Citrus Sinensis ID: 043008

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------

NYPLRTLPSNFKPKNLVELNLPYGHKVVQIWEGKKRAFKLKFINLSHSQCHIKIPDPSETPNLERIDILNCTNPACVLSSITNFNHLSMLCFRHCKNLRHFPNNLHFVCPIIIDFSYCVNLTEFPQISGNIIDLILTETAIEEVPSSTECLTNLQYLFLCSCKKLKRVSTSICKFKSLVWLSLNNDLTAIPQEIGCLSSLECLNLGGNNFEGLPASIKQISRLECLDLSYCNSLQSLPELPLHLEVLLATNCKRLQSLPEIPSCLEELDASVLEKLSKHSFGEEYRIWSIKFNFTNCLKLMNEEANKKNLADSRLRIQHMAIASLRLFWELRQFSLPLNRYHPLEHRENLKGATIMLPGNNVPEFFINRSSGSEITLQLPQHCCQNLMGFAVCAVLQQIDEERDCFFVDFLMKTLSGRKIVRCYETIALRRQVTKTNVILGFRPLRNVGFPDDNNRTVVPFKFSSQYYVVKCCEVCPFWRRGIGTESQETLQRRPCQHFLRTNINCFGVDISVYTTY

cccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEcccccccccccEEEEcccccccccccccccccHHcccccccEEccccccccccccEEEcccccccccccccccccccccEEccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccEEEEccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEccccccccccccccccEEEEEccccccccccEEEEEEEEEEcccccccEEEEEEEEEccccEEEEEEEEEEccccccccEEEEEEEccccccccccccEEEEEEEEEcccEEEEEEEEEEEEEcccccccHHHHccccccEEEEccccEEEEccEEEEcc

ccccccccccccHHHHEEEcccccHHHHHHHccccccccccEEEccccccHcccccccccccHHEEEccccccHcccccHHHHHHHHHEEEcccccccEEccccccHHHHcEEEccccHHHcccccHHHcHHEEEcccccEEEccccHHHccccEEEEcccccccccccccHHcHHHHHHEcccccccccccccccccccEEEEccccccccccccHHHHHcccEEEccccccccccccccccccEEEccccccHcccccccHHHHHHHHcccccccccccccccccccEEEEccccHHHHccccccHHHHHHHHHHHHHHHHHcccccHHHcccHHHHHHHHHcccccccccEEEcccccccHHHcccccccEEEEEcccccccccccEEEEEEEEccccccccEEEEEEEEEccccEEcccccccccccccccEEEEEEEEccccccccccccEEEEEEEEccccEEEEEcEEEEEEEccccccccccccccccccEEEcccccccEEEEEEEcc

nyplrtlpsnfkpknlvelnlpyghkvVQIWEGKKRAFKLKFINLShsqchikipdpsetpnleridilnctnpacvlssitnfnHLSMLCFRHcknlrhfpnnlhfvcpiiidfsycvnltefpqisgnIIDLILTEtaieevpsstecltnlqYLFLCSCKKLKRVSTSICKFKSLVWLSLNndltaipqeigclssleclnlggnnfeglpasiKQISRLecldlsycnslqslpelplHLEVLLATNCkrlqslpeipsCLEELDASVLEKLskhsfgeeyriWSIKFNFTNCLKLMNEEANKKNLADSRLRIQHMAIASLRLFWELRQfslplnryhplehrenlkgatimlpgnnvpeffinrssgseitlqlpqhcCQNLMGFAVCAVLQQIDEERDCFFVDFLMKTLSGRKIVRCYETIALRRQVTKTNVilgfrplrnvgfpddnnrtvvpfkfsSQYYVVKCcevcpfwrrgigtesqetlqrrpcqhflrtnincfgvdisvytty

nyplrtlpsnfkpknlvelnlpYGHKVVQIWEGKKRAFKLKFINLSHSQChikipdpsetpNLERIDILNCTNPACVLSSITNFNHLSMLCFRHCKNLRHFPNNLHFVCPIIIDFSYCVNLTEFPQISGNIIDLILTETAIEEVPSSTECLTNLQYLFLCSCKKLKRVSTSICKFKSLVWLSLNNDLTAIPQEIGCLSSLECLNLGGNNFEGLPASIKQISRLECLDLSYCNSLQSLPELPLHLEVLLATNCKRLQSLPEIPSCLEELDASVLEKLSKhsfgeeyriWSIKFNFTNCLKLMNEEANKKNLADSRLRIQHMAIASLRLFWELRQFSLPLNRYHPLEHRENLKGATIMLPGNNVPEFFINRSSGSEITLQLPQHCCQNLMGFAVCAVLQQIDEERDCFFVDFLMktlsgrkivRCYETIalrrqvtktnvilgfrplrnvgfpddnNRTVVPFKFSSQYYVVKCCEVCPFWrrgigtesqetlQRRPCQHflrtnincfgvdisvytty

NYPLRTLPSNFKPKNLVELNLPYGHKVVQIWEGKKRAFKLKFINLSHSQCHIKIPDPSETPNLERIDILNCTNPACVLSSITNFNHLSMLCFRHCKNLRHFPNNLHFVCPIIIDFSYCVNLTEFPQISGNIIDLILTETAIEEVPSSTECLTNLQYLFLCSCKKLKRVSTSICKFKSLVWLSLNNDLTAIPQEIGCLSSLECLNLGGNNFEGLPASIKQISRLECLDLSYCNSLQSlpelplhlevllATNCKRLQSLPEIPSCLEELDASVLEKLSKHSFGEEYRIWSIKFNFTNCLKLMNEEANKKNLADSRLRIQHMAIASLRLFWELRQFSLPLNRYHPLEHRENLKGATIMLPGNNVPEFFINRSSGSEITLQLPQHCCQNLMGFAVCAVLQQIDEERDCFFVDFLMKTLSGRKIVRCYETIALRRQVTKTNVILGFRPLRNVGFPDDNNRTVVPFKFSSQYYVVKCCEVCPFWRRGIGTESQETLQRRPCQHFLRTNINCFGVDISVYTTY

*************KNLVELNLPYGHKVVQIWEGKKRAFKLKFINLSHSQCHIKIPDPSETPNLERIDILNCTNPACVLSSITNFNHLSMLCFRHCKNLRHFPNNLHFVCPIIIDFSYCVNLTEFPQISGNIIDLILTETAIEEVPSSTECLTNLQYLFLCSCKKLKRVSTSICKFKSLVWLSLNNDLTAIPQEIGCLSSLECLNLGGNNFEGLPASIKQISRLECLDLSYCNSLQSLPELPLHLEVLLATNCKRLQSLPEIPSCLEELDASVLEKLSKHSFGEEYRIWSIKFNFTNCLKLMNEEANKKNLADSRLRIQHMAIASLRLFWELRQFSLPLNRYHPLEHRENLKGATIMLPGNNVPEFFINRSSGSEITLQLPQHCCQNLMGFAVCAVLQQIDEERDCFFVDFLMKTLSGRKIVRCYETIALRRQVTKTNVILGFRPLRNVGFPDDNNRTVVPFKFSSQYYVVKCCEVCPFWRRGIGTESQETLQRRPCQHFLRTNINCFGVDISVYT**

NYPLRTLPSNFKPKNLVELNLPYGHKVVQIWEGKKRAFKLKFINLSHSQCHIKIPDPSETPNLERIDILNCTNPACVLSSITNFNHLSMLCFRHCKNLRHFPNNLHFVCPIIIDFSYCVNLTEFPQISGNIIDLILTETAIEEVPSSTECLTNLQYLFLCSCKKLKRVSTSICKFKSLVWLSLNNDLTAIPQEIGCLSSLECLNLGGNNFEGLPASIKQISRLECLDLSYCNSLQSLPELPLHLEVLLATNCKRLQSLPEIPSCLEELDASVLEKLSKHSFGEEYRIWSIKFNFTNCLKLMNEEA**KNLADSRLRIQHMAIASLRLFWELRQFSLPLNRYHPLEHRENLKGATIMLPGNNVPEFFINRSSGSEITLQLPQHCCQNLMGFAVCAVLQQIDEERDCFFVDFLMKTLSGRKIVRCYETIALRRQVTKTNVILGFRPLRNVGFPDDNNRTVVPFKFSSQYYVVKCCEVCPFWR********************************V****

*Y*LRTLPSNFKPKNLVELNLPYGHKVVQIWEGKKRAFKLKFINLSHSQCHIKIPDPSETPNLERIDILNCTNPACVLSSITNFNHLSMLCFRHCKNLRHFPNNLHFVCPIIIDFSYCVNLTEFPQISGNIIDLILTETAIEEVPSSTECLTNLQYLFLCSCKKLKRVSTSICKFKSLVWLSLNNDLTAIPQEIGCLSSLECLNLGGNNFEGLPASIKQISRLECLDLSYCNSLQSLPELPLHLEVLLATNCKRLQSLPEIPSCLEELDASVLEKLSKHSFGEEYRIWSIKFNFTNCLKLMNEEANKKNLADSRLRIQHMAIASLRLFWELRQFSLPLNRYHPLEHRENLKGATIMLPGNNVPEFFINRSSGSEITLQLPQHCCQNLMGFAVCAVLQQIDEERDCFFVDFLMKTLSGRKIVRCYETIALRRQVTKTNVILGFRPLRNVGFPDDNNRTVVPFKFSSQYYVVKCCEVCPFWRRG*******TLQRRPCQHFLRTNINCFGVDISVYTTY

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		517	2.2.26 [Sep-21-2011]
O82500		1095	Putative disease resistan	no	no	0.603	0.284	0.303	3e-28
Q9SZ67		1895	Probable WRKY transcripti	no	no	0.497	0.135	0.332	1e-24
Q40392		1144	TMV resistance protein N	N/A	no	0.709	0.320	0.259	3e-21
O23530		1301	Protein SUPPRESSOR OF npr	no	no	0.493	0.196	0.315	9e-21
Q9FL92		1372	Probable WRKY transcripti	no	no	0.514	0.193	0.284	8e-18
Q9FH83		1288	Probable WRKY transcripti	no	no	0.398	0.159	0.297	6e-16
Q6DHL5		238	Leucine-rich repeat-conta	yes	no	0.226	0.491	0.362	1e-09
Q9FKN7		1613	Protein DA1-related 4 OS=	no	no	0.510	0.163	0.248	3e-09
Q9Y4C4		1052	Malignant fibrous histioc	yes	no	0.485	0.238	0.285	3e-09
Q8BGR2		859	Leucine-rich repeat-conta	yes	no	0.386	0.232	0.287	2e-08

>sp\|O82500\|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1	Back alignment and function desciption

 Score =  127 bits (318), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 120/396 (30%), Positives = 169/396 (42%), Gaps = 84/396 (21%)

Query: 2   YPLRTLPSNFKPKNLVELNLPYGHKVVQIWEGKKRAFKLKFINLSHSQCHIKIPDPSETP 61
           YPL   PS+F+P+ LVELN+ +  K+ ++W G +    L+ +NL+ S+    +P+  E  
Sbjct: 596 YPLEFFPSSFRPECLVELNMSHS-KLKKLWSGVQPLRNLRTMNLNSSRNLEILPNLMEAT 654

Query: 62  NLERIDILNCTNPACVLSSITNFNHLSMLCFRHCKNLRHFPNNLHFVCPIIIDFSYCVNL 121
            L R+D+  C +   + SSI N  HL +L    CK L   P N++     ++ F YC  L
Sbjct: 655 KLNRLDLGWCESLVELPSSIKNLQHLILLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRL 714

Query: 122 TEFPQISGNIIDLILTETAIEEVPSSTECLTNLQYLFLCSCKKLKRVSTSICKFKSLVWL 181
             FP+IS NI  L L  TAI EVP S +  +           K+  +     K K LV  
Sbjct: 715 QTFPEISTNIRLLNLIGTAITEVPPSVKYWS-----------KIDEICMERAKVKRLV-- 761

Query: 182 SLNNDLTAIPQEIGCLSSLECLNLGGNN-FEGLPASIKQISRLECLDLSYCNSLQSLPEL 240
                   +P        LE L L  N   E +P  +K + RL+ +D+SYC ++ SLP+L
Sbjct: 762 -------HVPY------VLEKLCLRENKELETIPRYLKYLPRLQMIDISYCINIISLPKL 808

Query: 241 PLHLEVLLATNCKRLQSLPEIPSCLEELDASVLEKLSKHSFGEEYRIWSIKFNFTNCLKL 300
           P  +  L A NC+ LQ L                    H     +R  SI  NF NCLKL
Sbjct: 809 PGSVSALTAVNCESLQIL--------------------HG---HFRNKSIHLNFINCLKL 845

Query: 301 MNEEANKKNLADSRLRIQHMAIASLRLFWELRQFSLPLNRYHPLEHRENLKGATIMLPGN 360
                 K  +  S    Q   IA +                               LPG 
Sbjct: 846 GQRAQEK--IHRSVYIHQSSYIADV-------------------------------LPGE 872

Query: 361 NVPEFFINRSSGSEITLQLPQHCCQNLMGFAVCAVL 396
           +VP +F  RS+GS I +   +        F VC VL
Sbjct: 873 HVPAYFSYRSTGSSIMIHSNKVDLSKFNRFKVCLVL 908

Arabidopsis thaliana (taxid: 3702)

>sp\|Q9SZ67\|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1	Back alignment and function description

>sp\|Q40392\|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1	Back alignment and function description

>sp\|O23530\|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3	Back alignment and function description

>sp\|Q9FL92\|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1	Back alignment and function description

>sp\|Q9FH83\|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3	Back alignment and function description

>sp\|Q6DHL5\|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1	Back alignment and function description

>sp\|Q9FKN7\|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2	Back alignment and function description

>sp\|Q9Y4C4\|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2	Back alignment and function description

>sp\|Q8BGR2\|LRC8D_MOUSE Leucine-rich repeat-containing protein 8D OS=Mus musculus GN=Lrrc8d PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		517
255537139		1137	leucine-rich repeat-containing protein,	0.793	0.360	0.329	3e-43
224127750		1018	tir-nbs-lrr resistance protein [Populus	0.694	0.352	0.328	2e-42
224127754		1125	tir-nbs-lrr resistance protein [Populus	0.686	0.315	0.322	1e-39
359496030		1195	PREDICTED: TMV resistance protein N-like	0.659	0.285	0.325	3e-39
147769268		1236	hypothetical protein VITISV_013549 [Viti	0.731	0.305	0.307	9e-39
225460354		1174	PREDICTED: TMV resistance protein N-like	0.692	0.304	0.310	1e-38
356557333		1158	PREDICTED: protein SUPPRESSOR OF npr1-1,	0.752	0.335	0.299	2e-38
359493496		1180	PREDICTED: TMV resistance protein N-like	0.698	0.305	0.313	3e-38
147768286		1206	hypothetical protein VITISV_033530 [Viti	0.692	0.296	0.306	4e-37
296090597		1201	unnamed protein product [Vitis vinifera]	0.829	0.357	0.300	5e-37

>gi\|255537139\|ref\|XP_002509636.1\| leucine-rich repeat-containing protein, putative [Ricinus communis] gi\|223549535\|gb\|EEF51023.1\| leucine-rich repeat-containing protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  182 bits (463), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 153/465 (32%), Positives = 233/465 (50%), Gaps = 55/465 (11%)

Query: 1    NYPLRTLPSNFKPKNLVELNLPYGHKVVQIWEGKKRAFKLKFINLSHSQCHIKIPDPSET 60
             YPL++LP+     NLV L LPY  KV ++W+G K   KLK I+LS+SQ  I+I + +  
Sbjct: 591  GYPLKSLPARIHLMNLVVLVLPYS-KVKRLWKGCKDLKKLKVIDLSYSQALIRITELTTA 649

Query: 61   PNLERIDILNCTNPACVLSSITNFNHLSMLCFRHCKNLRHFPNNLHFVCPI----IIDFS 116
             NL  + +  C N    + S T +  LS L   +C  L   P++   +C +     +   
Sbjct: 650  SNLSYMKLSGCKNLRS-MPSTTRWKSLSTLEMNYCTKLESLPSS---ICKLKSLESLSLC 705

Query: 117  YCVNLTEFPQI---SGNIIDLILTETAIEEVPSSTECLTNLQYLFLCSCKKLKRVSTSIC 173
             C NL  FP+I      +  L+L  TAI+E+PSS E L  L  ++L +C+ L  +  S C
Sbjct: 706  GCSNLQSFPEILESMDRLKVLVLNGTAIKELPSSIERLKGLSSIYLENCRNLAHLPESFC 765

Query: 174  KFKSLVWLSLN--NDLTAIPQEIGCLSSLECLNLGGNNFEGLPASIKQISRLECLDLSYC 231
              K+L WL L     L  +P+++  L++LE L++G  N   LP+ +  +S +  LDLS  
Sbjct: 766  NLKALYWLFLTFCPKLEKLPEKLSNLTTLEDLSVGVCNLLKLPSHMNHLSCISKLDLS-G 824

Query: 232  NSLQSLPELP--LHLEVLLATNCKRLQSLPEIPSCLEELDA---SVLEKLS--KHSFGEE 284
            N    LP     L+L  L  ++C+RL+SLPE+P  L ++DA     LE +S  K  F  +
Sbjct: 825  NYFDQLPSFKYLLNLRCLDISSCRRLRSLPEVPHSLTDIDAHDCRSLETISGLKQIFQLK 884

Query: 285  YR--IWSIKFNFTNCLKLMNEEANKKNLADSRLRIQHMAIASLRLFWELRQFSLPLNRYH 342
            Y    +  K  FT+C K M+E A    LAD++  IQ +A+ +                  
Sbjct: 885  YTHTFYDKKIIFTSCFK-MDESAWSDFLADAQFWIQKVAMRA------------------ 925

Query: 343  PLEHRENLKGATIMLPGNNVPEFFINRSSGSEITLQL-PQHCCQNLMGFAVCAVLQQIDE 401
                 ++ +  +I  PG+ +P++F  +S GS I +QL P+    NL+GF +C VL   DE
Sbjct: 926  -----KDEESFSIWYPGSKIPKWFGYQSEGSSIVIQLHPRSHKHNLLGFTLCVVLAFEDE 980

Query: 402  -ERDCFFVDFL----MKTLSGRKIVRCYETIALRRQVTKTNVILG 441
             E    F D L    +K   G +   C E  + R  V+  N  +G
Sbjct: 981  FEYHNSFFDVLCVYQLKNYRG-EYTDCKEVYSSRTHVSGKNKYVG 1024

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224127750\|ref\|XP_002329168.1\| tir-nbs-lrr resistance protein [Populus trichocarpa] gi\|222870949\|gb\|EEF08080.1\| tir-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224127754\|ref\|XP_002329169.1\| tir-nbs-lrr resistance protein [Populus trichocarpa] gi\|222870950\|gb\|EEF08081.1\| tir-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359496030\|ref\|XP_002277205.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147769268\|emb\|CAN68108.1\| hypothetical protein VITISV_013549 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225460354\|ref\|XP_002263146.1\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356557333\|ref\|XP_003546971.1\| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|359493496\|ref\|XP_003634615.1\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147768286\|emb\|CAN64759.1\| hypothetical protein VITISV_033530 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296090597\|emb\|CBI40966.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		517
TAIR\|locus:2151491		1123	AT5G46450 [Arabidopsis thalian	0.731	0.336	0.294	1.4e-27
TAIR\|locus:2122985		1167	AT4G19530 [Arabidopsis thalian	0.570	0.252	0.321	2e-27
TAIR\|locus:2155322		1170	LAZ5 "LAZARUS 5" [Arabidopsis	0.765	0.338	0.287	5.7e-27
TAIR\|locus:2158475		1217	RPS4 "RESISTANT TO P. SYRINGAE	0.729	0.309	0.295	6e-27
TAIR\|locus:2153072		1229	AT5G51630 [Arabidopsis thalian	0.338	0.142	0.380	7.8e-27
TAIR\|locus:2081810		1226	AT3G51570 [Arabidopsis thalian	0.752	0.317	0.288	1.4e-26
TAIR\|locus:2170333		1197	CSA1 "constitutive shade-avoid	0.723	0.312	0.285	1.7e-26
TAIR\|locus:2122209		1179	AT4G36150 [Arabidopsis thalian	0.727	0.318	0.302	4.1e-25
TAIR\|locus:2053405		1215	AT2G14080 [Arabidopsis thalian	0.516	0.219	0.320	1e-24
TAIR\|locus:2118116		1895	WRKY19 [Arabidopsis thaliana (	0.429	0.117	0.351	2.3e-24

TAIR\|locus:2151491 AT5G46450 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 337 (123.7 bits), Expect = 1.4e-27, P = 1.4e-27
 Identities = 123/418 (29%), Positives = 200/418 (47%)

Query:     2 YPLRTLPSNFKPKNLVELNLPYGHKVVQIWEGKKRAFKLKFINLSHSQCHIKIPDPSETP 61
             YPLR +PSNF+P+NLV+L +    K+ ++W+G      L+ ++L  S+   +IPD S   
Sbjct:   593 YPLRCMPSNFRPENLVKLQMCES-KLEKLWDGVHSLTGLRNMDLRGSENLKEIPDLSLAT 651

Query:    62 NLERIDILNCTNPACVLSSITNFNHLSMLCFRHCKNLRHFPNNLHFVCPIIIDFSYCVNL 121
             NL+++D+ NCT+   + S+I N N L  L    C+NL + P  ++      ++ + C  L
Sbjct:   652 NLKKLDVSNCTSLVELSSTIQNLNQLEELQMERCENLENLPIGINLESLYCLNLNGCSKL 711

Query:   122 TEFPQISGNIIDLILTETAIEEVPSSTECLTNLQYLFLCSCK--KL-KRVS--TSICKF- 175
               FP IS  I +L L+ETAIEE P+    L NL YL L   K  KL KRV   T +    
Sbjct:   712 RSFPDISTTISELYLSETAIEEFPTELH-LENLYYLGLYDMKSEKLWKRVQPLTPLMTML 770

Query:   176 -KSLVWLSLNN--DLTAIPQEIGCLSSLECLNLGG-NNFEGLPASIKQISRLECLDLSYC 231
               SL  L L++   L  +P     L +LE LN+    N E LP  +  +  LE LD S C
Sbjct:   771 SPSLTKLFLSDIPSLVELPSSFQNLHNLEHLNIARCTNLETLPTGVN-LELLEQLDFSGC 829

Query:   232 NSLQSXXXXXXXXXXXXATNCKRLQSLPEIPSCLEEL-DASVLEKLSKHSF-GEEYRIWS 289
             + L+S                     + E+P  +E+    S L  +  ++  G    I  
Sbjct:   830 SRLRSFPDISTNIFSLVLDGT----GIEEVPWWIEDFYRLSFLSMIGCNNLQGVSLNISK 885

Query:   290 IK----FNFTNCLKLMNEEANKKNLADSRLRIQHMAIASLRLFWELRQFSLPLNRYHPLE 345
             ++     +F++C  L +  AN   +  +      +A+A+  +  +L    +  +    L+
Sbjct:   886 LEKLETVDFSDCEALSH--ANWDTIPSA------VAMATENIHSKL-PVCIKFSNCFNLD 936

Query:   346 HRENLKGATI----MLPGNNVPEFFINRSSGSEITLQLPQ-HC--CQNLMGFAVCAVL 396
             H+  L   +I    +L G  +  +F +R++G+ +T  +P  H   CQ    F  CA++
Sbjct:   937 HKAVLLQQSIFKQLILSGGEMFSYFTHRTTGTSLT-NIPLLHISPCQPFFRFRACALV 993

GO:0000166 "nucleotide binding" evidence=IEA

GO:0005622 "intracellular" evidence=IEA

GO:0006952 "defense response" evidence=IEA;ISS

GO:0007165 "signal transduction" evidence=IEA

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2122985 AT4G19530 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2155322 LAZ5 "LAZARUS 5" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2153072 AT5G51630 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2122209 AT4G36150 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00001784001	SubName- Full=Chromosome chr18 scaffold_122, whole genome shotgun sequence; (1102 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		517
PLN03210		1153	PLN03210, PLN03210, Resistant to P	1e-37
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-06
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	3e-06
PRK15387		788	PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss	3e-05
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	3e-05
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-04
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	3e-04
PRK15387		788	PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss	7e-04
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	7e-04
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	0.001

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

 Score =  147 bits (373), Expect = 1e-37
 Identities = 126/433 (29%), Positives = 194/433 (44%), Gaps = 40/433 (9%)

Query: 2    YPLRTLPSNFKPKNLVELNLPYGHKVVQIWEGKKRAFKLKFINLSHSQCHIKIPDPSETP 61
            YPLR +PSNF+P+NLV+L +  G K+ ++W+G      L+ I+L  S+   +IPD S   
Sbjct: 599  YPLRCMPSNFRPENLVKLQMQ-GSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMAT 657

Query: 62   NLERIDILNCTNPACVLSSITNFNHLSMLCFRHCKNLRHFPNNLHFVCPIIIDFSYCVNL 121
            NLE + + +C++   + SSI   N L  L    C+NL   P  ++      ++ S C  L
Sbjct: 658  NLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRL 717

Query: 122  TEFPQISGNIIDLILTETAIEEVPSSTECLTNLQYLFLC---SCKKLKRVS------TSI 172
              FP IS NI  L L ETAIEE PS+   L NL  L LC   S K  +RV       T +
Sbjct: 718  KSFPDISTNISWLDLDETAIEEFPSNLR-LENLDELILCEMKSEKLWERVQPLTPLMTML 776

Query: 173  CKFKSLVWLSLNNDLTAIPQEIGCLSSLECLNLGG-NNFEGLPASIKQISRLECLDLSYC 231
                + ++LS    L  +P  I  L  LE L +    N E LP  I  +  LE LDLS C
Sbjct: 777  SPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGC 835

Query: 232  NSLQSLPELPLHLEVLLATNCKRLQSLPEIP------SCLEELDASVLEKLSKHSFGEEY 285
            + L++ P++  ++  L  +       + E+P      S L  LD +    L + S     
Sbjct: 836  SRLRTFPDISTNISDLNLSR----TGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISK 891

Query: 286  RIWSIKFNFTNCLKLMNEEAN--KKNLADSRLRIQHMAIASLRLFW----ELRQFSLPLN 339
                   +F++C  L     N     +A +   I     +++ + +     L Q +L   
Sbjct: 892  LKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLDQEALLQQ 951

Query: 340  RYHPLEHRENLKGATIMLPGNNVPEFFINRSSGSEIT-LQLPQ-HCCQNLMGFAVCAVLQ 397
            +    +         ++L G  VP +F +R++G+ +T + L     CQ    F  CAV+ 
Sbjct: 952  QSIFKQ---------LILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVD 1002

Query: 398  QIDEERDCFFVDF 410
                       D 
Sbjct: 1003 SESFFIISVSFDI 1015

syringae 6; Provisional. Length = 1153

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		517
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.92
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.91
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.86
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.84
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.82
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.79
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.78
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.77
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.76
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.75
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.67
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.66
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.66
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.62
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.61
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.55
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.47
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.45
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.41
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.36
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.33
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.05
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.99
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.98
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.93
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.91
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.79
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.73
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.69
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.68
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.66
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.64
PLN03150		623	hypothetical protein; Provisional	98.62
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.61
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.58
PRK15386		426	type III secretion protein GogB; Provisional	98.51
PLN03150		623	hypothetical protein; Provisional	98.48
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.37
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.3
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.28
PRK15386		426	type III secretion protein GogB; Provisional	98.26
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.25
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.24
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.0
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.88
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.81
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.8
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.71
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.62
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.53
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.5
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.18
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.14
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.14
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.07
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.96
KOG4341		483	consensus F-box protein containing LRR [General fu	96.86
KOG4341		483	consensus F-box protein containing LRR [General fu	96.49
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	96.48
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.45
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.3
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.24
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.05
KOG1947		482	consensus Leucine rich repeat proteins, some prote	95.42
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.2
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.08
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	94.87
KOG2123		388	consensus Uncharacterized conserved protein [Funct	94.62
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	94.42
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	94.34
PF07725		20	LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le	93.69
KOG1947		482	consensus Leucine rich repeat proteins, some prote	93.66
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	93.05
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	89.99
smart00370		26	LRR Leucine-rich repeats, outliers.	89.99
KOG3864		221	consensus Uncharacterized conserved protein [Funct	82.15
KOG0473		326	consensus Leucine-rich repeat protein [Function un	80.4
KOG3864		221	consensus Uncharacterized conserved protein [Funct	80.03

>PLN03210 Resistant to P	Back alignment and domain information

Probab=100.00  E-value=8.8e-45  Score=420.51  Aligned_cols=436  Identities=29%  Similarity=0.417  Sum_probs=317.9

Q ss_pred             CCCCCCCCCCCCCCCccEEeccCCCCCccccccCCCCCCccEEEccCCCCCCCCCCCCCCCCccEEeeccccCCcccCcc
Q 043008            1 NYPLRTLPSNFKPKNLVELNLPYGHKVVQIWEGKKRAFKLKFINLSHSQCHIKIPDPSETPNLERIDILNCTNPACVLSS   80 (517)
Q Consensus         1 ~~pl~~lP~~f~~~~L~~L~L~~n~~l~~l~~~~~~l~~L~~L~Ls~~~~l~~~p~l~~l~~L~~L~L~~~~~l~~~p~s   80 (517)
                      +||++++|+.|.+++|++|+|++| +++.+|.+++.+++|+.|+|++|..++.+|+++.+++|+.|+|++|..+..+|.+
T Consensus       598 ~~~l~~lP~~f~~~~L~~L~L~~s-~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~L~L~~c~~L~~lp~s  676 (1153)
T PLN03210        598 KYPLRCMPSNFRPENLVKLQMQGS-KLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPSS  676 (1153)
T ss_pred             CCCCCCCCCcCCccCCcEEECcCc-cccccccccccCCCCCEEECCCCCCcCcCCccccCCcccEEEecCCCCccccchh
Confidence            589999999999999999999999 9999999999999999999999988999999999999999999999999999999


Q ss_pred             ccCCCCCCEEeccCCcCccccCCCCCCCCCcEEEEecCCCCCccCCCCCCCcEEEeecccCcccCCcCC-----------
Q 043008           81 ITNFNHLSMLCFRHCKNLRHFPNNLHFVCPIIIDFSYCVNLTEFPQISGNIIDLILTETAIEEVPSSTE-----------  149 (517)
Q Consensus        81 i~~l~~L~~L~L~~~~~l~~lp~~~~l~sL~~L~L~~c~~l~~~p~~~~~L~~L~L~~~~i~~lp~~i~-----------  149 (517)
                      ++++++|+.|++++|..++.+|..+++++|+.|++++|..++.+|....+|+.|++++|.+..+|..+.           
T Consensus       677 i~~L~~L~~L~L~~c~~L~~Lp~~i~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L~L~~n~i~~lP~~~~l~~L~~L~l~~  756 (1153)
T PLN03210        677 IQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDELILCE  756 (1153)
T ss_pred             hhccCCCCEEeCCCCCCcCccCCcCCCCCCCEEeCCCCCCccccccccCCcCeeecCCCccccccccccccccccccccc
Confidence            999999999999999999999998899999999999999999999988999999999999888876431           


Q ss_pred             -------------------CCCCccEEEcccCcCCccccccccCCCCCcEEEcCCC--CCcCCccCCCC-----------
Q 043008          150 -------------------CLTNLQYLFLCSCKKLKRVSTSICKFKSLVWLSLNND--LTAIPQEIGCL-----------  197 (517)
Q Consensus       150 -------------------~l~~L~~L~l~~~~~l~~lp~~l~~l~~L~~L~Ls~~--l~~lp~~l~~l-----------  197 (517)
                                         ..++|+.|++++|.....+|..++++++|+.|+++++  ++.+|..+ .+           
T Consensus       757 ~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~-~L~sL~~L~Ls~c  835 (1153)
T PLN03210        757 MKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGC  835 (1153)
T ss_pred             cchhhccccccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCC-CccccCEEECCCC
Confidence                               1236777777777777778888888888888888753  45555433 22           


Q ss_pred             ----------CCCCEEEecCCCCCcchhhhhcCCCCCEEeccCCCCCCcCCCCC---CCccEEecccccCcCcCCCCCch
Q 043008          198 ----------SSLECLNLGGNNFEGLPASIKQISRLECLDLSYCNSLQSLPELP---LHLEVLLATNCKRLQSLPEIPSC  264 (517)
Q Consensus       198 ----------~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~c~~l~~lp~l~---~~L~~L~~~~c~~l~~l~~~~~~  264 (517)
                                .+|+.|+|++|.++.+|.++..+++|+.|+|++|+.++.+|..+   .+|+.|++.+|.+|..++.... 
T Consensus       836 ~~L~~~p~~~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~-  914 (1153)
T PLN03210        836 SRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGS-  914 (1153)
T ss_pred             CccccccccccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCCCC-
Confidence                      35667777777788888889999999999999999999888654   5677778888988876543211 


Q ss_pred             hhhcchhhHHhhhcCCCCCcceeeeeEEeeeCCCCcchHHHhhhcchhhHHHHHHHHHHHHhHhHhhhcccCCCCcccCc
Q 043008          265 LEELDASVLEKLSKHSFGEEYRIWSIKFNFTNCLKLMNEEANKKNLADSRLRIQHMAIASLRLFWELRQFSLPLNRYHPL  344 (517)
Q Consensus       265 L~~L~~l~~~~Ls~n~~~~~~~l~~l~~~~~nC~kL~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  344 (517)
                          +. ....+++|.........  ...|.||++|+ +++.   +       +.                  ...+   
T Consensus       915 ----~~-~~~~~~~n~~~~~p~~~--~l~f~nC~~L~-~~a~---l-------~~------------------~~~~---  955 (1153)
T PLN03210        915 ----PS-EVAMATDNIHSKLPSTV--CINFINCFNLD-QEAL---L-------QQ------------------QSIF---  955 (1153)
T ss_pred             ----ch-hhhhhcccccccCCchh--ccccccccCCC-chhh---h-------cc------------------cccc---
Confidence                00 11222233222111112  24899999996 4441   1       10                  1111   


Q ss_pred             cccccCCccEEEecCCCCCCCcccCCCccEEE-EECCCCCC-CCccceeEEEEEeeeCC---------ceeEEEecCCCc
Q 043008          345 EHRENLKGATIMLPGNNVPEFFINRSSGSEIT-LQLPQHCC-QNLMGFAVCAVLQQIDE---------ERDCFFVDFLMK  413 (517)
Q Consensus       345 ~~~~~~~~~~~~~Pg~~iP~wf~~q~~g~si~-i~lp~~~~-~~~~gf~~c~v~~~~~~---------~~~c~~~~~~~~  413 (517)
                              ..+++||.++|+||+||+.|++++ |++|+.|+ +.|.||++|+|++..+.         .+.|.|.+..+.
T Consensus       956 --------~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~~~~~~~f~~c~v~~~~~~~~~~~~~~~~~~c~~~~~~~~ 1027 (1153)
T PLN03210        956 --------KQLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDSESFFIISVSFDIQVCCRFIDRLGN 1027 (1153)
T ss_pred             --------eEEECCCccCchhccCCcccceeeeeccCCcccCCCccceEEEEEEecCccccCCCceeEEEEEEEECCCCC
Confidence                    157899999999999999999998 99999999 78999999999954332         356777766665


Q ss_pred             eEEeeEEeeEEeccccccccccceEEEeeeeCcCCCC--CCCCCCceEEEEEEe--e--eeeEEeeeeeeeEecccCccc
Q 043008          414 TLSGRKIVRCYETIALRRQVTKTNVILGFRPLRNVGF--PDDNNRTVVPFKFSS--Q--YYVVKCCEVCPFWRRGIGTES  487 (517)
Q Consensus       414 ~~~~~~~~~~~~~~~~~~~~~s~hv~~~y~~~~~~~~--~~~~~~~~~~f~fs~--~--~~~v~~Cgv~~~~~~~~~~~~  487 (517)
                      .++.....+.|.    .....+|.+++........+.  ..+.++++++++|..  .  .++|++|||+++|++......
T Consensus      1028 ~~~~~~~~~~~~----~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~cg~~~~~~~~~~~~~ 1103 (1153)
T PLN03210       1028 HFDSPYQPHVFS----VTKKGSHLVIFDCCFPLNEDNAPLAELNYDHVDIQFRLTNKNSQLKLKGCGIRLSEDDSSLNNT 1103 (1153)
T ss_pred             ccccCCCceeEe----eeccccceEEecccccccccccchhccCCceeeEEEEEecCCCCeEEEeeeEEEeccCCCcccC
Confidence            443211111111    111222222222211100000  001124565555543  2  358999999999965544433


Q ss_pred             ccc
Q 043008          488 QET  490 (517)
Q Consensus       488 ~~~  490 (517)
                      -|+
T Consensus      1104 ~~~ 1106 (1153)
T PLN03210       1104 LPN 1106 (1153)
T ss_pred             CCc
Confidence            333

syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		517
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	4e-31
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-27
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-25
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-06
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	8e-22
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-21
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-14
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	5e-09
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	6e-19
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-12
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-17
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	7e-16
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-17
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	4e-16
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-11
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	8e-17
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	5e-16
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-14
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	5e-14
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-04
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-14
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	8e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-14
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-09
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-13
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	5e-04
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	4e-13
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-06
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-04
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	4e-13
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	9e-08
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-13
1o6v_A		466	Internalin A; bacterial infection, extracellular r	6e-08
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-12
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	7e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	9e-05
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-12
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-10
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	8e-08
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-12
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	9e-05
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	7e-12
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	4e-07
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	9e-12
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-07
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	8e-05
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	9e-12
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-11
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	5e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-11
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	7e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-11
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	9e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-09
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-10
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	5e-10
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	5e-05
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-10
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	5e-10
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-08
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	5e-10
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-09
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-09
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	6e-05
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-09
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	5e-09
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-09
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-04
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-09
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	5e-09
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	1e-08
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	8e-09
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-08
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	6e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	8e-05
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	3e-08
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	3e-08
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	1e-05
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	2e-04
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	3e-08
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	6e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	7e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	3e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	7e-08
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	6e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-04
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	9e-08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-05
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	1e-07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	8e-07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-07
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	9e-07
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	1e-06
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	4e-04
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-06
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	4e-06
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-06
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-04
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-06
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	3e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-04
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	3e-06
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-05
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	4e-06
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	5e-04
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	3e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-04
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	4e-04
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	3e-05
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	5e-04
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	4e-05
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	8e-05
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	1e-04
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	1e-04
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	2e-04
3m19_A		251	Variable lymphocyte receptor A diversity region; a	2e-04
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	5e-04
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	6e-04
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	8e-04
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	8e-04

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

 Score =  121 bits (307), Expect = 4e-31
 Identities = 63/270 (23%), Positives = 97/270 (35%), Gaps = 25/270 (9%)

Query: 4   LRTLPSNFKP---KNLVELNLPYGHKVVQIWEGKKRAFKLKFINLSHSQCHIKIPDP-SE 59
           L+      +       V L L     + Q  +   R   L+ + +  +    ++PD   +
Sbjct: 68  LKATADLLEDATQPGRVALEL-RSVPLPQFPDQAFRLSHLQHMTIDAAGLM-ELPDTMQQ 125

Query: 60  TPNLERIDILNCTNPACVLSSITNFNHLSMLCFRHCKNLRHFPNNLHFVCPIIIDFSYCV 119
              LE +  L       + +SI + N L  L  R C  L   P  L        +    V
Sbjct: 126 FAGLETLT-LARNPLRALPASIASLNRLRELSIRACPELTELPEPL-ASTDASGEHQGLV 183

Query: 120 NLTEFPQISGNIIDLILTETAIEEVPSSTECLTNLQYLFLCSCKKLKRVSTSICKFKSLV 179
           NL            L L  T I  +P+S   L NL+ L + +   L  +  +I     L 
Sbjct: 184 NLQS----------LRLEWTGIRSLPASIANLQNLKSLKIRNSP-LSALGPAIHHLPKLE 232

Query: 180 WLSL--NNDLTAIPQEIGCLSSLECLNL-GGNNFEGLPASIKQISRLECLDLSYCNSLQS 236
            L L     L   P   G  + L+ L L   +N   LP  I ++++LE LDL  C +L  
Sbjct: 233 ELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSR 292

Query: 237 LPELP---LHLEVLLATNCKRLQSLPEIPS 263
           LP L        ++L     + Q     P 
Sbjct: 293 LPSLIAQLPANCIILVPPHLQAQLDQHRPV 322

PyMOL of 4fcg

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		517
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.94
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.93
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.93
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.93
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.93
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.93
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.93
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.92
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.92
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.92
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.92
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.92
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.92
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.92
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.92
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.92
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.91
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.91
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.91
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.91
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.91
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.91
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.91
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.91
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.91
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.9
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.9
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.9
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.9
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.9
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.9
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.9
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.9
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.9
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.89
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.89
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.89
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.89
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.89
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.89
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.89
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.89
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.89
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.88
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.88
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.88
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.88
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.88
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.88
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.88
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.88
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.87
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.87
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.87
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.86
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.86
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.85
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.85
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.85
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.85
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.84
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.84
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.84
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.83
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.83
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.82
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.81
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.81
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.8
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.8
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.79
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.79
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.79
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.78
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.78
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.77
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.77
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.77
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.77
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.74
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.74
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.73
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.72
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.72
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.72
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.71
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.7
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.68
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.68
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.68
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.67
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.64
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.64
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.64
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.63
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.63
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.62
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.61
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.59
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.58
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.58
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.57
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.56
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.56
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.53
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.52
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.52
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.52
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.52
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.52
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.51
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.51
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.49
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.48
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.48
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.47
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.42
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.42
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.4
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.4
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.39
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.36
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.36
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.35
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.34
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.34
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.32
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.32
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.29
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.28
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.26
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.24
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.2
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.11
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.1
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.07
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.07
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.05
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.04
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.02
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.99
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.98
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.74
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.74
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.68
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.58
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.4
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.4
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.33
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.21
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.2
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.16
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.16
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.98
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.69
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.62
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.61
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.5
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.26
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.23
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.16
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	94.03
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	93.97
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	92.8

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

Probab=99.94  E-value=6e-26  Score=238.37  Aligned_cols=277  Identities=15%  Similarity=0.128  Sum_probs=178.3

Q ss_pred             CCCCCCCCCCCCCccEEeccCCCCCccc-cccCCCCCCccEEEccCCCCCCCCC--CCCCCCCccEEeeccccCCcccCc
Q 043008            3 PLRTLPSNFKPKNLVELNLPYGHKVVQI-WEGKKRAFKLKFINLSHSQCHIKIP--DPSETPNLERIDILNCTNPACVLS   79 (517)
Q Consensus         3 pl~~lP~~f~~~~L~~L~L~~n~~l~~l-~~~~~~l~~L~~L~Ls~~~~l~~~p--~l~~l~~L~~L~L~~~~~l~~~p~   79 (517)
                      .++.+|.  -+++|++|+|++| .++.+ +..+..+++|++|+|++|.+...++  .|.++++|++|+|++|......|.
T Consensus        21 ~l~~lp~--l~~~l~~L~Ls~n-~i~~~~~~~~~~l~~L~~L~L~~n~~~~~i~~~~~~~l~~L~~L~Ls~n~l~~~~~~   97 (455)
T 3v47_A           21 GLHQVPE--LPAHVNYVDLSLN-SIAELNETSFSRLQDLQFLKVEQQTPGLVIRNNTFRGLSSLIILKLDYNQFLQLETG   97 (455)
T ss_dssp             CCSSCCC--CCTTCCEEECCSS-CCCEECTTTTSSCTTCCEEECCCCSTTCEECTTTTTTCTTCCEEECTTCTTCEECTT
T ss_pred             CcccCCC--CCCccCEEEecCC-ccCcCChhHhccCccccEEECcCCcccceECcccccccccCCEEeCCCCccCccChh
Confidence            4667777  3588899999988 88877 6778888889999998888665554  378888888888888877666778


Q ss_pred             cccCCCCCCEEeccCCcCccccCCC--C-CCCCCcEEEEecCCCCCccCCC----CCCCcEEEeecccCcccC-CcCC--
Q 043008           80 SITNFNHLSMLCFRHCKNLRHFPNN--L-HFVCPIIIDFSYCVNLTEFPQI----SGNIIDLILTETAIEEVP-SSTE--  149 (517)
Q Consensus        80 si~~l~~L~~L~L~~~~~l~~lp~~--~-~l~sL~~L~L~~c~~l~~~p~~----~~~L~~L~L~~~~i~~lp-~~i~--  149 (517)
                      .++++++|++|++++|......|..  + ++++|++|++++|......|..    +.+|+.|++++|.+..++ ..+.  
T Consensus        98 ~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l  177 (455)
T 3v47_A           98 AFNGLANLEVLTLTQCNLDGAVLSGNFFKPLTSLEMLVLRDNNIKKIQPASFFLNMRRFHVLDLTFNKVKSICEEDLLNF  177 (455)
T ss_dssp             TTTTCTTCCEEECTTSCCBTHHHHSSTTTTCTTCCEEECCSSBCCSCCCCGGGGGCTTCCEEECTTCCBSCCCTTTSGGG
T ss_pred             hccCcccCCEEeCCCCCCCccccCcccccCcccCCEEECCCCccCccCcccccCCCCcccEEeCCCCcccccChhhhhcc
Confidence            8888888888888888766544433  5 7888888888887655554543    355677888777776432 2221  


Q ss_pred             --------------------------------CCCCccEEEcccCcCC--------------------------------
Q 043008          150 --------------------------------CLTNLQYLFLCSCKKL--------------------------------  165 (517)
Q Consensus       150 --------------------------------~l~~L~~L~l~~~~~l--------------------------------  165 (517)
                                                      .+++|+.|++++|.+.                                
T Consensus       178 ~~~~L~~L~l~~n~l~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~  257 (455)
T 3v47_A          178 QGKHFTLLRLSSITLQDMNEYWLGWEKCGNPFKNTSITTLDLSGNGFKESMAKRFFDAIAGTKIQSLILSNSYNMGSSFG  257 (455)
T ss_dssp             TTCEEEEEECTTCBCTTCSTTCTTHHHHCCTTTTCEEEEEECTTSCCCHHHHHHHHHHTTTCCEEEEECTTCTTTSCCTT
T ss_pred             ccccccccccccCcccccchhhccccccccccccceeeeEecCCCcccccchhhhhccccccceeeEeeccccccccccc
Confidence                                            2245555555555443                                


Q ss_pred             -------------------------------ccccccccCCCCCcEEEcCCC-CCcC-CccCCCCCCCCEEEecCCCCCc
Q 043008          166 -------------------------------KRVSTSICKFKSLVWLSLNND-LTAI-PQEIGCLSSLECLNLGGNNFEG  212 (517)
Q Consensus       166 -------------------------------~~lp~~l~~l~~L~~L~Ls~~-l~~l-p~~l~~l~~L~~L~Ls~n~l~~  212 (517)
                                                     +..|..+..+++|+.|++++| +..+ |..+..+++|++|+|++|.++.
T Consensus       258 ~~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~  337 (455)
T 3v47_A          258 HTNFKDPDNFTFKGLEASGVKTCDLSKSKIFALLKSVFSHFTDLEQLTLAQNEINKIDDNAFWGLTHLLKLNLSQNFLGS  337 (455)
T ss_dssp             CCSSCCCCTTTTGGGTTSCCCEEECCSSCCCEECTTTTTTCTTCCEEECTTSCCCEECTTTTTTCTTCCEEECCSSCCCE
T ss_pred             hhhhccCcccccccccccCceEEEecCccccccchhhcccCCCCCEEECCCCcccccChhHhcCcccCCEEECCCCccCC
Confidence                                           334445556666666666554 3333 4456666667777777776665


Q ss_pred             c-hhhhhcCCCCCEEeccCCCCCCcCCCCC---CCccEEecccccCcCcCCCCCchhhhcchhhHHhhhcCCCCCcc
Q 043008          213 L-PASIKQISRLECLDLSYCNSLQSLPELP---LHLEVLLATNCKRLQSLPEIPSCLEELDASVLEKLSKHSFGEEY  285 (517)
Q Consensus       213 l-p~~l~~l~~L~~L~L~~c~~l~~lp~l~---~~L~~L~~~~c~~l~~l~~~~~~L~~L~~l~~~~Ls~n~~~~~~  285 (517)
                      + |..+..+++|+.|+|++|+.....|..+   ++|+.|++.++ .++  ...+..+..++.++.++|++|++++.|
T Consensus       338 ~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N-~l~--~~~~~~~~~l~~L~~L~l~~N~l~~~~  411 (455)
T 3v47_A          338 IDSRMFENLDKLEVLDLSYNHIRALGDQSFLGLPNLKELALDTN-QLK--SVPDGIFDRLTSLQKIWLHTNPWDCSC  411 (455)
T ss_dssp             ECGGGGTTCTTCCEEECCSSCCCEECTTTTTTCTTCCEEECCSS-CCS--CCCTTTTTTCTTCCEEECCSSCBCCCT
T ss_pred             cChhHhcCcccCCEEECCCCcccccChhhccccccccEEECCCC-ccc--cCCHhHhccCCcccEEEccCCCcccCC
Confidence            4 4556666777777776643322224332   45555555542 222  223334566666666677777765444

PyMOL of 3v47

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		517
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	6e-09
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	6e-07
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-06
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	1e-05
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	8e-06
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	2e-05
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	2e-04
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	7e-05
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	2e-04
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	4e-04
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	0.002
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	7e-04
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	7e-04
d2omxa2		199	c.10.2.1 (A:37-235) Internalin B {Listeria monocyt	0.003
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	0.003
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	0.004

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]

 Score = 55.6 bits (132), Expect = 6e-09
 Identities = 32/109 (29%), Positives = 43/109 (39%), Gaps = 5/109 (4%)

Query: 160 CSCKKLKRVSTSICKFKSLVWLSLNNDLTAIPQEIGCLSSLECLNLGGNNFEGLPASIKQ 219
            +   +     S           LN     I        SLE LN+  N    LPA    
Sbjct: 246 LTFLDVSENIFSGLSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPAL--- 302

Query: 220 ISRLECLDLSYCNSLQSLPELPLHLEVLLATNCKRLQSLPEIPSCLEEL 268
             RLE L  S+ N L  +PELP +L+ L       L+  P+IP  +E+L
Sbjct: 303 PPRLERLIASF-NHLAEVPELPQNLKQLHVEYNP-LREFPDIPESVEDL 349

PyMOL of d1jl5a_

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		517
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.88
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.87
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.85
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.82
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.8
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.78
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.78
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.78
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.76
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.75
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.69
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.68
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.68
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.67
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.61
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.59
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.58
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.58
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.53
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.5
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.45
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.34
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.34
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.3
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.29
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.23
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.16
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.1
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.0
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.96
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.94
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.91
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.8
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.79
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.74
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.55
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.38
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.38
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.44
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	95.91
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	94.95
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	92.8

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.88  E-value=6.3e-23  Score=202.54  Aligned_cols=234  Identities=16%  Similarity=0.169  Sum_probs=196.4

Q ss_pred             CCccEEeccCCCCCc---cccccCCCCCCccEEEccC-CCCCCCCCC-CCCCCCccEEeeccccCCcccCccccCCCCCC
Q 043008           14 KNLVELNLPYGHKVV---QIWEGKKRAFKLKFINLSH-SQCHIKIPD-PSETPNLERIDILNCTNPACVLSSITNFNHLS   88 (517)
Q Consensus        14 ~~L~~L~L~~n~~l~---~l~~~~~~l~~L~~L~Ls~-~~~l~~~p~-l~~l~~L~~L~L~~~~~l~~~p~si~~l~~L~   88 (517)
                      .+++.|+|+++ .+.   .+|..+.++++|++|+|++ |.+.+.+|. ++++++|++|+|++|......+..+..+.+|+
T Consensus        50 ~~v~~L~L~~~-~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~  128 (313)
T d1ogqa_          50 YRVNNLDLSGL-NLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLV  128 (313)
T ss_dssp             CCEEEEEEECC-CCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCC
T ss_pred             EEEEEEECCCC-CCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhc
Confidence            46999999998 776   5789999999999999997 666668884 99999999999999988888888899999999


Q ss_pred             EEeccCCcCccccCCCC-CCCCCcEEEEecCCCCCccCCCCCCC----cEEEeecccCc-ccCCcCCCCCCccEEEcccC
Q 043008           89 MLCFRHCKNLRHFPNNL-HFVCPIIIDFSYCVNLTEFPQISGNI----IDLILTETAIE-EVPSSTECLTNLQYLFLCSC  162 (517)
Q Consensus        89 ~L~L~~~~~l~~lp~~~-~l~sL~~L~L~~c~~l~~~p~~~~~L----~~L~L~~~~i~-~lp~~i~~l~~L~~L~l~~~  162 (517)
                      .+++++|.....+|..+ +++.|+.+++++|.....+|..+.++    +.+++++|++. ..|..+..+.. ..+++..+
T Consensus       129 ~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~-~~l~l~~~  207 (313)
T d1ogqa_         129 TLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNL-AFVDLSRN  207 (313)
T ss_dssp             EEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCC-SEEECCSS
T ss_pred             ccccccccccccCchhhccCcccceeecccccccccccccccccccccccccccccccccccccccccccc-cccccccc
Confidence            99999999999999988 99999999999988777888765443    78899999998 44555666654 47999999


Q ss_pred             cCCccccccccCCCCCcEEEcCCC-CCcCCccCCCCCCCCEEEecCCCCC-cchhhhhcCCCCCEEeccCCCCCCcCCCC
Q 043008          163 KKLKRVSTSICKFKSLVWLSLNND-LTAIPQEIGCLSSLECLNLGGNNFE-GLPASIKQISRLECLDLSYCNSLQSLPEL  240 (517)
Q Consensus       163 ~~l~~lp~~l~~l~~L~~L~Ls~~-l~~lp~~l~~l~~L~~L~Ls~n~l~-~lp~~l~~l~~L~~L~L~~c~~l~~lp~l  240 (517)
                      ...+..|..+..+++|+.++++++ +...+..++.+++|+.|+|++|+++ .+|.++.++++|++|+|++|+.-..+|+.
T Consensus       208 ~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~  287 (313)
T d1ogqa_         208 MLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG  287 (313)
T ss_dssp             EEEECCGGGCCTTSCCSEEECCSSEECCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCc
Confidence            888999999999999999999775 3445667889999999999999999 79999999999999999986544477764


Q ss_pred             CCCccEEecc
Q 043008          241 PLHLEVLLAT  250 (517)
Q Consensus       241 ~~~L~~L~~~  250 (517)
                       .+++.|+..
T Consensus       288 -~~L~~L~~l  296 (313)
T d1ogqa_         288 -GNLQRFDVS  296 (313)
T ss_dssp             -TTGGGSCGG
T ss_pred             -ccCCCCCHH
Confidence             333433333

PyMOL of d1ogqa_

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure