Citrus Sinensis ID: 042985


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MFIVNADGTITRDYSNYPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDSSTKTKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALE
cEEEcccccEEEcccccccccccccccccccEEEEEEEEcccccEEEEEEcccccccccccccccEEEEEccccEEEEcccccHHHHHHHHHHHHcccEEEEEccccccccccccccccccc
cEEEcccccEEEcccccccccccccccccccEEEEEEEEcccccEEEEEEEccccccccccccccEEEEEccccEEEcccccHHHHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHH
mfivnadgtitrdysnypstaatpdpndhtiavskdvpvnqsnktwVRIFlprqaldsstktklplIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVdyrlapehrlpaayydale
mfivnadgtitrdysnypstaatpdpndhTIAVSKdvpvnqsnktWVRIFlprqaldsstktkLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDyrlapehrlpaayydale
MFIVNADGTITRDYSNYPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDSSTKTKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALE
**************************************VNQSNKTWVRIFLPRQALDSSTKTKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYY****
MFIVNADGTITRDYSNYPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQAL**STKTKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALE
MFIVNADGTITRDYSNYPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDSSTKTKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALE
MFIVNADGTITRDYSNYPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDSSTKTKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFIVNADGTITRDYSNYPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDSSTKTKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query122 2.2.26 [Sep-21-2011]
Q9LVB8 327 Probable carboxylesterase yes no 0.967 0.360 0.55 5e-34
Q0ZPV7 335 Carboxylesterase 1 OS=Act N/A no 0.959 0.349 0.558 1e-30
O64640 329 Probable carboxylesterase no no 0.860 0.319 0.471 2e-25
Q9LT10 335 Probable carboxylesterase no no 0.909 0.331 0.379 7e-18
Q9LFR7 344 Probable carboxylesterase no no 0.901 0.319 0.422 7e-18
O64641 324 Probable carboxylesterase no no 0.967 0.364 0.391 2e-17
Q9SX25 336 Probable carboxylesterase no no 0.696 0.252 0.430 1e-14
Q9LMA7 318 Probable carboxylesterase no no 0.967 0.371 0.338 5e-14
Q9SMM9 329 Probable carboxylesterase no no 0.959 0.355 0.377 6e-14
Q9FX93 374 Probable carboxylesterase no no 0.926 0.302 0.387 7e-14
>sp|Q9LVB8|CXE20_ARATH Probable carboxylesterase 120 OS=Arabidopsis thaliana GN=CXE20 PE=2 SV=1 Back     alignment and function desciption
 Score =  142 bits (359), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 87/120 (72%), Gaps = 2/120 (1%)

Query: 5   NADGTITRDYSNYPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDSS--TKT 62
           N DG+ITRD SN+P TAATPDP+    AVSKD+PVNQ   TW+R++LP  A++    +  
Sbjct: 19  NPDGSITRDLSNFPCTAATPDPSPLNPAVSKDLPVNQLKSTWLRLYLPSSAVNEGNVSSQ 78

Query: 63  KLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALE 122
           KLP++VY HGG  IL S   +++HD CS++A  + A++VS  YRLAPEHRLPAAY D +E
Sbjct: 79  KLPIVVYYHGGGFILCSVDMQLFHDFCSEVARDLNAIVVSPSYRLAPEHRLPAAYDDGVE 138




Carboxylesterase acting on esters with varying acyl chain length.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 1
>sp|Q0ZPV7|CXE1_ACTER Carboxylesterase 1 OS=Actinidia eriantha GN=CXE1 PE=1 SV=1 Back     alignment and function description
>sp|O64640|CXE8_ARATH Probable carboxylesterase 8 OS=Arabidopsis thaliana GN=CXE8 PE=2 SV=1 Back     alignment and function description
>sp|Q9LT10|CXE18_ARATH Probable carboxylesterase 18 OS=Arabidopsis thaliana GN=CXE18 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFR7|CXE17_ARATH Probable carboxylesterase 17 OS=Arabidopsis thaliana GN=CXE17 PE=2 SV=1 Back     alignment and function description
>sp|O64641|CXE9_ARATH Probable carboxylesterase 9 OS=Arabidopsis thaliana GN=CXE9 PE=2 SV=1 Back     alignment and function description
>sp|Q9SX25|CXE6_ARATH Probable carboxylesterase 6 OS=Arabidopsis thaliana GN=CXE6 PE=2 SV=1 Back     alignment and function description
>sp|Q9LMA7|CXE1_ARATH Probable carboxylesterase 1 OS=Arabidopsis thaliana GN=CXE1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SMM9|CXE13_ARATH Probable carboxylesterase 13 OS=Arabidopsis thaliana GN=CXE13 PE=2 SV=1 Back     alignment and function description
>sp|Q9FX93|CXE4_ARATH Probable carboxylesterase 4 OS=Arabidopsis thaliana GN=CXE4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
224136894 333 predicted protein [Populus trichocarpa] 0.991 0.363 0.622 2e-36
297797183 327 hypothetical protein ARALYDRAFT_496395 [ 0.983 0.366 0.553 8e-33
15241725 327 carboxyesterase 20 [Arabidopsis thaliana 0.967 0.360 0.55 2e-32
255539621 325 Gibberellin receptor GID1, putative [Ric 0.991 0.372 0.56 1e-31
359490219 245 PREDICTED: probable carboxylesterase 120 0.959 0.477 0.544 4e-30
82697959 312 CXE carboxylesterase, partial [Actinidia 0.975 0.381 0.557 6e-30
225468141 326 PREDICTED: probable carboxylesterase 120 0.983 0.368 0.523 2e-29
225455637 312 PREDICTED: probable carboxylesterase 120 0.959 0.375 0.520 3e-29
296084083 295 unnamed protein product [Vitis vinifera] 0.959 0.396 0.520 5e-29
122236529 335 RecName: Full=Carboxylesterase 1; Short= 0.959 0.349 0.558 6e-29
>gi|224136894|ref|XP_002322442.1| predicted protein [Populus trichocarpa] gi|222869438|gb|EEF06569.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 93/122 (76%), Gaps = 1/122 (0%)

Query: 2   FIVNADGTITRDYSNYPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQAL-DSST 60
            I N DGTITRD + YP+++ +PDP D T  +SKD+ VNQS KTWVRIFLPRQ + DSS+
Sbjct: 21  IIPNHDGTITRDPNRYPNSSPSPDPKDPTPVLSKDIIVNQSEKTWVRIFLPRQTIVDSSS 80

