |
| PRK03204 | 286 | haloalkane dehalogenase; Provisional | 88.36 | |
| PLN03087 | 481 | BODYGUARD 1 domain containing hydrolase; Provision | 88.16 | |
| PF11144 | 403 | DUF2920: Protein of unknown function (DUF2920); In | 87.69 | |
| PRK11460 | 232 | putative hydrolase; Provisional | 87.41 | |
| PLN02679 | 360 | hydrolase, alpha/beta fold family protein | 87.29 | |
| PLN02980 | 1655 | 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi | 87.21 | |
| PF00151 | 331 | Lipase: Lipase; InterPro: IPR013818 Triglyceride l | 86.85 | |
| TIGR01249 | 306 | pro_imino_pep_1 proline iminopeptidase, Neisseria- | 84.68 | |
| KOG2382 | 315 | consensus Predicted alpha/beta hydrolase [General | 83.11 | |
| PLN02578 | 354 | hydrolase | 82.12 | |
| KOG4178 | 322 | consensus Soluble epoxide hydrolase [Lipid transpo | 80.6 | |
| PF10686 | 71 | DUF2493: Protein of unknown function (DUF2493); In | 80.38 | |
| PRK07581 | 339 | hypothetical protein; Validated | 80.27 |
| >KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.1e-30 Score=192.22 Aligned_cols=117 Identities=38% Similarity=0.671 Sum_probs=107.5
Q ss_pred CeEEccCCcEEecCCCCCCCCCCCCCCCCCceEEeeEEecCCCCEEEEEEeeCCCCCCCCCCCccEEEEEeCCeeEeeCC
Q 042985 1 MFIVNADGTITRDYSNYPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDSSTKTKLPLIVYVHGGALILLSA 80 (122)
Q Consensus 1 ~~~~~~~g~~~r~~~~~~~~~~~~~p~~~~~v~~~~v~~~~~~~~~~~iy~P~~~~~~~~~~~~pvvv~iHGGg~~~g~~ 80 (122)
.++++++|+++|.....+.+++.++|.++ +..+++.+....++.++||.|...... .+.|+|||||||||+.|+.
T Consensus 32 ~i~i~~~~~~~r~~~~~~~~p~~~~p~~~--v~~~dv~~~~~~~l~vRly~P~~~~~~---~~~p~lvyfHGGGf~~~S~ 106 (336)
T KOG1515|consen 32 NIRIFKDGSFERFFGRFDKVPPSSDPVNG--VTSKDVTIDPFTNLPVRLYRPTSSSSE---TKLPVLVYFHGGGFCLGSA 106 (336)
T ss_pred hceeecCCceeeeecccccCCCCCCcccC--ceeeeeEecCCCCeEEEEEcCCCCCcc---cCceEEEEEeCCccEeCCC
Confidence 37899999999988335899999999977 999999999999999999999987654 6899999999999999998
Q ss_pred CchhhHHHHHHHHhcCCcEEEEEcCCCCCCCCCCchhhhhhC
Q 042985 81 ATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALE 122 (122)
Q Consensus 81 ~~~~~~~~~~~la~~~g~~vv~v~YRlaPe~~~P~~~~D~~~ 122 (122)
....|+.+|.++|.+++++||+||||||||++||++++||++
T Consensus 107 ~~~~y~~~~~~~a~~~~~vvvSVdYRLAPEh~~Pa~y~D~~~ 148 (336)
T KOG1515|consen 107 NSPAYDSFCTRLAAELNCVVVSVDYRLAPEHPFPAAYDDGWA 148 (336)
T ss_pred CCchhHHHHHHHHHHcCeEEEecCcccCCCCCCCccchHHHH
Confidence 888899999999999999999999999999999999999974
|
|
| >COG0657 Aes Esterase/lipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK10162 acetyl esterase; Provisional | Back alignment and domain information |
|---|
| >PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >COG2272 PnbA Carboxylesterase type B [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases | Back alignment and domain information |
|---|
| >cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc | Back alignment and domain information |
|---|
| >KOG4388 consensus Hormone-sensitive lipase HSL [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4389 consensus Acetylcholinesterase/Butyrylcholinesterase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters | Back alignment and domain information |
|---|
| >PLN00021 chlorophyllase | Back alignment and domain information |
|---|
| >COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01840 esterase_phb esterase, PHB depolymerase family | Back alignment and domain information |
|---|
| >PRK10115 protease 2; Provisional | Back alignment and domain information |
|---|
| >TIGR02821 fghA_ester_D S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PRK10566 esterase; Provisional | Back alignment and domain information |
|---|
| >KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02442 S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PLN02385 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN02652 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A | Back alignment and domain information |
|---|
| >PLN02298 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PF10503 Esterase_phd: Esterase PHB depolymerase | Back alignment and domain information |
|---|
| >PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins | Back alignment and domain information |
|---|
| >PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 | Back alignment and domain information |
|---|
| >PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A | Back alignment and domain information |
|---|
| >PRK05077 frsA fermentation/respiration switch protein; Reviewed | Back alignment and domain information |
|---|
| >PHA02857 monoglyceride lipase; Provisional | Back alignment and domain information |
|---|
| >TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PRK10985 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK00870 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02511 hydrolase | Back alignment and domain information |
|---|
| >KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG4099 Predicted peptidase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00976 /NonD putative hydrolase, CocE/NonD family | Back alignment and domain information |
|---|
| >KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A | Back alignment and domain information |
|---|
| >TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily | Back alignment and domain information |
|---|
| >PRK10673 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >PLN02211 methyl indole-3-acetate methyltransferase | Back alignment and domain information |
|---|
| >cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes | Back alignment and domain information |
|---|
| >PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 | Back alignment and domain information |
|---|
| >TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase | Back alignment and domain information |
|---|
| >PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway | Back alignment and domain information |
|---|
| >PRK10749 lysophospholipase L2; Provisional | Back alignment and domain information |
|---|
| >KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02872 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae | Back alignment and domain information |
|---|
| >PRK10439 enterobactin/ferric enterobactin esterase; Provisional | Back alignment and domain information |
|---|
| >COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02824 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR03611 RutD pyrimidine utilization protein D | Back alignment and domain information |
|---|
| >PLN02894 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit | Back alignment and domain information |
|---|
| >COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A | Back alignment and domain information |
|---|
| >KOG3101 consensus Esterase D [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase | Back alignment and domain information |
|---|
| >KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein | Back alignment and domain information |
|---|
| >TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase | Back alignment and domain information |
|---|
| >PLN03084 alpha/beta hydrolase fold protein; Provisional | Back alignment and domain information |
|---|
| >COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02965 Probable pheophorbidase | Back alignment and domain information |
|---|
| >PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants | Back alignment and domain information |
|---|
| >PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] | Back alignment and domain information |
|---|
| >TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family | Back alignment and domain information |
|---|
| >TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH | Back alignment and domain information |
|---|
| >PRK13604 luxD acyl transferase; Provisional | Back alignment and domain information |
|---|
| >COG2936 Predicted acyl esterases [General function prediction only] | Back alignment and domain information |
|---|
| >COG4188 Predicted dienelactone hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional | Back alignment and domain information |
|---|
| >PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function | Back alignment and domain information |
|---|
| >TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella | Back alignment and domain information |
|---|
| >PRK06489 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10349 carboxylesterase BioH; Provisional | Back alignment and domain information |
|---|
| >KOG1838 consensus Alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2267 PldB Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK03592 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03204 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function | Back alignment and domain information |
|---|
| >PRK11460 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02679 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding | Back alignment and domain information |
|---|
| >PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 | Back alignment and domain information |
|---|
| >TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily | Back alignment and domain information |
|---|
| >KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02578 hydrolase | Back alignment and domain information |
|---|
| >KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF10686 DUF2493: Protein of unknown function (DUF2493); InterPro: IPR019627 This entry is represented by Mycobacteriophage D29, Gp61 | Back alignment and domain information |
|---|
| >PRK07581 hypothetical protein; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 122 | ||||
| 2o7r_A | 338 | Plant Carboxylesterase Aecxe1 From Actinidia Eriant | 1e-31 | ||
| 3ebl_A | 365 | Crystal Structure Of Rice Gid1 Complexed With Ga4 L | 3e-11 | ||
| 2yh2_A | 313 | Pyrobaculum Calidifontis Esterase Monoclinic Form L | 6e-11 | ||
| 1jji_A | 311 | The Crystal Structure Of A Hyper-Thermophilic Carbo | 8e-10 | ||
| 2c7b_A | 311 | The Crystal Structure Of Este1, A New Thermophilic | 2e-09 | ||
| 2zsh_A | 351 | Structural Basis Of Gibberellin(Ga3)-Induced Della | 2e-09 | ||
| 3qh4_A | 317 | Crystal Structure Of Esterase Lipw From Mycobacteri | 5e-09 | ||
| 3ain_A | 323 | R267g Mutant Of A Hsl-Like Carboxylesterase From Su | 8e-08 | ||
| 3aim_A | 323 | R267e Mutant Of A Hsl-Like Carboxylesterase From Su | 8e-08 | ||
| 3aio_A | 323 | R267k Mutant Of A Hsl-Like Carboxylesterase From Su | 8e-08 | ||
| 3aik_A | 323 | Crystal Structure Of A Hsl-Like Carboxylesterase Fr | 8e-08 | ||
| 1qz3_A | 310 | Crystal Structure Of Mutant M211sR215L OF CARBOXYLE | 1e-07 | ||
| 2hm7_A | 310 | Crystal Structure Analysis Of The G84s Est2 Mutant | 1e-07 | ||
| 1evq_A | 310 | The Crystal Structure Of The Thermophilic Carboxyle | 2e-07 | ||
| 1c7i_A | 489 | Thermophylic Pnb Esterase Length = 489 | 5e-06 | ||
| 1jkm_B | 361 | Brefeldin A Esterase, A Bacterial Homologue Of Huma | 1e-05 | ||
| 1qe3_A | 489 | Pnb Esterase Length = 489 | 2e-05 | ||
| 1c7j_A | 489 | Pnb Esterase 56c8 Length = 489 | 2e-05 | ||
| 3dnm_A | 336 | Crystal Structure Hormone-Sensitive Lipase From A M | 5e-05 | ||
| 3k6k_A | 322 | Crystal Structure At 2.2 Angstrom Of Hsl-Homolog Es | 5e-05 | ||
| 3fak_A | 322 | Structural And Functional Analysis Of A Hormone-Sen | 8e-05 | ||
| 3v9a_A | 309 | Crystal Structure Of EsteraseLIPASE FROM UNCULTURED | 1e-04 | ||
| 3k9b_A | 529 | Crystal Structure Of Human Liver Carboxylesterase 1 | 6e-04 | ||
| 1ya4_A | 532 | Crystal Structure Of Human Liver Carboxylesterase 1 | 6e-04 | ||
| 1mx1_A | 548 | Crystal Structure Of Human Liver Carboxylesterase I | 7e-04 | ||
| 2dqy_A | 542 | Crystal Structure Of Human Carboxylesterase In Comp | 7e-04 | ||
| 1lzk_A | 323 | Bacterial Heroin Esterase Complex With Transition S | 8e-04 | ||
| 1lzl_A | 323 | Bacterial Heroin Esterase Length = 323 | 8e-04 |
| >pdb|2O7R|A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct Length = 338 | Back alignment and structure |
|
| >pdb|3EBL|A Chain A, Crystal Structure Of Rice Gid1 Complexed With Ga4 Length = 365 | Back alignment and structure |
| >pdb|2YH2|A Chain A, Pyrobaculum Calidifontis Esterase Monoclinic Form Length = 313 | Back alignment and structure |
| >pdb|1JJI|A Chain A, The Crystal Structure Of A Hyper-Thermophilic Carboxylesterase From The Archaeon Archaeoglobus Fulgidus Length = 311 | Back alignment and structure |
| >pdb|2C7B|A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library Length = 311 | Back alignment and structure |
| >pdb|2ZSH|A Chain A, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor Length = 351 | Back alignment and structure |
| >pdb|3QH4|A Chain A, Crystal Structure Of Esterase Lipw From Mycobacterium Marinum Length = 317 | Back alignment and structure |
| >pdb|3AIN|A Chain A, R267g Mutant Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 | Back alignment and structure |
| >pdb|3AIM|A Chain A, R267e Mutant Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 | Back alignment and structure |
| >pdb|3AIO|A Chain A, R267k Mutant Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 | Back alignment and structure |
| >pdb|3AIK|A Chain A, Crystal Structure Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 | Back alignment and structure |
| >pdb|1QZ3|A Chain A, Crystal Structure Of Mutant M211sR215L OF CARBOXYLESTERASE Est2 Complexed With Hexadecanesulfonate Length = 310 | Back alignment and structure |
| >pdb|2HM7|A Chain A, Crystal Structure Analysis Of The G84s Est2 Mutant Length = 310 | Back alignment and structure |
| >pdb|1EVQ|A Chain A, The Crystal Structure Of The Thermophilic Carboxylesterase Est2 From Alicyclobacillus Acidocaldarius Length = 310 | Back alignment and structure |
| >pdb|1C7I|A Chain A, Thermophylic Pnb Esterase Length = 489 | Back alignment and structure |
| >pdb|1JKM|B Chain B, Brefeldin A Esterase, A Bacterial Homologue Of Human Hormone Sensitive Lipase Length = 361 | Back alignment and structure |
| >pdb|1QE3|A Chain A, Pnb Esterase Length = 489 | Back alignment and structure |
| >pdb|1C7J|A Chain A, Pnb Esterase 56c8 Length = 489 | Back alignment and structure |
| >pdb|3DNM|A Chain A, Crystal Structure Hormone-Sensitive Lipase From A Metagenome Library Length = 336 | Back alignment and structure |
| >pdb|3K6K|A Chain A, Crystal Structure At 2.2 Angstrom Of Hsl-Homolog Este7 From A Metagenome Library Length = 322 | Back alignment and structure |
| >pdb|3FAK|A Chain A, Structural And Functional Analysis Of A Hormone-Sensitive Lipase Like Este5 From A Metagenome Library Length = 322 | Back alignment and structure |
| >pdb|3V9A|A Chain A, Crystal Structure Of EsteraseLIPASE FROM UNCULTURED BACTERIUM Length = 309 | Back alignment and structure |
| >pdb|3K9B|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 (Hce1) In Covalent Complex With The Nerve Agent Cyclosarin (Gf) Length = 529 | Back alignment and structure |
| >pdb|1YA4|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 In Complex With Tamoxifen Length = 532 | Back alignment and structure |
| >pdb|1MX1|A Chain A, Crystal Structure Of Human Liver Carboxylesterase In Complex With Tacrine Length = 548 | Back alignment and structure |
| >pdb|2DQY|A Chain A, Crystal Structure Of Human Carboxylesterase In Complex With Cholate And Palmitate Length = 542 | Back alignment and structure |
| >pdb|1LZK|A Chain A, Bacterial Heroin Esterase Complex With Transition State Analog Dimethylarsenic Acid Length = 323 | Back alignment and structure |
| >pdb|1LZL|A Chain A, Bacterial Heroin Esterase Length = 323 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 122 | |||
| 2o7r_A | 338 | CXE carboxylesterase; alpha/beta hydrolase; 1.40A | 2e-44 | |
| 2zsh_A | 351 | Probable gibberellin receptor GID1L1; plant hormon | 8e-42 | |
| 3ebl_A | 365 | Gibberellin receptor GID1; alpha/beta hydrolase, l | 4e-40 | |
| 2c7b_A | 311 | Carboxylesterase, ESTE1; carboxyesterase, thermoph | 1e-19 | |
| 2hm7_A | 310 | Carboxylesterase; alpha/beta hydrolase fold, hydro | 1e-19 | |
| 1lzl_A | 323 | Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod | 3e-19 | |
| 3ain_A | 323 | 303AA long hypothetical esterase; carboxylesterase | 4e-19 | |
| 3qh4_A | 317 | Esterase LIPW; structural genomics, ssgcid, seattl | 8e-19 | |
| 1jji_A | 311 | Carboxylesterase; alpha-beta hydrolase fold, hydro | 2e-18 | |
| 3ga7_A | 326 | Acetyl esterase; phosphoserine, IDP00896, hydrolas | 2e-18 | |
| 2wir_A | 313 | Pesta, alpha/beta hydrolase fold-3 domain protein; | 1e-17 | |
| 2qru_A | 274 | Uncharacterized protein; alpha/beta-hydrolase, str | 2e-17 | |
| 3k6k_A | 322 | Esterase/lipase; alpha/beta hydrolase fold; 2.20A | 1e-16 | |
| 3fak_A | 322 | Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc | 2e-16 | |
| 3h04_A | 275 | Uncharacterized protein; protein with unknown func | 9e-16 | |
| 1jkm_A | 361 | Brefeldin A esterase; serine hydrolase, degradatio | 3e-15 | |
| 3d7r_A | 326 | Esterase; alpha/beta fold, hydrolase; 2.01A {Staph | 1e-14 | |
| 1vkh_A | 273 | Putative serine hydrolase; structural genomics, jo | 8e-13 | |
| 4e15_A | 303 | Kynurenine formamidase; alpha/beta hydrolase fold, | 1e-08 | |
| 1dx4_A | 585 | ACHE, acetylcholinesterase; hydrolase, serine este | 2e-07 | |
| 2fj0_A | 551 | JuvenIle hormone esterase; manduca sexta, alpha-be | 1e-06 | |
| 2pbl_A | 262 | Putative esterase/lipase/thioesterase; alpha/beta- | 5e-06 | |
| 2ogt_A | 498 | Thermostable carboxylesterase EST50; alpha/beta hy | 6e-06 | |
| 1qe3_A | 489 | PNB esterase, para-nitrobenzyl esterase; alpha-bet | 7e-06 | |
| 2bce_A | 579 | Cholesterol esterase; hydrolase, serine esterase, | 1e-05 | |
| 3bix_A | 574 | Neuroligin-1, neuroligin I; esterase domain, alpha | 1e-05 | |
| 3bxp_A | 277 | Putative lipase/esterase; putative carboxylesteras | 2e-05 | |
| 1p0i_A | 529 | Cholinesterase; serine hydrolase, butyrate, hydrol | 2e-05 | |
| 2ha2_A | 543 | ACHE, acetylcholinesterase; hydrolase fold, serine | 3e-05 | |
| 1ea5_A | 537 | ACHE, acetylcholinesterase; hydrolase, serine hydr | 6e-05 | |
| 1ukc_A | 522 | ESTA, esterase; fungi, A/B hydrolase fold, acetylc | 6e-05 | |
| 1thg_A | 544 | Lipase; hydrolase(carboxylic esterase); HET: NAG N | 1e-04 | |
| 1llf_A | 534 | Lipase 3; candida cylindracea cholesterol esterase | 3e-04 | |
| 2h7c_A | 542 | Liver carboxylesterase 1; enzyme, cholesteryl este | 3e-04 |
| >2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Length = 338 | Back alignment and structure |
|---|
Score = 146 bits (371), Expect = 2e-44
Identities = 67/121 (55%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
Query: 2 FIVNADGTITRDYSNYPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDSSTK 61
++N D TITR PSTAA+PDP + ++KD+ +N + T+VR+FLPR AL +S K
Sbjct: 24 IVLNPDRTITR-PIQIPSTAASPDPTSSSPVLTKDLALNPLHNTFVRLFLPRHALYNSAK 82
Query: 62 TKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDAL 121
LPL+VY HGG IL SAA+ I+HD C ++A VI SVDYRLAPEHRLPAAY DA+
Sbjct: 83 --LPLVVYFHGGGFILFSAASTIFHDFCCEMAVHAGVVIASVDYRLAPEHRLPAAYDDAM 140
Query: 122 E 122
E
Sbjct: 141 E 141
|
| >2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Length = 351 | Back alignment and structure |
|---|
| >3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Length = 365 | Back alignment and structure |
|---|
| >2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Length = 311 | Back alignment and structure |
|---|
| >2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Length = 310 | Back alignment and structure |
|---|
| >1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Length = 323 | Back alignment and structure |
|---|
| >3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Length = 323 | Back alignment and structure |
|---|
| >3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Length = 317 | Back alignment and structure |
|---|
| >1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Length = 311 | Back alignment and structure |
|---|
| >3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Length = 326 | Back alignment and structure |
|---|
| >2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Length = 274 | Back alignment and structure |
|---|
| >3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Length = 322 | Back alignment and structure |
|---|
| >3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Length = 322 | Back alignment and structure |
|---|
| >3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Length = 275 | Back alignment and structure |
|---|
| >1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Length = 361 | Back alignment and structure |
|---|
| >3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Length = 326 | Back alignment and structure |
|---|
| >1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Length = 273 | Back alignment and structure |
|---|
| >4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Length = 303 | Back alignment and structure |
|---|
| >1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Length = 585 | Back alignment and structure |
|---|
| >2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Length = 551 | Back alignment and structure |
|---|
| >2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Length = 262 | Back alignment and structure |
|---|
| >2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Length = 498 | Back alignment and structure |
|---|
| >1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Length = 489 | Back alignment and structure |
|---|
| >2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Length = 579 | Back alignment and structure |
|---|
| >3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Length = 574 | Back alignment and structure |
|---|
| >3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Length = 277 | Back alignment and structure |
|---|
| >1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Length = 529 | Back alignment and structure |
|---|
| >2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Length = 543 | Back alignment and structure |
|---|
| >1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Length = 537 | Back alignment and structure |
|---|
| >1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Length = 522 | Back alignment and structure |
|---|
| >1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Length = 544 | Back alignment and structure |
|---|
| >1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Length = 534 | Back alignment and structure |
|---|
| >2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Length = 542 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 122 | |||
| 3ebl_A | 365 | Gibberellin receptor GID1; alpha/beta hydrolase, l | 99.88 | |
| 2o7r_A | 338 | CXE carboxylesterase; alpha/beta hydrolase; 1.40A | 99.86 | |
| 2zsh_A | 351 | Probable gibberellin receptor GID1L1; plant hormon | 99.8 | |
| 2qru_A | 274 | Uncharacterized protein; alpha/beta-hydrolase, str | 99.75 | |
| 3qh4_A | 317 | Esterase LIPW; structural genomics, ssgcid, seattl | 99.74 | |
| 3fak_A | 322 | Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc | 99.7 | |
| 3ga7_A | 326 | Acetyl esterase; phosphoserine, IDP00896, hydrolas | 99.69 | |
| 3ain_A | 323 | 303AA long hypothetical esterase; carboxylesterase | 99.68 | |
| 1lzl_A | 323 | Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod | 99.65 | |
| 2wir_A | 313 | Pesta, alpha/beta hydrolase fold-3 domain protein; | 99.62 | |
| 2hm7_A | 310 | Carboxylesterase; alpha/beta hydrolase fold, hydro | 99.6 | |
| 1llf_A | 534 | Lipase 3; candida cylindracea cholesterol esterase | 99.58 | |
| 1jji_A | 311 | Carboxylesterase; alpha-beta hydrolase fold, hydro | 99.58 | |
| 2c7b_A | 311 | Carboxylesterase, ESTE1; carboxyesterase, thermoph | 99.57 | |
| 3bix_A | 574 | Neuroligin-1, neuroligin I; esterase domain, alpha | 99.56 | |
| 4e15_A | 303 | Kynurenine formamidase; alpha/beta hydrolase fold, | 99.56 | |
| 3k6k_A | 322 | Esterase/lipase; alpha/beta hydrolase fold; 2.20A | 99.55 | |
| 1thg_A | 544 | Lipase; hydrolase(carboxylic esterase); HET: NAG N | 99.55 | |
| 2ha2_A | 543 | ACHE, acetylcholinesterase; hydrolase fold, serine | 99.55 | |
| 1p0i_A | 529 | Cholinesterase; serine hydrolase, butyrate, hydrol | 99.54 | |
| 1jkm_A | 361 | Brefeldin A esterase; serine hydrolase, degradatio | 99.54 | |
| 1ukc_A | 522 | ESTA, esterase; fungi, A/B hydrolase fold, acetylc | 99.53 | |
| 1ea5_A | 537 | ACHE, acetylcholinesterase; hydrolase, serine hydr | 99.51 | |
| 2bce_A | 579 | Cholesterol esterase; hydrolase, serine esterase, | 99.48 | |
| 2ogt_A | 498 | Thermostable carboxylesterase EST50; alpha/beta hy | 99.46 | |
| 2fj0_A | 551 | JuvenIle hormone esterase; manduca sexta, alpha-be | 99.42 | |
| 1dx4_A | 585 | ACHE, acetylcholinesterase; hydrolase, serine este | 99.41 | |
| 2h7c_A | 542 | Liver carboxylesterase 1; enzyme, cholesteryl este | 99.4 | |
| 3bxp_A | 277 | Putative lipase/esterase; putative carboxylesteras | 99.39 | |
| 1qe3_A | 489 | PNB esterase, para-nitrobenzyl esterase; alpha-bet | 99.38 | |
| 3d7r_A | 326 | Esterase; alpha/beta fold, hydrolase; 2.01A {Staph | 99.36 | |
| 2pbl_A | 262 | Putative esterase/lipase/thioesterase; alpha/beta- | 99.35 | |
| 1vkh_A | 273 | Putative serine hydrolase; structural genomics, jo | 99.25 | |
| 3bjr_A | 283 | Putative carboxylesterase; structural genomics, jo | 99.2 | |
| 3hxk_A | 276 | Sugar hydrolase; alpha-beta protein., structural g | 99.2 | |
| 3h04_A | 275 | Uncharacterized protein; protein with unknown func | 99.05 | |
| 1l7a_A | 318 | Cephalosporin C deacetylase; structural genomics, | 98.74 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 98.66 | |
| 2fuk_A | 220 | XC6422 protein; A/B hydrolase, structural genomics | 98.63 | |
| 1vlq_A | 337 | Acetyl xylan esterase; TM0077, structural genomics | 98.58 | |
| 4hvt_A | 711 | Ritya.17583.B, post-proline cleaving enzyme; ssgci | 98.56 | |
| 3fcy_A | 346 | Xylan esterase 1; alpha/beta hydrolase, carbohydra | 98.54 | |
| 3trd_A | 208 | Alpha/beta hydrolase; cellular processes; 1.50A {C | 98.52 | |
| 4ao6_A | 259 | Esterase; hydrolase, thermo label; 1.60A {Unidenti | 98.51 | |
| 3fcx_A | 282 | FGH, esterase D, S-formylglutathione hydrolase; re | 98.5 | |
| 2hdw_A | 367 | Hypothetical protein PA2218; alpha/beta hydrolase | 98.4 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 98.39 | |
| 2uz0_A | 263 | Esterase, tributyrin esterase; alpha/beta hydrolas | 98.27 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 98.26 | |
| 1jjf_A | 268 | Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x | 98.23 | |
| 2i3d_A | 249 | AGR_C_3351P, hypothetical protein ATU1826; structu | 98.2 | |
| 3ls2_A | 280 | S-formylglutathione hydrolase; psychrophilic organ | 98.2 | |
| 3f67_A | 241 | Putative dienelactone hydrolase; alpha-beta-alpha | 98.19 | |
| 3nuz_A | 398 | Putative acetyl xylan esterase; structural genomic | 98.18 | |
| 3i6y_A | 280 | Esterase APC40077; lipase, structural genomics, PS | 98.18 | |
| 4b6g_A | 283 | Putative esterase; hydrolase, formaldehyde detoxif | 98.17 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 98.14 | |
| 3hju_A | 342 | Monoglyceride lipase; alpha/beta hydrolase, hydrol | 98.13 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 98.13 | |
| 3d0k_A | 304 | Putative poly(3-hydroxybutyrate) depolymerase LPQ; | 98.1 | |
| 3hlk_A | 446 | Acyl-coenzyme A thioesterase 2, mitochondrial; alp | 98.1 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 98.08 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 98.08 | |
| 2fx5_A | 258 | Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse | 98.08 | |
| 2qm0_A | 275 | BES; alpha-beta structure, structural genomics, PS | 98.07 | |
| 3h2g_A | 397 | Esterase; xanthomonas oryzae PV. oryzae, cell WALL | 98.06 | |
| 3g8y_A | 391 | SUSD/RAGB-associated esterase-like protein; struct | 98.06 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 98.05 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 98.04 | |
| 3e4d_A | 278 | Esterase D; S-formylglutathione hydrolase, hydrola | 98.04 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 98.0 | |
| 1gkl_A | 297 | Endo-1,4-beta-xylanase Y; hydrolase, esterase fami | 98.0 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 97.99 | |
| 3k2i_A | 422 | Acyl-coenzyme A thioesterase 4; alpha/beta hydrola | 97.97 | |
| 3pe6_A | 303 | Monoglyceride lipase; alpha-beta hydrolase fold, 2 | 97.96 | |
| 3pfb_A | 270 | Cinnamoyl esterase; alpha/beta hydrolase fold, hyd | 97.96 | |
| 3ksr_A | 290 | Putative serine hydrolase; catalytic triad, struct | 97.93 | |
| 3vis_A | 306 | Esterase; alpha/beta-hydrolase fold, polyethylene | 97.93 | |
| 2o2g_A | 223 | Dienelactone hydrolase; YP_324580.1, structural ge | 97.86 | |
| 3mve_A | 415 | FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ | 97.79 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 97.76 | |
| 3doh_A | 380 | Esterase; alpha-beta hydrolase, beta sheet; 2.60A | 97.72 | |
| 1zi8_A | 236 | Carboxymethylenebutenolidase; alpha and beta prote | 97.71 | |
| 3c8d_A | 403 | Enterochelin esterase; alpha-beta-alpha sandwich, | 97.7 | |
| 2jbw_A | 386 | Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine | 97.7 | |
| 1jfr_A | 262 | Lipase; serine hydrolase; 1.90A {Streptomyces exfo | 97.68 | |
| 3llc_A | 270 | Putative hydrolase; structural genomics, joint cen | 97.67 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 97.61 | |
| 1ufo_A | 238 | Hypothetical protein TT1662; alpha-beta fold, hydr | 97.59 | |
| 3i2k_A | 587 | Cocaine esterase; alpha/beta hydrolase, hydrolase; | 97.52 | |
| 3bdi_A | 207 | Uncharacterized protein TA0194; NP_393672.1, predi | 97.5 | |
| 3d59_A | 383 | Platelet-activating factor acetylhydrolase; secret | 97.41 | |
| 2wtm_A | 251 | EST1E; hydrolase; 1.60A {Clostridium proteoclastic | 97.35 | |
| 1imj_A | 210 | CIB, CCG1-interacting factor B; alpha/beta hydrola | 97.34 | |
| 3iii_A | 560 | COCE/NOND family hydrolase; structural genomics, c | 97.29 | |
| 2gzs_A | 278 | IROE protein; enterobactin, salmochelin, DFP, hydr | 97.27 | |
| 3qit_A | 286 | CURM TE, polyketide synthase; thioesterase, alpha/ | 97.24 | |
| 1auo_A | 218 | Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl | 97.21 | |
| 4ezi_A | 377 | Uncharacterized protein; alpha-beta hydrolases fol | 97.14 | |
| 1qlw_A | 328 | Esterase; anisotropic refinement, atomic resolutio | 97.06 | |
| 2qjw_A | 176 | Uncharacterized protein XCC1541; putative hydrolas | 97.05 | |
| 1sfr_A | 304 | Antigen 85-A; alpha/beta hydrolase, structural gen | 96.97 | |
| 1tht_A | 305 | Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. | 96.96 | |
| 1mpx_A | 615 | Alpha-amino acid ester hydrolase; alpha/beta hydro | 96.91 | |
| 3cn9_A | 226 | Carboxylesterase; alpha/beta hydrolase fold super- | 96.85 | |
| 1uxo_A | 192 | YDEN protein; hydrolase, A/B hydrolase, esterase, | 96.81 | |
| 3dkr_A | 251 | Esterase D; alpha beta hydrolase, mechanism, catal | 96.81 | |
| 3c5v_A | 316 | PME-1, protein phosphatase methylesterase 1; demet | 96.74 | |
| 3sty_A | 267 | Methylketone synthase 1; alpha/beta hydrolase, dec | 96.74 | |
| 2b9v_A | 652 | Alpha-amino acid ester hydrolase; catalytic triad, | 96.73 | |
| 1fj2_A | 232 | Protein (acyl protein thioesterase 1); alpha/beta | 96.72 | |
| 2h1i_A | 226 | Carboxylesterase; structural genomics, PSI-2, prot | 96.69 | |
| 2r11_A | 306 | Carboxylesterase NP; 2632844, putative hydrolase, | 96.67 | |
| 3b5e_A | 223 | MLL8374 protein; NP_108484.1, carboxylesterase, st | 96.65 | |
| 3rm3_A | 270 | MGLP, thermostable monoacylglycerol lipase; alpha/ | 96.59 | |
| 3fnb_A | 405 | Acylaminoacyl peptidase SMU_737; alpha-beta-alpha | 96.55 | |
| 4g9e_A | 279 | AHL-lactonase, alpha/beta hydrolase fold protein; | 96.5 | |
| 1k8q_A | 377 | Triacylglycerol lipase, gastric; APHA beta hydrola | 96.4 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 96.38 | |
| 3og9_A | 209 | Protein YAHD A copper inducible hydrolase; alpha/b | 96.28 | |
| 3r40_A | 306 | Fluoroacetate dehalogenase; FACD, defluorinase, al | 96.25 | |
| 2qs9_A | 194 | Retinoblastoma-binding protein 9; B5T overexpresse | 96.25 | |
| 3dqz_A | 258 | Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl | 96.23 | |
| 2e3j_A | 356 | Epoxide hydrolase EPHB; epoxide hydrolase B, struc | 96.21 | |
| 1r88_A | 280 | MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP | 96.19 | |
| 3vdx_A | 456 | Designed 16NM tetrahedral protein CAGE containing | 96.19 | |
| 1zoi_A | 276 | Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo | 96.15 | |
| 3hss_A | 293 | Putative bromoperoxidase; alpha beta hydrolase, ox | 96.09 | |
| 3u0v_A | 239 | Lysophospholipase-like protein 1; alpha, beta hydr | 96.09 | |
| 1a88_A | 275 | Chloroperoxidase L; haloperoxidase, oxidoreductase | 96.03 | |
| 3r0v_A | 262 | Alpha/beta hydrolase fold protein; structural geno | 95.99 | |
| 2wfl_A | 264 | Polyneuridine-aldehyde esterase; alkaloid metaboli | 95.99 | |
| 3bwx_A | 285 | Alpha/beta hydrolase; YP_496220.1, joint center fo | 95.95 | |
| 3fob_A | 281 | Bromoperoxidase; structural genomics, IDP00046, ba | 95.94 | |
| 2rau_A | 354 | Putative esterase; NP_343859.1, putative lipase, s | 95.9 | |
| 1hkh_A | 279 | Gamma lactamase; hydrolase, alpha/beta hydrolase, | 95.83 | |
| 3fla_A | 267 | RIFR; alpha-beta hydrolase thioesterase, hydrolase | 95.82 | |
| 3ia2_A | 271 | Arylesterase; alpha-beta hydrolase fold, transitio | 95.81 | |
| 3g9x_A | 299 | Haloalkane dehalogenase; alpha/beta hydrolase, hel | 95.79 | |
| 1a8s_A | 273 | Chloroperoxidase F; haloperoxidase, oxidoreductase | 95.71 | |
| 4fbl_A | 281 | LIPS lipolytic enzyme; thermostable, structural ge | 95.64 | |
| 2d81_A | 318 | PHB depolymerase; alpha/beta hydrolase fold, circu | 95.64 | |
| 3kxp_A | 314 | Alpha-(N-acetylaminomethylene)succinic acid hydrol | 95.59 | |
| 1r3d_A | 264 | Conserved hypothetical protein VC1974; structural | 95.53 | |
| 2y6u_A | 398 | Peroxisomal membrane protein LPX1; hydrolase, puta | 95.52 | |
| 2ocg_A | 254 | Valacyclovir hydrolase; alpha beta hydrolase fold; | 95.5 | |
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 95.48 | |
| 2r8b_A | 251 | AGR_C_4453P, uncharacterized protein ATU2452; APC6 | 95.47 | |
| 3kda_A | 301 | CFTR inhibitory factor (CIF); alpha/beta hydrolase | 95.46 | |
| 1q0r_A | 298 | RDMC, aclacinomycin methylesterase; anthracycline, | 95.45 | |
| 3qvm_A | 282 | OLEI00960; structural genomics, PSI-biology, midwe | 95.41 | |
| 2cjp_A | 328 | Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu | 95.4 | |
| 3oos_A | 278 | Alpha/beta hydrolase family protein; APC67239.0, p | 95.4 | |
| 3u1t_A | 309 | DMMA haloalkane dehalogenase; alpha/beta-hydrolase | 95.38 | |
| 4fol_A | 299 | FGH, S-formylglutathione hydrolase; D-type esteras | 95.36 | |
| 3fsg_A | 272 | Alpha/beta superfamily hydrolase; PF00561, MCSG, P | 95.22 | |
| 3qmv_A | 280 | Thioesterase, REDJ; alpha/beta hydrolase fold, hyd | 95.21 | |
| 3e0x_A | 245 | Lipase-esterase related protein; APC60309, clostri | 95.2 | |
| 1a8q_A | 274 | Bromoperoxidase A1; haloperoxidase, oxidoreductase | 95.19 | |
| 1mtz_A | 293 | Proline iminopeptidase; alpha-beta hydrolase, CAP | 95.11 | |
| 4dnp_A | 269 | DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu | 95.1 | |
| 2yys_A | 286 | Proline iminopeptidase-related protein; TTHA1809, | 95.08 | |
| 3ibt_A | 264 | 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, | 95.06 | |
| 1tqh_A | 247 | Carboxylesterase precursor; tetrahedral intermedia | 94.97 | |
| 1brt_A | 277 | Bromoperoxidase A2; haloperoxidase, oxidoreductase | 94.9 | |
| 1xkl_A | 273 | SABP2, salicylic acid-binding protein 2; alpha-bet | 94.73 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 94.54 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 94.39 | |
| 3nwo_A | 330 | PIP, proline iminopeptidase; structural genomics, | 94.39 | |
| 3v48_A | 268 | Aminohydrolase, putative aminoacrylate hydrolase R | 94.34 | |
| 1pja_A | 302 | Palmitoyl-protein thioesterase 2 precursor; hydrol | 94.29 | |
| 2xt0_A | 297 | Haloalkane dehalogenase; hydrolase, alpha-beta hyd | 94.27 | |
| 4fle_A | 202 | Esterase; structural genomics, PSI-biology, northe | 94.26 | |
| 3c6x_A | 257 | Hydroxynitrilase; atomic resolution, hydroxynitril | 94.22 | |
| 1dqz_A | 280 | 85C, protein (antigen 85-C); fibronectin, structur | 94.21 | |
| 2pl5_A | 366 | Homoserine O-acetyltransferase; alpha/beta hydrola | 94.11 | |
| 3g02_A | 408 | Epoxide hydrolase; alpha/beta hydrolase fold, enan | 94.05 | |
| 1j1i_A | 296 | META cleavage compound hydrolase; carbazole degrad | 94.01 | |
| 2qmq_A | 286 | Protein NDRG2, protein NDR2; alpha/beta-hydrolases | 93.98 | |
| 3bf7_A | 255 | Esterase YBFF; thioesterase, helical CAP, hydrolas | 93.86 | |
| 1rp1_A | 450 | Pancreatic lipase related protein 1; hydrolase, li | 93.71 | |
| 1hpl_A | 449 | Lipase; hydrolase(carboxylic esterase); 2.30A {Equ | 93.7 | |
| 1b6g_A | 310 | Haloalkane dehalogenase; hydrolase, alpha/beta-hyd | 93.67 | |
| 4i19_A | 388 | Epoxide hydrolase; structural genomics, PSI-biolog | 93.63 | |
| 3om8_A | 266 | Probable hydrolase; structural genomics, PSI-2, pr | 93.57 | |
| 4fhz_A | 285 | Phospholipase/carboxylesterase; alpha/beta hydrola | 93.44 | |
| 3gff_A | 331 | IROE-like serine hydrolase; NP_718593.1, structura | 93.41 | |
| 3afi_E | 316 | Haloalkane dehalogenase; A/B-hydrolase, hydrolase; | 93.35 | |
| 3i1i_A | 377 | Homoserine O-acetyltransferase; structural genomic | 93.29 | |
| 2wue_A | 291 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas | 93.26 | |
| 1bu8_A | 452 | Protein (pancreatic lipase related protein 2); hyd | 93.24 | |
| 1c4x_A | 285 | BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di | 93.12 | |
| 2xua_A | 266 | PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate | 92.93 | |
| 1ehy_A | 294 | Protein (soluble epoxide hydrolase); alpha/beta hy | 92.72 | |
| 3b12_A | 304 | Fluoroacetate dehalogenase; dehalogease, hydrolase | 91.81 | |
| 1gpl_A | 432 | RP2 lipase; serine esterase, hydrolase, lipid degr | 92.59 | |
| 1ycd_A | 243 | Hypothetical 27.3 kDa protein in AAP1-SMF2 interge | 92.33 | |
| 3p2m_A | 330 | Possible hydrolase; alpha/beta hydrolase superfami | 92.26 | |
| 1w52_X | 452 | Pancreatic lipase related protein 2; detergent, cl | 92.21 | |
| 1m33_A | 258 | BIOH protein; alpha-betta-alpha sandwich, structur | 92.2 | |
| 2puj_A | 286 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; | 92.19 | |
| 1ex9_A | 285 | Lactonizing lipase; alpha-beta hydrolase fold, pho | 92.05 | |
| 4h0c_A | 210 | Phospholipase/carboxylesterase; PSI-biology, midwe | 92.03 | |
| 2xmz_A | 269 | Hydrolase, alpha/beta hydrolase fold family; menaq | 91.9 | |
| 1mj5_A | 302 | 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; | 91.82 | |
| 2qvb_A | 297 | Haloalkane dehalogenase 3; RV2579, alpha-beta hydr | 91.71 | |
| 3qyj_A | 291 | ALR0039 protein; alpha/beta fold, hydrolase; 1.78A | 91.65 | |
| 2wj6_A | 276 | 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid | 91.01 | |
| 1u2e_A | 289 | 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase | 90.77 | |
| 2b61_A | 377 | Homoserine O-acetyltransferase; acyl-enzyme, aspar | 90.74 | |
| 2zyr_A | 484 | Lipase, putative; fatty acid, hydrolase; HET: 1PE; | 90.69 | |
| 1ys1_X | 320 | Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h | 89.97 | |
| 2psd_A | 318 | Renilla-luciferin 2-monooxygenase; alpha/beta-hydr | 89.77 | |
| 3pic_A | 375 | CIP2; alpha/beta hydrolase fold, glucuronoyl ester | 89.6 | |
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 89.59 | |
| 2q0x_A | 335 | Protein DUF1749, uncharacterized protein; alpha/be | 89.35 | |
| 1wom_A | 271 | RSBQ, sigma factor SIGB regulation protein RSBQ; a | 88.61 | |
| 1wm1_A | 317 | Proline iminopeptidase; complex with inhibitor, hy | 88.57 | |
| 3lcr_A | 319 | Tautomycetin biosynthetic PKS; alpha-beta hydrolas | 88.24 | |
| 1iup_A | 282 | META-cleavage product hydrolase; aromatic compound | 88.06 | |
| 2vat_A | 444 | Acetyl-COA--deacetylcephalosporin C acetyltransfer | 87.62 | |
| 3ils_A | 265 | PKS, aflatoxin biosynthesis polyketide synthase; A | 86.92 | |
| 4f21_A | 246 | Carboxylesterase/phospholipase family protein; str | 86.07 | |
| 3guu_A | 462 | Lipase A; protein structure, hydrolase; HET: 1PE; | 85.73 | |
| 3n2z_B | 446 | Lysosomal Pro-X carboxypeptidase; alpha/beta hydro | 84.98 | |
| 1jmk_C | 230 | SRFTE, surfactin synthetase; thioesterase, non-rib | 84.79 | |
| 1lns_A | 763 | X-prolyl dipeptidyl aminopetidase; alpha beta hydr | 84.41 | |
| 3tjm_A | 283 | Fatty acid synthase; thioesterase domain, fatty ac | 84.16 | |
| 2cb9_A | 244 | Fengycin synthetase; thioesterase, non-ribosomal p | 83.52 | |
| 1azw_A | 313 | Proline iminopeptidase; aminopeptidase, serine pro | 82.87 | |
| 2k2q_B | 242 | Surfactin synthetase thioesterase subunit; A/B-hyd | 82.29 | |
| 2x5x_A | 342 | PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE | 81.75 |
| >3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* | Back alignment and structure |
|---|
Probab=99.88 E-value=2.6e-23 Score=153.59 Aligned_cols=115 Identities=36% Similarity=0.567 Sum_probs=95.9
Q ss_pred EEccCCcEEecCCC--CCCCCCCCCCCCCCceEEeeEEecCCCCEEEEEEe-eCCCC-------------------CCCC
Q 042985 3 IVNADGTITRDYSN--YPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFL-PRQAL-------------------DSST 60 (122)
Q Consensus 3 ~~~~~g~~~r~~~~--~~~~~~~~~p~~~~~v~~~~v~~~~~~~~~~~iy~-P~~~~-------------------~~~~ 60 (122)
.+++||+++|++.. .+.+++.++|..+ +..+|+.+.+.+++.+++|. |.... ..
T Consensus 33 ~~~~dg~v~r~~~~~~~~~~~~~~~~~~~--v~~~dv~~~~~~gl~~~~~~~P~~~~~~~~~~~~~~~~l~~~~~~~~-- 108 (365)
T 3ebl_A 33 LRRADGTFERDLGEYLDRRVPANARPLEG--VSSFDHIIDQSVGLEVRIYRAAAEGDAEEGAAAVTRPILEFLTDAPA-- 108 (365)
T ss_dssp HBCTTSCBCHHHHHHHSCBCCCCSSCBTT--EEEEEEEEETTTTEEEEEEEEC----------------CGGGGSCCB--
T ss_pred ccCCCCceEecCcccccCCCCCCCCCCCC--CceeeEEecCCCCceEEEEeCCCccccccccccccccccccccCCCC--
Confidence 46899999997522 3567788888766 99999999999999999998 97530 11
Q ss_pred CCCccEEEEEeCCeeEeeCCCchhhHHHHHHHHhcCCcEEEEEcCCCCCCCCCCchhhhhh
Q 042985 61 KTKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDAL 121 (122)
Q Consensus 61 ~~~~pvvv~iHGGg~~~g~~~~~~~~~~~~~la~~~g~~vv~v~YRlaPe~~~P~~~~D~~ 121 (122)
.++.|+|||+|||||..|+.....|..++..|+.+.|++|+++|||++|++++|++++|+.
T Consensus 109 ~~~~Pvvv~~HGGg~~~g~~~~~~~~~~~~~la~~~g~~Vv~~dyR~~p~~~~~~~~~D~~ 169 (365)
T 3ebl_A 109 AEPFPVIIFFHGGSFVHSSASSTIYDSLCRRFVKLSKGVVVSVNYRRAPEHRYPCAYDDGW 169 (365)
T ss_dssp SSCCEEEEEECCSTTTSCCTTBHHHHHHHHHHHHHHTSEEEEECCCCTTTSCTTHHHHHHH
T ss_pred CCcceEEEEEcCCccccCCCchhhHHHHHHHHHHHCCCEEEEeeCCCCCCCCCcHHHHHHH
Confidence 1678999999999999998887667889999999889999999999999999999999986
|
| >2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A | Back alignment and structure |
|---|
| >2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* | Back alignment and structure |
|---|
| >2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A | Back alignment and structure |
|---|
| >3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A | Back alignment and structure |
|---|
| >1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A | Back alignment and structure |
|---|
| >2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A | Back alignment and structure |
|---|
| >1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* | Back alignment and structure |
|---|
| >1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} | Back alignment and structure |
|---|
| >3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* | Back alignment and structure |
|---|
| >4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A | Back alignment and structure |
|---|
| >3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A | Back alignment and structure |
|---|
| >1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... | Back alignment and structure |
|---|
| >1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... | Back alignment and structure |
|---|
| >1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... | Back alignment and structure |
|---|
| >2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A | Back alignment and structure |
|---|
| >2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A | Back alignment and structure |
|---|
| >2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} | Back alignment and structure |
|---|
| >1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* | Back alignment and structure |
|---|
| >2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* | Back alignment and structure |
|---|
| >3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* | Back alignment and structure |
|---|
| >1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A | Back alignment and structure |
|---|
| >3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 | Back alignment and structure |
|---|
| >3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* | Back alignment and structure |
|---|
| >4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} | Back alignment and structure |
|---|
| >3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} | Back alignment and structure |
|---|
| >3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A | Back alignment and structure |
|---|
| >3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* | Back alignment and structure |
|---|
| >2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A | Back alignment and structure |
|---|
| >4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} | Back alignment and structure |
|---|
| >2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A | Back alignment and structure |
|---|
| >3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* | Back alignment and structure |
|---|
| >3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* | Back alignment and structure |
|---|
| >3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} | Back alignment and structure |
|---|
| >2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} | Back alignment and structure |
|---|
| >3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A | Back alignment and structure |
|---|
| >1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* | Back alignment and structure |
|---|
| >3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* | Back alignment and structure |
|---|
| >2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 | Back alignment and structure |
|---|
| >1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 | Back alignment and structure |
|---|
| >3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 | Back alignment and structure |
|---|
| >3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A | Back alignment and structure |
|---|
| >3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* | Back alignment and structure |
|---|
| >2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* | Back alignment and structure |
|---|
| >1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 | Back alignment and structure |
|---|
| >3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* | Back alignment and structure |
|---|
| >2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* | Back alignment and structure |
|---|
| >3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} | Back alignment and structure |
|---|
| >1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* | Back alignment and structure |
|---|
| >4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* | Back alignment and structure |
|---|
| >2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* | Back alignment and structure |
|---|
| >1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 | Back alignment and structure |
|---|
| >3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A | Back alignment and structure |
|---|
| >3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P | Back alignment and structure |
|---|
| >3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* | Back alignment and structure |
|---|
| >2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A | Back alignment and structure |
|---|
| >1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A | Back alignment and structure |
|---|
| >3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} | Back alignment and structure |
|---|
| >4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A | Back alignment and structure |
|---|
| >1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A | Back alignment and structure |
|---|
| >2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* | Back alignment and structure |
|---|
| >1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A | Back alignment and structure |
|---|
| >1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A | Back alignment and structure |
|---|
| >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A | Back alignment and structure |
|---|
| >3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* | Back alignment and structure |
|---|
| >3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* | Back alignment and structure |
|---|
| >3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* | Back alignment and structure |
|---|
| >3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A | Back alignment and structure |
|---|
| >3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A | Back alignment and structure |
|---|
| >1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A | Back alignment and structure |
|---|
| >2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* | Back alignment and structure |
|---|
| >3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 | Back alignment and structure |
|---|
| >2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* | Back alignment and structure |
|---|
| >2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A | Back alignment and structure |
|---|
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A | Back alignment and structure |
|---|
| >2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A | Back alignment and structure |
|---|
| >1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* | Back alignment and structure |
|---|
| >3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} | Back alignment and structure |
|---|
| >2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* | Back alignment and structure |
|---|
| >3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} | Back alignment and structure |
|---|
| >4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* | Back alignment and structure |
|---|
| >3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* | Back alignment and structure |
|---|
| >3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A | Back alignment and structure |
|---|
| >4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A | Back alignment and structure |
|---|
| >2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A | Back alignment and structure |
|---|
| >1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A | Back alignment and structure |
|---|
| >1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* | Back alignment and structure |
|---|
| >3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} | Back alignment and structure |
|---|
| >1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} | Back alignment and structure |
|---|
| >4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... | Back alignment and structure |
|---|
| >1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* | Back alignment and structure |
|---|
| >2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* | Back alignment and structure |
|---|
| >1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A | Back alignment and structure |
|---|
| >3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A | Back alignment and structure |
|---|
| >1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A | Back alignment and structure |
|---|
| >1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 | Back alignment and structure |
|---|
| >1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A | Back alignment and structure |
|---|
| >4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} | Back alignment and structure |
|---|
| >3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* | Back alignment and structure |
|---|
| >3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* | Back alignment and structure |
|---|
| >3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A | Back alignment and structure |
|---|
| >1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* | Back alignment and structure |
|---|
| >1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 | Back alignment and structure |
|---|
| >3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A | Back alignment and structure |
|---|
| >1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A | Back alignment and structure |
|---|
| >1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} | Back alignment and structure |
|---|
| >1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 | Back alignment and structure |
|---|
| >2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A | Back alignment and structure |
|---|
| >1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 | Back alignment and structure |
|---|
| >4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A | Back alignment and structure |
|---|
| >2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A | Back alignment and structure |
|---|
| >3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} | Back alignment and structure |
|---|
| >2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* | Back alignment and structure |
|---|
| >1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* | Back alignment and structure |
|---|
| >1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E | Back alignment and structure |
|---|
| >2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A | Back alignment and structure |
|---|
| >3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* | Back alignment and structure |
|---|
| >2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* | Back alignment and structure |
|---|
| >1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* | Back alignment and structure |
|---|
| >3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} | Back alignment and structure |
|---|
| >1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A | Back alignment and structure |
|---|
| >2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* | Back alignment and structure |
|---|
| >3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} | Back alignment and structure |
|---|
| >4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* | Back alignment and structure |
|---|
| >3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} | Back alignment and structure |
|---|
| >1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 | Back alignment and structure |
|---|
| >1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A | Back alignment and structure |
|---|
| >2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* | Back alignment and structure |
|---|
| >1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 | Back alignment and structure |
|---|
| >2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A | Back alignment and structure |
|---|
| >2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 122 | ||||
| d1vkha_ | 263 | c.69.1.32 (A:) Putative serine hydrolase Ydr428c { | 1e-06 | |
| d1jjia_ | 311 | c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeogl | 2e-05 | |
| d2bcea_ | 579 | c.69.1.1 (A:) Bile-salt activated lipase (choleste | 3e-04 | |
| d1dx4a_ | 571 | c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Dro | 0.002 | |
| d2hu7a2 | 260 | c.69.1.33 (A:322-581) Acylamino-acid-releasing enz | 0.002 |
| >d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 263 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Putative serine hydrolase Ydr428c domain: Putative serine hydrolase Ydr428c species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 43.7 bits (101), Expect = 1e-06
Identities = 14/61 (22%), Positives = 26/61 (42%), Gaps = 3/61 (4%)
Query: 60 TKTKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPA---VIVSVDYRLAPEHRLPAA 116
++ ++Y+HGGA ++ L + I + S++YRL+PE P
Sbjct: 27 SQNTREAVIYIHGGAWNDPENTPNDFNQLANTIKSMDTESTVCQYSIEYRLSPEITNPRN 86
Query: 117 Y 117
Sbjct: 87 L 87
|
| >d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 311 | Back information, alignment and structure |
|---|
| >d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Length = 579 | Back information, alignment and structure |
|---|
| >d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 571 | Back information, alignment and structure |
|---|
| >d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Length = 260 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 122 | |||
| d1lzla_ | 317 | Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | 99.86 | |
| d1jkma_ | 358 | Carboxylesterase {Bacillus subtilis, brefeldin A e | 99.86 | |
| d1jjia_ | 311 | Carboxylesterase {Archaeon Archaeoglobus fulgidus | 99.85 | |
| d2pbla1 | 261 | Uncharacterized protein TM1040_2492 {Silicibacter | 99.8 | |
| d1u4na_ | 308 | Carboxylesterase {Alicyclobacillus acidocaldarius | 99.8 | |
| d1vkha_ | 263 | Putative serine hydrolase Ydr428c {Baker's yeast ( | 99.61 | |
| d1qe3a_ | 483 | Thermophilic para-nitrobenzyl esterase (PNB estera | 99.53 | |
| d1thga_ | 544 | Type-B carboxylesterase/lipase {Fungus (Geotrichum | 99.5 | |
| d1ukca_ | 517 | Esterase EstA {Aspergillus niger [TaxId: 5061]} | 99.5 | |
| d1ea5a_ | 532 | Acetylcholinesterase {Pacific electric ray (Torped | 99.49 | |
| d1p0ia_ | 526 | Butyryl cholinesterase {Human (Homo sapiens) [TaxI | 99.48 | |
| d2ha2a1 | 542 | Acetylcholinesterase {Mouse (Mus musculus) [TaxId: | 99.48 | |
| d1llfa_ | 534 | Type-B carboxylesterase/lipase {Candida cylindrace | 99.48 | |
| d1dx4a_ | 571 | Acetylcholinesterase {Fruit fly (Drosophila melano | 99.46 | |
| d2h7ca1 | 532 | Mammalian carboxylesterase (liver carboxylesterase | 99.45 | |
| d2bcea_ | 579 | Bile-salt activated lipase (cholesterol esterase) | 99.44 | |
| d2hu7a2 | 260 | Acylamino-acid-releasing enzyme, C-terminal donain | 99.27 | |
| d2bgra2 | 258 | Dipeptidyl peptidase IV/CD26, C-terminal domain {P | 98.94 | |
| d1xfda2 | 258 | Dipeptidyl aminopeptidase-like protein 6, DPP6, C- | 98.86 | |
| d1qfma2 | 280 | Prolyl oligopeptidase, C-terminal domain {Pig (Sus | 98.85 | |
| d1l7aa_ | 318 | Cephalosporin C deacetylase {Bacillus subtilis [Ta | 98.74 | |
| d1vlqa_ | 322 | Acetyl xylan esterase TM0077 {Thermotoga maritima | 98.64 | |
| d2gzsa1 | 265 | Enterobactin and salmochelin hydrolase IroE {Esche | 98.35 | |
| d1jfra_ | 260 | Lipase {Streptomyces exfoliatus [TaxId: 1905]} | 98.14 | |
| d1ju3a2 | 347 | Bacterial cocaine esterase N-terminal domain {Rhod | 98.09 | |
| d1ufoa_ | 238 | Hypothetical protein TT1662 {Thermus thermophilus | 97.99 | |
| d1thta_ | 302 | Myristoyl-ACP-specific thioesterase {Vibrio harvey | 97.97 | |
| d2jbwa1 | 360 | 2,6-dihydropseudooxynicotine hydrolase {Arthrobact | 97.85 | |
| d1qlwa_ | 318 | A novel bacterial esterase {Alcaligenes sp. [TaxId | 97.75 | |
| d1wb4a1 | 273 | Feruloyl esterase domain of the cellulosomal xylan | 97.69 | |
| d1mpxa2 | 381 | Alpha-amino acid ester hydrolase {Xanthomonas citr | 97.67 | |
| d2fuka1 | 218 | XC6422 protein {Xanthomonas campestris [TaxId: 339 | 97.58 | |
| d2b9va2 | 385 | Alpha-amino acid ester hydrolase {Acetobacter past | 97.56 | |
| d1dina_ | 233 | Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI | 97.41 | |
| d3c8da2 | 246 | Enterochelin esterase, catalytic domain {Shigella | 97.34 | |
| d2h1ia1 | 202 | Carboxylesterase {Bacillus cereus [TaxId: 1396]} | 97.32 | |
| d1jjfa_ | 255 | Feruloyl esterase domain of the cellulosomal xylan | 97.32 | |
| d1sfra_ | 288 | Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 | 97.32 | |
| d1r3da_ | 264 | Hypothetical protein VC1974 {Vibrio cholerae [TaxI | 97.25 | |
| d1tqha_ | 242 | Carboxylesterase Est {Bacillus stearothermophilus | 97.21 | |
| d2i3da1 | 218 | Hypothetical protein Atu1826 {Agrobacterium tumefa | 97.18 | |
| d1brta_ | 277 | Bromoperoxidase A2 {Streptomyces aureofaciens [Tax | 97.13 | |
| d1k8qa_ | 377 | Gastric lipase {Dog (Canis familiaris) [TaxId: 961 | 97.13 | |
| d1a88a_ | 275 | Chloroperoxidase L {Streptomyces lividans [TaxId: | 97.12 | |
| d1hkha_ | 279 | Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] | 97.07 | |
| d1va4a_ | 271 | Arylesterase {Pseudomonas fluorescens [TaxId: 294] | 96.95 | |
| d1imja_ | 208 | Ccg1/TafII250-interacting factor B (Cib) {Human (H | 96.85 | |
| d1a8qa_ | 274 | Bromoperoxidase A1 {Streptomyces aureofaciens [Tax | 96.63 | |
| d1mtza_ | 290 | Tricorn interacting factor F1 {Archaeon Thermoplas | 96.57 | |
| d1zd3a2 | 322 | Mammalian epoxide hydrolase, C-terminal domain {Hu | 96.52 | |
| d1a8sa_ | 273 | Chloroperoxidase F {Pseudomonas fluorescens [TaxId | 96.39 | |
| d1xkla_ | 258 | Salicylic acid-binding protein 2 (SABP2) {Common t | 96.18 | |
| d1q0ra_ | 297 | Aclacinomycin methylesterase RdmC {Streptomyces pu | 95.83 | |
| d1b6ga_ | 310 | Haloalkane dehalogenase {Xanthobacter autotrophicu | 95.79 | |
| d2r8ba1 | 203 | Uncharacterized protein Atu2452 {Agrobacterium tum | 95.78 | |
| d1bn7a_ | 291 | Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 | 95.66 | |
| d3b5ea1 | 209 | Uncharacterized protein Mll8374 {Mesorhizobium lot | 95.63 | |
| d1c4xa_ | 281 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 95.57 | |
| d1uxoa_ | 186 | Hypothetical protein YdeN {Bacillus subtilis [TaxI | 95.42 | |
| d1pv1a_ | 299 | Hypothetical esterase YJL068C {Baker's yeast (Sacc | 95.16 | |
| d1uk8a_ | 271 | Meta-cleavage product hydrolase CumD {Pseudomonas | 94.83 | |
| d1ehya_ | 293 | Bacterial epoxide hydrolase {Agrobacterium radioba | 94.75 | |
| d2rhwa1 | 283 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 94.71 | |
| d1wm1a_ | 313 | Proline aminopeptidase {Serratia marcescens [TaxId | 94.7 | |
| d1m33a_ | 256 | Biotin biosynthesis protein BioH {Escherichia coli | 94.38 | |
| d3c70a1 | 256 | Hydroxynitrile lyase {Rubber tree (Hevea brasilien | 94.23 | |
| d1j1ia_ | 268 | Meta cleavage compound hydrolase CarC {Janthinobac | 94.2 | |
| d1mj5a_ | 298 | Haloalkane dehalogenase {Sphingomonas paucimobilis | 93.53 | |
| d1ex9a_ | 285 | Lipase {Pseudomonas aeruginosa [TaxId: 287]} | 93.18 | |
| d1dqza_ | 280 | Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 | 93.05 | |
| d1fj2a_ | 229 | Acyl protein thioesterase 1 {Human (Homo sapiens) | 92.88 | |
| d1lnsa3 | 405 | X-Prolyl dipeptidyl aminopeptidase PepX, middle do | 92.45 | |
| d1azwa_ | 313 | Proline iminopeptidase {Xanthomonas campestris, pv | 91.58 | |
| d1jmkc_ | 230 | Surfactin synthetase, SrfA {Bacillus subtilis [Tax | 91.45 | |
| d1r88a_ | 267 | Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta | 90.99 | |
| d1qo7a_ | 394 | Bacterial epoxide hydrolase {Aspergillus niger [Ta | 90.87 | |
| d1auoa_ | 218 | Carboxylesterase {Pseudomonas fluorescens [TaxId: | 89.23 | |
| d1pjaa_ | 268 | Palmitoyl protein thioesterase 2 {Human (Homo sapi | 88.57 | |
| d1rp1a2 | 337 | Pancreatic lipase, N-terminal domain {Dog (Canis f | 88.26 | |
| d1xkta_ | 286 | Fatty acid synthase {Human (Homo sapiens) [TaxId: | 87.73 | |
| d1cvla_ | 319 | Lipase {Chromobacterium viscosum [TaxId: 42739]} | 87.48 | |
| d1tcaa_ | 317 | Triacylglycerol lipase {Yeast (Candida antarctica) | 86.88 | |
| d1bu8a2 | 338 | Pancreatic lipase, N-terminal domain {Rat (Rattus | 82.34 | |
| d1ispa_ | 179 | Lipase A {Bacillus subtilis [TaxId: 1423]} | 81.13 |
| >d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Carboxylesterase domain: Heroin esterase species: Rhodococcus sp. [TaxId: 1831]
Probab=99.86 E-value=4.5e-22 Score=141.95 Aligned_cols=84 Identities=21% Similarity=0.520 Sum_probs=74.9
Q ss_pred eEEeeEEecCCC---CEEEEEEeeCCCCCCCCCCCccEEEEEeCCeeEeeCCCchhhHHHHHHHHhcCCcEEEEEcCCCC
Q 042985 32 AVSKDVPVNQSN---KTWVRIFLPRQALDSSTKTKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLA 108 (122)
Q Consensus 32 v~~~~v~~~~~~---~~~~~iy~P~~~~~~~~~~~~pvvv~iHGGg~~~g~~~~~~~~~~~~~la~~~g~~vv~v~YRla 108 (122)
+..+++.+.+.+ .+++++|+|++.+ ++.|+|||||||||+.|+... +..+++.++.+.|++|+++||||+
T Consensus 48 v~~~~~~~~~~~g~~~i~~~~~~P~~~~-----~~~Pvvv~iHGGG~~~g~~~~--~~~~~~~la~~~G~~V~~vdYrl~ 120 (317)
T d1lzla_ 48 VSLRELSAPGLDGDPEVKIRFVTPDNTA-----GPVPVLLWIHGGGFAIGTAES--SDPFCVEVARELGFAVANVEYRLA 120 (317)
T ss_dssp EEEEEEEECCSTTCCCEEEEEEEESSCC-----SCEEEEEEECCSTTTSCCGGG--GHHHHHHHHHHHCCEEEEECCCCT
T ss_pred ceEEEEEEecCCCCceEEEEEECCCCCC-----CCCcEEEEecCcccccccccc--cchHHHhHHhhcCCcccccccccc
Confidence 888899987654 3899999998654 788999999999999999887 688899999888999999999999
Q ss_pred CCCCCCchhhhhhC
Q 042985 109 PEHRLPAAYYDALE 122 (122)
Q Consensus 109 Pe~~~P~~~~D~~~ 122 (122)
||++||++++|+.+
T Consensus 121 pe~~~~~~~~d~~~ 134 (317)
T d1lzla_ 121 PETTFPGPVNDCYA 134 (317)
T ss_dssp TTSCTTHHHHHHHH
T ss_pred cccccccccccccc
Confidence 99999999999863
|
| >d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} | Back information, alignment and structure |
|---|
| >d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} | Back information, alignment and structure |
|---|
| >d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} | Back information, alignment and structure |
|---|
| >d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} | Back information, alignment and structure |
|---|
| >d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} | Back information, alignment and structure |
|---|
| >d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} | Back information, alignment and structure |
|---|
| >d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} | Back information, alignment and structure |
|---|
| >d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} | Back information, alignment and structure |
|---|
| >d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} | Back information, alignment and structure |
|---|
| >d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} | Back information, alignment and structure |
|---|
| >d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} | Back information, alignment and structure |
|---|
| >d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|