Query: 61  KTKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDA 120
            +KLPLIVY HGG  I  SA++ ++HD CS +   +  VIVSVDYRLAPEHRLPAAY DA
Sbjct: 81  TSKLPLIVYFHGGGFINCSASSTVFHDFCSSMVLDLHVVIVSVDYRLAPEHRLPAAYDDA 140

Query: 121 LE 122
           +E
Sbjct: 141 ME 142




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297797183|ref|XP_002866476.1| hypothetical protein ARALYDRAFT_496395 [Arabidopsis lyrata subsp. lyrata] gi|297312311|gb|EFH42735.1| hypothetical protein ARALYDRAFT_496395 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15241725|ref|NP_201024.1| carboxyesterase 20 [Arabidopsis thaliana] gi|75180635|sp|Q9LVB8.1|CXE20_ARATH RecName: Full=Probable carboxylesterase 120; AltName: Full=AtCXE20 gi|8809631|dbj|BAA97182.1| HSR203J protein-like protein [Arabidopsis thaliana] gi|332010195|gb|AED97578.1| carboxyesterase 20 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255539621|ref|XP_002510875.1| Gibberellin receptor GID1, putative [Ricinus communis] gi|223549990|gb|EEF51477.1| Gibberellin receptor GID1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359490219|ref|XP_003634052.1| PREDICTED: probable carboxylesterase 120-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|82697959|gb|ABB89014.1| CXE carboxylesterase, partial [Actinidia arguta] Back     alignment and taxonomy information
>gi|225468141|ref|XP_002267455.1| PREDICTED: probable carboxylesterase 120 [Vitis vinifera] gi|297741146|emb|CBI31877.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225455637|ref|XP_002271453.1| PREDICTED: probable carboxylesterase 120-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296084083|emb|CBI24471.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|122236529|sp|Q0ZPV7.1|CXE1_ACTER RecName: Full=Carboxylesterase 1; Short=AeCXE1 gi|82697957|gb|ABB89013.1| CXE carboxylesterase [Actinidia eriantha] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
TAIR|locus:2174033 327 CXE20 "carboxyesterase 20" [Ar 0.967 0.360 0.55 1.1e-32
TAIR|locus:2043644 329 AT2G45600 [Arabidopsis thalian 0.877 0.325 0.478 5.3e-24
TAIR|locus:2146097 344 CXE17 "AT5G16080" [Arabidopsis 0.893 0.316 0.426 2.1e-18
TAIR|locus:2043654 324 AT2G45610 [Arabidopsis thalian 0.967 0.364 0.391 2.8e-18
TAIR|locus:2171681 335 CXE18 "carboxyesterase 18" [Ar 0.909 0.331 0.379 2.7e-17
TAIR|locus:2012196 315 AT1G49640 [Arabidopsis thalian 0.942 0.365 0.385 1.4e-15
TAIR|locus:2144083 329 AT5G06570 [Arabidopsis thalian 0.909 0.337 0.373 1.4e-15
TAIR|locus:2114480 329 CXE13 "carboxyesterase 13" [Ar 0.959 0.355 0.377 2.4e-15
TAIR|locus:2012227 319 CXE5 "carboxyesterase 5" [Arab 0.901 0.344 0.380 9.9e-15
TAIR|locus:2202190 318 AT1G19190 [Arabidopsis thalian 0.844 0.323 0.359 1.3e-14
TAIR|locus:2174033 CXE20 "carboxyesterase 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 357 (130.7 bits), Expect = 1.1e-32, P = 1.1e-32
 Identities = 66/120 (55%), Positives = 87/120 (72%)

Query:     5 NADGTITRDYSNYPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDSS--TKT 62
             N DG+ITRD SN+P TAATPDP+    AVSKD+PVNQ   TW+R++LP  A++    +  
Sbjct:    19 NPDGSITRDLSNFPCTAATPDPSPLNPAVSKDLPVNQLKSTWLRLYLPSSAVNEGNVSSQ 78

Query:    63 KLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALE 122
             KLP++VY HGG  IL S   +++HD CS++A  + A++VS  YRLAPEHRLPAAY D +E
Sbjct:    79 KLPIVVYYHGGGFILCSVDMQLFHDFCSEVARDLNAIVVSPSYRLAPEHRLPAAYDDGVE 138




GO:0005634 "nucleus" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0004091 "carboxylesterase activity" evidence=IDA
TAIR|locus:2043644 AT2G45600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146097 CXE17 "AT5G16080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043654 AT2G45610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171681 CXE18 "carboxyesterase 18" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012196 AT1G49640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144083 AT5G06570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114480 CXE13 "carboxyesterase 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012227 CXE5 "carboxyesterase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202190 AT1G19190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pm.C_LG_XV000431
hypothetical protein (333 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pm.C_scaffold_123000024
hypothetical protein (377 aa)
       0.412

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
pfam07859 207 pfam07859, Abhydrolase_3, alpha/beta hydrolase fol 4e-21
COG0657 312 COG0657, Aes, Esterase/lipase [Lipid metabolism] 6e-15
COG2272 491 COG2272, PnbA, Carboxylesterase type B [Lipid meta 1e-07
pfam00135 510 pfam00135, COesterase, Carboxylesterase family 2e-06
PRK10162 318 PRK10162, PRK10162, acetyl esterase; Provisional 3e-06
cd00312 493 cd00312, Esterase_lipase, Esterases and lipases (i 3e-05
pfam03403 372 pfam03403, PAF-AH_p_II, Platelet-activating factor 8e-04
>gnl|CDD|219611 pfam07859, Abhydrolase_3, alpha/beta hydrolase fold Back     alignment and domain information
 Score = 83.4 bits (207), Expect = 4e-21
 Identities = 31/56 (55%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 67  IVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALE 122
           +VY HGG  +L SA T  +  LC  +AA   AV+VSVDYRLAPEH  PAA  DA  
Sbjct: 1   LVYFHGGGFVLGSADT--HDRLCRRLAAAAGAVVVSVDYRLAPEHPFPAAIEDAYA 54


This catalytic domain is found in a very wide range of enzymes. Length = 207

>gnl|CDD|223730 COG0657, Aes, Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|225181 COG2272, PnbA, Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|215741 pfam00135, COesterase, Carboxylesterase family Back     alignment and domain information
>gnl|CDD|236660 PRK10162, PRK10162, acetyl esterase; Provisional Back     alignment and domain information
>gnl|CDD|238191 cd00312, Esterase_lipase, Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>gnl|CDD|217536 pfam03403, PAF-AH_p_II, Platelet-activating factor acetylhydrolase, isoform II Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 122
KOG1515 336 consensus Arylacetamide deacetylase [Defense mecha 99.97
COG0657 312 Aes Esterase/lipase [Lipid metabolism] 99.81
PRK10162 318 acetyl esterase; Provisional 99.8
PF07859 211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 99.67
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 99.61
PF00135 535 COesterase: Carboxylesterase family The prints ent 99.46
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 99.44
KOG4388 880 consensus Hormone-sensitive lipase HSL [Lipid tran 99.42
KOG4627 270 consensus Kynurenine formamidase [Amino acid trans 99.2
KOG1516 545 consensus Carboxylesterase and related proteins [G 99.11
KOG4389 601 consensus Acetylcholinesterase/Butyrylcholinestera 99.03
PF10340 374 DUF2424: Protein of unknown function (DUF2424); In 98.98
PLN00021 313 chlorophyllase 98.26
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 98.19
TIGR01840 212 esterase_phb esterase, PHB depolymerase family. Th 97.95
PRK10115 686 protease 2; Provisional 97.65
TIGR02821 275 fghA_ester_D S-formylglutathione hydrolase. This m 97.48
PRK10566 249 esterase; Provisional 97.47
KOG2564 343 consensus Predicted acetyltransferases and hydrola 97.2
PLN02442 283 S-formylglutathione hydrolase 97.17
PLN02385 349 hydrolase; alpha/beta fold family protein 97.1
PLN02652 395 hydrolase; alpha/beta fold family protein 97.04
PF03403 379 PAF-AH_p_II: Platelet-activating factor acetylhydr 97.03
PLN02298 330 hydrolase, alpha/beta fold family protein 97.01
TIGR03101 266 hydr2_PEP hydrolase, ortholog 2, exosortase system 96.97
PF10503 220 Esterase_phd: Esterase PHB depolymerase 96.92
PF05448 320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 96.9
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 96.79
PF12740 259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 96.75
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 96.74
PRK05077 414 frsA fermentation/respiration switch protein; Revi 96.7
PHA02857 276 monoglyceride lipase; Provisional 96.67
TIGR03100 274 hydr1_PEP hydrolase, ortholog 1, exosortase system 96.66
PRK10985 324 putative hydrolase; Provisional 96.46
PRK00870 302 haloalkane dehalogenase; Provisional 96.41
PLN02511 388 hydrolase 96.24
KOG4391 300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 96.06
KOG3847 399 consensus Phospholipase A2 (platelet-activating fa 95.97
COG3509 312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 95.84
COG4099 387 Predicted peptidase [General function prediction o 95.79
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 95.7
KOG1455 313 consensus Lysophospholipase [Lipid transport and m 95.61
PF12715 390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 95.54
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 95.15
PRK10673 255 acyl-CoA esterase; Provisional 95.11
PLN02211 273 methyl indole-3-acetate methyltransferase 95.1
cd00707 275 Pancreat_lipase_like Pancreatic lipase-like enzyme 94.9
PF07224 307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 94.83
TIGR03343 282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 94.79
PF01738 218 DLH: Dienelactone hydrolase family; InterPro: IPR0 94.62
PRK10749 330 lysophospholipase L2; Provisional 94.59
KOG2100 755 consensus Dipeptidyl aminopeptidase [Posttranslati 94.53
PLN02872 395 triacylglycerol lipase 94.52
PF00756 251 Esterase: Putative esterase; InterPro: IPR000801 T 94.5
PRK10439 411 enterobactin/ferric enterobactin esterase; Provisi 94.32
COG0412 236 Dienelactone hydrolase and related enzymes [Second 94.27
PLN02824 294 hydrolase, alpha/beta fold family protein 94.2
TIGR03611 257 RutD pyrimidine utilization protein D. This protei 94.02
PLN02894 402 hydrolase, alpha/beta fold family protein 93.98
TIGR01836 350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 93.97
COG0429 345 Predicted hydrolase of the alpha/beta-hydrolase fo 93.83
PF12697 228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 93.77
KOG3101 283 consensus Esterase D [General function prediction 93.71
TIGR03695 251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 93.65
KOG2281 867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 93.64
TIGR03056 278 bchO_mg_che_rel putative magnesium chelatase acces 93.54
TIGR02427 251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 93.25
PLN03084 383 alpha/beta hydrolase fold protein; Provisional 93.01
COG3458 321 Acetyl esterase (deacetylase) [Secondary metabolit 92.76
PLN02965 255 Probable pheophorbidase 92.43
PF07082 250 DUF1350: Protein of unknown function (DUF1350); In 92.13
PF02129 272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 92.08
TIGR03502 792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 92.07
TIGR01738 245 bioH putative pimeloyl-BioC--CoA transferase BioH. 91.93
PRK13604 307 luxD acyl transferase; Provisional 91.75
COG2936 563 Predicted acyl esterases [General function predict 91.56
COG4188 365 Predicted dienelactone hydrolase [General function 91.36
PRK11126 242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 91.35
PF0408363 Abhydro_lipase: Partial alpha/beta-hydrolase lipas 91.17
TIGR02240 276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 91.11
PRK05855 582 short chain dehydrogenase; Validated 91.02
PF10142 367 PhoPQ_related: PhoPQ-activated pathogenicity-relat 90.73
PRK06489 360 hypothetical protein; Provisional 90.64
PRK10349 256 carboxylesterase BioH; Provisional 90.39
KOG1838 409 consensus Alpha/beta hydrolase [General function p 90.34
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 90.25
COG2267 298 PldB Lysophospholipase [Lipid metabolism] 89.34
PRK03592 295 haloalkane dehalogenase; Provisional 89.21
COG2382 299 Fes Enterochelin esterase and related enzymes [Ino 89.12
KOG1552 258 consensus Predicted alpha/beta hydrolase [General 88.55
PRK03204 286 haloalkane dehalogenase; Provisional 88.36
PLN03087 481 BODYGUARD 1 domain containing hydrolase; Provision 88.16
PF11144 403 DUF2920: Protein of unknown function (DUF2920); In 87.69
PRK11460 232 putative hydrolase; Provisional 87.41
PLN02679 360 hydrolase, alpha/beta fold family protein 87.29
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 87.21
PF00151 331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 86.85
TIGR01249 306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 84.68
KOG2382 315 consensus Predicted alpha/beta hydrolase [General 83.11
PLN02578 354 hydrolase 82.12
KOG4178 322 consensus Soluble epoxide hydrolase [Lipid transpo 80.6
PF1068671 DUF2493: Protein of unknown function (DUF2493); In 80.38
PRK07581 339 hypothetical protein; Validated 80.27
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
Probab=99.97  E-value=1.1e-30  Score=192.22  Aligned_cols=117  Identities=38%  Similarity=0.671  Sum_probs=107.5

Q ss_pred             CeEEccCCcEEecCCCCCCCCCCCCCCCCCceEEeeEEecCCCCEEEEEEeeCCCCCCCCCCCccEEEEEeCCeeEeeCC
Q 042985            1 MFIVNADGTITRDYSNYPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDSSTKTKLPLIVYVHGGALILLSA   80 (122)
Q Consensus         1 ~~~~~~~g~~~r~~~~~~~~~~~~~p~~~~~v~~~~v~~~~~~~~~~~iy~P~~~~~~~~~~~~pvvv~iHGGg~~~g~~   80 (122)
                      .++++++|+++|.....+.+++.++|.++  +..+++.+....++.++||.|......   .+.|+|||||||||+.|+.
T Consensus        32 ~i~i~~~~~~~r~~~~~~~~p~~~~p~~~--v~~~dv~~~~~~~l~vRly~P~~~~~~---~~~p~lvyfHGGGf~~~S~  106 (336)
T KOG1515|consen   32 NIRIFKDGSFERFFGRFDKVPPSSDPVNG--VTSKDVTIDPFTNLPVRLYRPTSSSSE---TKLPVLVYFHGGGFCLGSA  106 (336)
T ss_pred             hceeecCCceeeeecccccCCCCCCcccC--ceeeeeEecCCCCeEEEEEcCCCCCcc---cCceEEEEEeCCccEeCCC
Confidence            37899999999988335899999999977  999999999999999999999987654   6899999999999999998


Q ss_pred             CchhhHHHHHHHHhcCCcEEEEEcCCCCCCCCCCchhhhhhC
Q 042985           81 ATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALE  122 (122)
Q Consensus        81 ~~~~~~~~~~~la~~~g~~vv~v~YRlaPe~~~P~~~~D~~~  122 (122)
                      ....|+.+|.++|.+++++||+||||||||++||++++||++
T Consensus       107 ~~~~y~~~~~~~a~~~~~vvvSVdYRLAPEh~~Pa~y~D~~~  148 (336)
T KOG1515|consen  107 NSPAYDSFCTRLAAELNCVVVSVDYRLAPEHPFPAAYDDGWA  148 (336)
T ss_pred             CCchhHHHHHHHHHHcCeEEEecCcccCCCCCCCccchHHHH
Confidence            888899999999999999999999999999999999999974



>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>KOG4388 consensus Hormone-sensitive lipase HSL [Lipid transport and metabolism] Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] Back     alignment and domain information
>KOG4389 consensus Acetylcholinesterase/Butyrylcholinesterase [Signal transduction mechanisms] Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PF10686 DUF2493: Protein of unknown function (DUF2493); InterPro: IPR019627 This entry is represented by Mycobacteriophage D29, Gp61 Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
2o7r_A 338 Plant Carboxylesterase Aecxe1 From Actinidia Eriant 1e-31
3ebl_A 365 Crystal Structure Of Rice Gid1 Complexed With Ga4 L 3e-11
2yh2_A 313 Pyrobaculum Calidifontis Esterase Monoclinic Form L 6e-11
1jji_A 311 The Crystal Structure Of A Hyper-Thermophilic Carbo 8e-10
2c7b_A 311 The Crystal Structure Of Este1, A New Thermophilic 2e-09
2zsh_A 351 Structural Basis Of Gibberellin(Ga3)-Induced Della 2e-09
3qh4_A 317 Crystal Structure Of Esterase Lipw From Mycobacteri 5e-09
3ain_A 323 R267g Mutant Of A Hsl-Like Carboxylesterase From Su 8e-08
3aim_A 323 R267e Mutant Of A Hsl-Like Carboxylesterase From Su 8e-08
3aio_A 323 R267k Mutant Of A Hsl-Like Carboxylesterase From Su 8e-08
3aik_A 323 Crystal Structure Of A Hsl-Like Carboxylesterase Fr 8e-08
1qz3_A 310 Crystal Structure Of Mutant M211sR215L OF CARBOXYLE 1e-07
2hm7_A 310 Crystal Structure Analysis Of The G84s Est2 Mutant 1e-07
1evq_A 310 The Crystal Structure Of The Thermophilic Carboxyle 2e-07
1c7i_A 489 Thermophylic Pnb Esterase Length = 489 5e-06
1jkm_B 361 Brefeldin A Esterase, A Bacterial Homologue Of Huma 1e-05
1qe3_A 489 Pnb Esterase Length = 489 2e-05
1c7j_A 489 Pnb Esterase 56c8 Length = 489 2e-05
3dnm_A 336 Crystal Structure Hormone-Sensitive Lipase From A M 5e-05
3k6k_A 322 Crystal Structure At 2.2 Angstrom Of Hsl-Homolog Es 5e-05
3fak_A 322 Structural And Functional Analysis Of A Hormone-Sen 8e-05
3v9a_A 309 Crystal Structure Of EsteraseLIPASE FROM UNCULTURED 1e-04
3k9b_A 529 Crystal Structure Of Human Liver Carboxylesterase 1 6e-04
1ya4_A 532 Crystal Structure Of Human Liver Carboxylesterase 1 6e-04
1mx1_A 548 Crystal Structure Of Human Liver Carboxylesterase I 7e-04
2dqy_A 542 Crystal Structure Of Human Carboxylesterase In Comp 7e-04
1lzk_A 323 Bacterial Heroin Esterase Complex With Transition S 8e-04
1lzl_A 323 Bacterial Heroin Esterase Length = 323 8e-04
>pdb|2O7R|A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct Length = 338 Back     alignment and structure

Iteration: 1

Score = 131 bits (329), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 67/120 (55%), Positives = 85/120 (70%), Gaps = 3/120 (2%) Query: 3 IVNADGTITRDYSNYPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDSSTKT 62 ++N D TITR PSTAA+PDP + ++KD+ +N + T+VR+FLPR AL +S K Sbjct: 25 VLNPDRTITRPI-QIPSTAASPDPTSSSPVLTKDLALNPLHNTFVRLFLPRHALYNSAK- 82 Query: 63 KLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALE 122 LPL+VY HGG IL SAA+ I+HD C ++A VI SVDYRLAPEHRLPAAY DA+E Sbjct: 83 -LPLVVYFHGGGFILFSAASTIFHDFCCEMAVHAGVVIASVDYRLAPEHRLPAAYDDAME 141
>pdb|3EBL|A Chain A, Crystal Structure Of Rice Gid1 Complexed With Ga4 Length = 365 Back     alignment and structure
>pdb|2YH2|A Chain A, Pyrobaculum Calidifontis Esterase Monoclinic Form Length = 313 Back     alignment and structure
>pdb|1JJI|A Chain A, The Crystal Structure Of A Hyper-Thermophilic Carboxylesterase From The Archaeon Archaeoglobus Fulgidus Length = 311 Back     alignment and structure
>pdb|2C7B|A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library Length = 311 Back     alignment and structure
>pdb|2ZSH|A Chain A, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor Length = 351 Back     alignment and structure
>pdb|3QH4|A Chain A, Crystal Structure Of Esterase Lipw From Mycobacterium Marinum Length = 317 Back     alignment and structure
>pdb|3AIN|A Chain A, R267g Mutant Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 Back     alignment and structure
>pdb|3AIM|A Chain A, R267e Mutant Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 Back     alignment and structure
>pdb|3AIO|A Chain A, R267k Mutant Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 Back     alignment and structure
>pdb|3AIK|A Chain A, Crystal Structure Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 Back     alignment and structure
>pdb|1QZ3|A Chain A, Crystal Structure Of Mutant M211sR215L OF CARBOXYLESTERASE Est2 Complexed With Hexadecanesulfonate Length = 310 Back     alignment and structure
>pdb|2HM7|A Chain A, Crystal Structure Analysis Of The G84s Est2 Mutant Length = 310 Back     alignment and structure
>pdb|1EVQ|A Chain A, The Crystal Structure Of The Thermophilic Carboxylesterase Est2 From Alicyclobacillus Acidocaldarius Length = 310 Back     alignment and structure
>pdb|1C7I|A Chain A, Thermophylic Pnb Esterase Length = 489 Back     alignment and structure
>pdb|1JKM|B Chain B, Brefeldin A Esterase, A Bacterial Homologue Of Human Hormone Sensitive Lipase Length = 361 Back     alignment and structure
>pdb|1QE3|A Chain A, Pnb Esterase Length = 489 Back     alignment and structure
>pdb|1C7J|A Chain A, Pnb Esterase 56c8 Length = 489 Back     alignment and structure
>pdb|3DNM|A Chain A, Crystal Structure Hormone-Sensitive Lipase From A Metagenome Library Length = 336 Back     alignment and structure
>pdb|3K6K|A Chain A, Crystal Structure At 2.2 Angstrom Of Hsl-Homolog Este7 From A Metagenome Library Length = 322 Back     alignment and structure
>pdb|3FAK|A Chain A, Structural And Functional Analysis Of A Hormone-Sensitive Lipase Like Este5 From A Metagenome Library Length = 322 Back     alignment and structure
>pdb|3V9A|A Chain A, Crystal Structure Of EsteraseLIPASE FROM UNCULTURED BACTERIUM Length = 309 Back     alignment and structure
>pdb|3K9B|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 (Hce1) In Covalent Complex With The Nerve Agent Cyclosarin (Gf) Length = 529 Back     alignment and structure
>pdb|1YA4|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 In Complex With Tamoxifen Length = 532 Back     alignment and structure
>pdb|1MX1|A Chain A, Crystal Structure Of Human Liver Carboxylesterase In Complex With Tacrine Length = 548 Back     alignment and structure
>pdb|2DQY|A Chain A, Crystal Structure Of Human Carboxylesterase In Complex With Cholate And Palmitate Length = 542 Back     alignment and structure
>pdb|1LZK|A Chain A, Bacterial Heroin Esterase Complex With Transition State Analog Dimethylarsenic Acid Length = 323 Back     alignment and structure
>pdb|1LZL|A Chain A, Bacterial Heroin Esterase Length = 323 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 2e-44
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 8e-42
3ebl_A 365 Gibberellin receptor GID1; alpha/beta hydrolase, l 4e-40
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 1e-19
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 1e-19
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 3e-19
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 4e-19
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 8e-19
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 2e-18
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 2e-18
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 1e-17
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 2e-17
3k6k_A 322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 1e-16
3fak_A 322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 2e-16
3h04_A 275 Uncharacterized protein; protein with unknown func 9e-16
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 3e-15
3d7r_A 326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 1e-14
1vkh_A 273 Putative serine hydrolase; structural genomics, jo 8e-13
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 1e-08
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 2e-07
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 1e-06
2pbl_A 262 Putative esterase/lipase/thioesterase; alpha/beta- 5e-06
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 6e-06
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 7e-06
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 1e-05
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 1e-05
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 2e-05
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 2e-05
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 3e-05
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 6e-05
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 6e-05
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 1e-04
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 3e-04
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 3e-04
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Length = 338 Back     alignment and structure
 Score =  146 bits (371), Expect = 2e-44
 Identities = 67/121 (55%), Positives = 85/121 (70%), Gaps = 3/121 (2%)

Query: 2   FIVNADGTITRDYSNYPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDSSTK 61
            ++N D TITR     PSTAA+PDP   +  ++KD+ +N  + T+VR+FLPR AL +S K
Sbjct: 24  IVLNPDRTITR-PIQIPSTAASPDPTSSSPVLTKDLALNPLHNTFVRLFLPRHALYNSAK 82

Query: 62  TKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDAL 121
             LPL+VY HGG  IL SAA+ I+HD C ++A     VI SVDYRLAPEHRLPAAY DA+
Sbjct: 83  --LPLVVYFHGGGFILFSAASTIFHDFCCEMAVHAGVVIASVDYRLAPEHRLPAAYDDAM 140

Query: 122 E 122
           E
Sbjct: 141 E 141


>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Length = 351 Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Length = 365 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Length = 311 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Length = 310 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Length = 323 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Length = 323 Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Length = 317 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Length = 311 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Length = 326 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Length = 274 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Length = 322 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Length = 322 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Length = 275 Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Length = 361 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Length = 326 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Length = 273 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Length = 303 Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Length = 585 Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Length = 551 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Length = 262 Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Length = 498 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Length = 489 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Length = 579 Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Length = 574 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Length = 277 Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Length = 529 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Length = 543 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Length = 537 Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Length = 522 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Length = 544 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Length = 534 Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Length = 542 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
3ebl_A 365 Gibberellin receptor GID1; alpha/beta hydrolase, l 99.88
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 99.86
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 99.8
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 99.75
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 99.74
3fak_A 322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 99.7
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.69
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 99.68
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 99.65
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 99.62
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 99.6
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 99.58
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 99.58
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 99.57
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 99.56
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.56
3k6k_A 322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 99.55
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 99.55
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 99.55
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 99.54
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 99.54
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 99.53
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 99.51
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 99.48
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 99.46
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 99.42
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 99.41
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 99.4
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 99.39
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 99.38
3d7r_A 326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.36
2pbl_A 262 Putative esterase/lipase/thioesterase; alpha/beta- 99.35
1vkh_A 273 Putative serine hydrolase; structural genomics, jo 99.25
3bjr_A 283 Putative carboxylesterase; structural genomics, jo 99.2
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 99.2
3h04_A 275 Uncharacterized protein; protein with unknown func 99.05
1l7a_A 318 Cephalosporin C deacetylase; structural genomics, 98.74
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.66
2fuk_A 220 XC6422 protein; A/B hydrolase, structural genomics 98.63
1vlq_A 337 Acetyl xylan esterase; TM0077, structural genomics 98.58
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 98.56
3fcy_A 346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 98.54
3trd_A 208 Alpha/beta hydrolase; cellular processes; 1.50A {C 98.52
4ao6_A 259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 98.51
3fcx_A 282 FGH, esterase D, S-formylglutathione hydrolase; re 98.5
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 98.4
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.39
2uz0_A 263 Esterase, tributyrin esterase; alpha/beta hydrolas 98.27
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.26
1jjf_A 268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 98.23
2i3d_A 249 AGR_C_3351P, hypothetical protein ATU1826; structu 98.2
3ls2_A 280 S-formylglutathione hydrolase; psychrophilic organ 98.2
3f67_A 241 Putative dienelactone hydrolase; alpha-beta-alpha 98.19
3nuz_A 398 Putative acetyl xylan esterase; structural genomic 98.18
3i6y_A 280 Esterase APC40077; lipase, structural genomics, PS 98.18
4b6g_A 283 Putative esterase; hydrolase, formaldehyde detoxif 98.17
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.14
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 98.13
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 98.13
3d0k_A 304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 98.1
3hlk_A 446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 98.1
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.08
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.08
2fx5_A 258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 98.08
2qm0_A 275 BES; alpha-beta structure, structural genomics, PS 98.07
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 98.06
3g8y_A 391 SUSD/RAGB-associated esterase-like protein; struct 98.06
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.05
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.04
3e4d_A 278 Esterase D; S-formylglutathione hydrolase, hydrola 98.04
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.0
1gkl_A 297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 98.0
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.99
3k2i_A 422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 97.97
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 97.96
3pfb_A 270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 97.96
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 97.93
3vis_A 306 Esterase; alpha/beta-hydrolase fold, polyethylene 97.93
2o2g_A 223 Dienelactone hydrolase; YP_324580.1, structural ge 97.86
3mve_A 415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 97.79
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.76
3doh_A 380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 97.72
1zi8_A 236 Carboxymethylenebutenolidase; alpha and beta prote 97.71
3c8d_A 403 Enterochelin esterase; alpha-beta-alpha sandwich, 97.7
2jbw_A 386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 97.7
1jfr_A 262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 97.68
3llc_A 270 Putative hydrolase; structural genomics, joint cen 97.67
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 97.61
1ufo_A 238 Hypothetical protein TT1662; alpha-beta fold, hydr 97.59
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 97.52
3bdi_A 207 Uncharacterized protein TA0194; NP_393672.1, predi 97.5
3d59_A 383 Platelet-activating factor acetylhydrolase; secret 97.41
2wtm_A 251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 97.35
1imj_A 210 CIB, CCG1-interacting factor B; alpha/beta hydrola 97.34
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 97.29
2gzs_A 278 IROE protein; enterobactin, salmochelin, DFP, hydr 97.27
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 97.24
1auo_A 218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 97.21
4ezi_A 377 Uncharacterized protein; alpha-beta hydrolases fol 97.14
1qlw_A 328 Esterase; anisotropic refinement, atomic resolutio 97.06
2qjw_A 176 Uncharacterized protein XCC1541; putative hydrolas 97.05
1sfr_A 304 Antigen 85-A; alpha/beta hydrolase, structural gen 96.97
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 96.96
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 96.91
3cn9_A 226 Carboxylesterase; alpha/beta hydrolase fold super- 96.85
1uxo_A 192 YDEN protein; hydrolase, A/B hydrolase, esterase, 96.81
3dkr_A 251 Esterase D; alpha beta hydrolase, mechanism, catal 96.81
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 96.74
3sty_A 267 Methylketone synthase 1; alpha/beta hydrolase, dec 96.74
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 96.73
1fj2_A 232 Protein (acyl protein thioesterase 1); alpha/beta 96.72
2h1i_A 226 Carboxylesterase; structural genomics, PSI-2, prot 96.69
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 96.67
3b5e_A 223 MLL8374 protein; NP_108484.1, carboxylesterase, st 96.65
3rm3_A 270 MGLP, thermostable monoacylglycerol lipase; alpha/ 96.59
3fnb_A 405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 96.55
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 96.5
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 96.4
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 96.38
3og9_A 209 Protein YAHD A copper inducible hydrolase; alpha/b 96.28
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 96.25
2qs9_A 194 Retinoblastoma-binding protein 9; B5T overexpresse 96.25
3dqz_A 258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 96.23
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 96.21
1r88_A 280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 96.19
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 96.19
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 96.15
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 96.09
3u0v_A 239 Lysophospholipase-like protein 1; alpha, beta hydr 96.09
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 96.03
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 95.99
2wfl_A 264 Polyneuridine-aldehyde esterase; alkaloid metaboli 95.99
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 95.95
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 95.94
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 95.9
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 95.83
3fla_A 267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 95.82
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 95.81
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 95.79
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 95.71
4fbl_A 281 LIPS lipolytic enzyme; thermostable, structural ge 95.64
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 95.64
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 95.59
1r3d_A 264 Conserved hypothetical protein VC1974; structural 95.53
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 95.52
2ocg_A 254 Valacyclovir hydrolase; alpha beta hydrolase fold; 95.5
1isp_A 181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 95.48
2r8b_A 251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 95.47
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 95.46
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 95.45
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 95.41
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 95.4
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 95.4
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 95.38
4fol_A 299 FGH, S-formylglutathione hydrolase; D-type esteras 95.36
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 95.22
3qmv_A 280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 95.21
3e0x_A 245 Lipase-esterase related protein; APC60309, clostri 95.2
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 95.19
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 95.11
4dnp_A 269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 95.1
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 95.08
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 95.06
1tqh_A 247 Carboxylesterase precursor; tetrahedral intermedia 94.97
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 94.9
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 94.73
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 94.54
1tca_A 317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 94.39
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 94.39
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 94.34
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 94.29
2xt0_A 297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 94.27
4fle_A 202 Esterase; structural genomics, PSI-biology, northe 94.26
3c6x_A 257 Hydroxynitrilase; atomic resolution, hydroxynitril 94.22
1dqz_A 280 85C, protein (antigen 85-C); fibronectin, structur 94.21
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 94.11
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 94.05
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 94.01
2qmq_A 286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 93.98
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 93.86
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 93.71
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 93.7
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 93.67
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 93.63
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 93.57
4fhz_A 285 Phospholipase/carboxylesterase; alpha/beta hydrola 93.44
3gff_A 331 IROE-like serine hydrolase; NP_718593.1, structura 93.41
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 93.35
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 93.29
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 93.26
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 93.24
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 93.12
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 92.93
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 92.72
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 91.81
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 92.59
1ycd_A 243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 92.33
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 92.26
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 92.21
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 92.2
2puj_A 286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 92.19
1ex9_A 285 Lactonizing lipase; alpha-beta hydrolase fold, pho 92.05
4h0c_A 210 Phospholipase/carboxylesterase; PSI-biology, midwe 92.03
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 91.9
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 91.82
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 91.71
3qyj_A 291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 91.65
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 91.01
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 90.77
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 90.74
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 90.69
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 89.97
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 89.77
3pic_A 375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 89.6
3icv_A 316 Lipase B, CALB; circular permutation, cleavage on 89.59
2q0x_A 335 Protein DUF1749, uncharacterized protein; alpha/be 89.35
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 88.61
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 88.57
3lcr_A 319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 88.24
1iup_A 282 META-cleavage product hydrolase; aromatic compound 88.06
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 87.62
3ils_A 265 PKS, aflatoxin biosynthesis polyketide synthase; A 86.92
4f21_A 246 Carboxylesterase/phospholipase family protein; str 86.07
3guu_A 462 Lipase A; protein structure, hydrolase; HET: 1PE; 85.73
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 84.98
1jmk_C 230 SRFTE, surfactin synthetase; thioesterase, non-rib 84.79
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 84.41
3tjm_A 283 Fatty acid synthase; thioesterase domain, fatty ac 84.16
2cb9_A 244 Fengycin synthetase; thioesterase, non-ribosomal p 83.52
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 82.87
2k2q_B 242 Surfactin synthetase thioesterase subunit; A/B-hyd 82.29
2x5x_A 342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 81.75
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
Probab=99.88  E-value=2.6e-23  Score=153.59  Aligned_cols=115  Identities=36%  Similarity=0.567  Sum_probs=95.9

Q ss_pred             EEccCCcEEecCCC--CCCCCCCCCCCCCCceEEeeEEecCCCCEEEEEEe-eCCCC-------------------CCCC
Q 042985            3 IVNADGTITRDYSN--YPSTAATPDPNDHTIAVSKDVPVNQSNKTWVRIFL-PRQAL-------------------DSST   60 (122)
Q Consensus         3 ~~~~~g~~~r~~~~--~~~~~~~~~p~~~~~v~~~~v~~~~~~~~~~~iy~-P~~~~-------------------~~~~   60 (122)
                      .+++||+++|++..  .+.+++.++|..+  +..+|+.+.+.+++.+++|. |....                   ..  
T Consensus        33 ~~~~dg~v~r~~~~~~~~~~~~~~~~~~~--v~~~dv~~~~~~gl~~~~~~~P~~~~~~~~~~~~~~~~l~~~~~~~~--  108 (365)
T 3ebl_A           33 LRRADGTFERDLGEYLDRRVPANARPLEG--VSSFDHIIDQSVGLEVRIYRAAAEGDAEEGAAAVTRPILEFLTDAPA--  108 (365)
T ss_dssp             HBCTTSCBCHHHHHHHSCBCCCCSSCBTT--EEEEEEEEETTTTEEEEEEEEC----------------CGGGGSCCB--
T ss_pred             ccCCCCceEecCcccccCCCCCCCCCCCC--CceeeEEecCCCCceEEEEeCCCccccccccccccccccccccCCCC--
Confidence            46899999997522  3567788888766  99999999999999999998 97530                   11  


Q ss_pred             CCCccEEEEEeCCeeEeeCCCchhhHHHHHHHHhcCCcEEEEEcCCCCCCCCCCchhhhhh
Q 042985           61 KTKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDAL  121 (122)
Q Consensus        61 ~~~~pvvv~iHGGg~~~g~~~~~~~~~~~~~la~~~g~~vv~v~YRlaPe~~~P~~~~D~~  121 (122)
                      .++.|+|||+|||||..|+.....|..++..|+.+.|++|+++|||++|++++|++++|+.
T Consensus       109 ~~~~Pvvv~~HGGg~~~g~~~~~~~~~~~~~la~~~g~~Vv~~dyR~~p~~~~~~~~~D~~  169 (365)
T 3ebl_A          109 AEPFPVIIFFHGGSFVHSSASSTIYDSLCRRFVKLSKGVVVSVNYRRAPEHRYPCAYDDGW  169 (365)
T ss_dssp             SSCCEEEEEECCSTTTSCCTTBHHHHHHHHHHHHHHTSEEEEECCCCTTTSCTTHHHHHHH
T ss_pred             CCcceEEEEEcCCccccCCCchhhHHHHHHHHHHHCCCEEEEeeCCCCCCCCCcHHHHHHH
Confidence            1678999999999999998887667889999999889999999999999999999999986



>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 122
d1vkha_ 263 c.69.1.32 (A:) Putative serine hydrolase Ydr428c { 1e-06
d1jjia_ 311 c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeogl 2e-05
d2bcea_ 579 c.69.1.1 (A:) Bile-salt activated lipase (choleste 3e-04
d1dx4a_ 571 c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Dro 0.002
d2hu7a2 260 c.69.1.33 (A:322-581) Acylamino-acid-releasing enz 0.002
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 263 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Putative serine hydrolase Ydr428c
domain: Putative serine hydrolase Ydr428c
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 43.7 bits (101), Expect = 1e-06
 Identities = 14/61 (22%), Positives = 26/61 (42%), Gaps = 3/61 (4%)

Query: 60  TKTKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPA---VIVSVDYRLAPEHRLPAA 116
           ++     ++Y+HGGA          ++ L + I +          S++YRL+PE   P  
Sbjct: 27  SQNTREAVIYIHGGAWNDPENTPNDFNQLANTIKSMDTESTVCQYSIEYRLSPEITNPRN 86

Query: 117 Y 117
            
Sbjct: 87  L 87


>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 311 Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Length = 579 Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 571 Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Length = 260 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
d1lzla_ 317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.86
d1jkma_ 358 Carboxylesterase {Bacillus subtilis, brefeldin A e 99.86
d1jjia_ 311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 99.85
d2pbla1 261 Uncharacterized protein TM1040_2492 {Silicibacter 99.8
d1u4na_ 308 Carboxylesterase {Alicyclobacillus acidocaldarius 99.8
d1vkha_ 263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.61
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 99.53
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 99.5
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 99.5
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 99.49
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 99.48
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 99.48
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 99.48
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 99.46
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 99.45
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 99.44
d2hu7a2 260 Acylamino-acid-releasing enzyme, C-terminal donain 99.27
d2bgra2 258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 98.94
d1xfda2 258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 98.86
d1qfma2 280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 98.85
d1l7aa_ 318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 98.74
d1vlqa_ 322 Acetyl xylan esterase TM0077 {Thermotoga maritima 98.64
d2gzsa1 265 Enterobactin and salmochelin hydrolase IroE {Esche 98.35
d1jfra_ 260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 98.14
d1ju3a2 347 Bacterial cocaine esterase N-terminal domain {Rhod 98.09
d1ufoa_ 238 Hypothetical protein TT1662 {Thermus thermophilus 97.99
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 97.97
d2jbwa1 360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 97.85
d1qlwa_ 318 A novel bacterial esterase {Alcaligenes sp. [TaxId 97.75
d1wb4a1 273 Feruloyl esterase domain of the cellulosomal xylan 97.69
d1mpxa2 381 Alpha-amino acid ester hydrolase {Xanthomonas citr 97.67
d2fuka1 218 XC6422 protein {Xanthomonas campestris [TaxId: 339 97.58
d2b9va2 385 Alpha-amino acid ester hydrolase {Acetobacter past 97.56
d1dina_ 233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 97.41
d3c8da2 246 Enterochelin esterase, catalytic domain {Shigella 97.34
d2h1ia1 202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 97.32
d1jjfa_ 255 Feruloyl esterase domain of the cellulosomal xylan 97.32
d1sfra_ 288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 97.32
d1r3da_ 264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 97.25
d1tqha_ 242 Carboxylesterase Est {Bacillus stearothermophilus 97.21
d2i3da1 218 Hypothetical protein Atu1826 {Agrobacterium tumefa 97.18
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 97.13
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 97.13
d1a88a_ 275 Chloroperoxidase L {Streptomyces lividans [TaxId: 97.12
d1hkha_ 279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 97.07
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 96.95
d1imja_ 208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 96.85
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 96.63
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 96.57
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 96.52
d1a8sa_ 273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 96.39
d1xkla_ 258 Salicylic acid-binding protein 2 (SABP2) {Common t 96.18
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 95.83
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 95.79
d2r8ba1 203 Uncharacterized protein Atu2452 {Agrobacterium tum 95.78
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 95.66
d3b5ea1 209 Uncharacterized protein Mll8374 {Mesorhizobium lot 95.63
d1c4xa_ 281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 95.57
d1uxoa_ 186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 95.42
d1pv1a_ 299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 95.16
d1uk8a_ 271 Meta-cleavage product hydrolase CumD {Pseudomonas 94.83
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 94.75
d2rhwa1 283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 94.71
d1wm1a_ 313 Proline aminopeptidase {Serratia marcescens [TaxId 94.7
d1m33a_ 256 Biotin biosynthesis protein BioH {Escherichia coli 94.38
d3c70a1 256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 94.23
d1j1ia_ 268 Meta cleavage compound hydrolase CarC {Janthinobac 94.2
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 93.53
d1ex9a_ 285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 93.18
d1dqza_ 280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 93.05
d1fj2a_ 229 Acyl protein thioesterase 1 {Human (Homo sapiens) 92.88
d1lnsa3 405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 92.45
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 91.58
d1jmkc_ 230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 91.45
d1r88a_ 267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 90.99
d1qo7a_ 394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 90.87
d1auoa_ 218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 89.23
d1pjaa_ 268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 88.57
d1rp1a2 337 Pancreatic lipase, N-terminal domain {Dog (Canis f 88.26
d1xkta_ 286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 87.73
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 87.48
d1tcaa_ 317 Triacylglycerol lipase {Yeast (Candida antarctica) 86.88
d1bu8a2 338 Pancreatic lipase, N-terminal domain {Rat (Rattus 82.34
d1ispa_ 179 Lipase A {Bacillus subtilis [TaxId: 1423]} 81.13
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carboxylesterase
domain: Heroin esterase
species: Rhodococcus sp. [TaxId: 1831]
Probab=99.86  E-value=4.5e-22  Score=141.95  Aligned_cols=84  Identities=21%  Similarity=0.520  Sum_probs=74.9

Q ss_pred             eEEeeEEecCCC---CEEEEEEeeCCCCCCCCCCCccEEEEEeCCeeEeeCCCchhhHHHHHHHHhcCCcEEEEEcCCCC
Q 042985           32 AVSKDVPVNQSN---KTWVRIFLPRQALDSSTKTKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLA  108 (122)
Q Consensus        32 v~~~~v~~~~~~---~~~~~iy~P~~~~~~~~~~~~pvvv~iHGGg~~~g~~~~~~~~~~~~~la~~~g~~vv~v~YRla  108 (122)
                      +..+++.+.+.+   .+++++|+|++.+     ++.|+|||||||||+.|+...  +..+++.++.+.|++|+++||||+
T Consensus        48 v~~~~~~~~~~~g~~~i~~~~~~P~~~~-----~~~Pvvv~iHGGG~~~g~~~~--~~~~~~~la~~~G~~V~~vdYrl~  120 (317)
T d1lzla_          48 VSLRELSAPGLDGDPEVKIRFVTPDNTA-----GPVPVLLWIHGGGFAIGTAES--SDPFCVEVARELGFAVANVEYRLA  120 (317)
T ss_dssp             EEEEEEEECCSTTCCCEEEEEEEESSCC-----SCEEEEEEECCSTTTSCCGGG--GHHHHHHHHHHHCCEEEEECCCCT
T ss_pred             ceEEEEEEecCCCCceEEEEEECCCCCC-----CCCcEEEEecCcccccccccc--cchHHHhHHhhcCCcccccccccc
Confidence            888899987654   3899999998654     788999999999999999887  688899999888999999999999


Q ss_pred             CCCCCCchhhhhhC
Q 042985          109 PEHRLPAAYYDALE  122 (122)
Q Consensus       109 Pe~~~P~~~~D~~~  122 (122)
                      ||++||++++|+.+
T Consensus       121 pe~~~~~~~~d~~~  134 (317)
T d1lzla_         121 PETTFPGPVNDCYA  134 (317)
T ss_dssp             TTSCTTHHHHHHHH
T ss_pred             cccccccccccccc
Confidence            99999999999863



>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure