Citrus Sinensis ID: 043013
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 179 | ||||||
| 224091795 | 291 | predicted protein [Populus trichocarpa] | 0.692 | 0.426 | 0.458 | 3e-15 | |
| 255577041 | 423 | hypothetical protein RCOM_0623850 [Ricin | 0.502 | 0.212 | 0.484 | 5e-11 | |
| 357480033 | 556 | hypothetical protein MTR_4g130690 [Medic | 0.497 | 0.160 | 0.437 | 1e-09 | |
| 218202164 | 341 | hypothetical protein OsI_31404 [Oryza sa | 0.329 | 0.173 | 0.457 | 1e-06 | |
| 125605735 | 341 | hypothetical protein OsJ_29403 [Oryza sa | 0.329 | 0.173 | 0.457 | 1e-06 | |
| 115479223 | 328 | Os09g0421700 [Oryza sativa Japonica Grou | 0.329 | 0.179 | 0.457 | 2e-06 | |
| 449454103 | 418 | PREDICTED: uncharacterized protein LOC10 | 0.385 | 0.165 | 0.402 | 6e-05 | |
| 308080486 | 321 | uncharacterized protein LOC100502196 [Ze | 0.201 | 0.112 | 0.631 | 6e-05 | |
| 226500844 | 323 | uncharacterized protein LOC100277679 [Ze | 0.201 | 0.111 | 0.631 | 6e-05 | |
| 125598060 | 489 | hypothetical protein OsJ_22184 [Oryza sa | 0.234 | 0.085 | 0.551 | 9e-05 |
| >gi|224091795|ref|XP_002309354.1| predicted protein [Populus trichocarpa] gi|222855330|gb|EEE92877.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 86.7 bits (213), Expect = 3e-15, Method: Compositional matrix adjust.
Identities = 60/131 (45%), Positives = 83/131 (63%), Gaps = 7/131 (5%)
Query: 32 KPYPNLCGSKQEATTLPADS-GK-PCSTGSKKPMH-WSCALCQVSSTSKRNLDEHLRGKK 88
KP PNLCG+K++A T A+S G+ P + KKP WSCALCQVS+TS+R L+EHL+G++
Sbjct: 4 KPDPNLCGAKRKAVTPAAESVGELPFAGIKKKPKEEWSCALCQVSATSERGLNEHLQGRR 63
Query: 89 HKAKEEGLEREKKHMARSNESKKNDEAVSLTTSTTIVTP-LEPTEKVEDEDVVTEESNEE 147
HKAKE GL +K MAR+ + + T TI T LE K+EDE + +S+
Sbjct: 64 HKAKEAGLRAQK--MARNPNKASLPKETTKTAKVTIPTAGLEMEAKIEDESLQLNKSDNF 121
Query: 148 TVDCVIENAED 158
+ + IEN E+
Sbjct: 122 S-NKKIENKEE 131
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255577041|ref|XP_002529405.1| hypothetical protein RCOM_0623850 [Ricinus communis] gi|223531153|gb|EEF33001.1| hypothetical protein RCOM_0623850 [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357480033|ref|XP_003610302.1| hypothetical protein MTR_4g130690 [Medicago truncatula] gi|355511357|gb|AES92499.1| hypothetical protein MTR_4g130690 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|218202164|gb|EEC84591.1| hypothetical protein OsI_31404 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|125605735|gb|EAZ44771.1| hypothetical protein OsJ_29403 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|115479223|ref|NP_001063205.1| Os09g0421700 [Oryza sativa Japonica Group] gi|50726117|dbj|BAD33638.1| unknown protein [Oryza sativa Japonica Group] gi|113631438|dbj|BAF25119.1| Os09g0421700 [Oryza sativa Japonica Group] gi|215766207|dbj|BAG98435.1| unnamed protein product [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|449454103|ref|XP_004144795.1| PREDICTED: uncharacterized protein LOC101215299 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|308080486|ref|NP_001183602.1| uncharacterized protein LOC100502196 [Zea mays] gi|238013370|gb|ACR37720.1| unknown [Zea mays] gi|413943510|gb|AFW76159.1| hypothetical protein ZEAMMB73_364823 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|226500844|ref|NP_001144654.1| uncharacterized protein LOC100277679 [Zea mays] gi|195645234|gb|ACG42085.1| hypothetical protein [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|125598060|gb|EAZ37840.1| hypothetical protein OsJ_22184 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
No hits with e-value below 0.001 by BLAST
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_LG_VI001245 | hypothetical protein (291 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 179 | |||
| pfam12874 | 25 | pfam12874, zf-met, Zinc-finger of C2H2 type | 1e-05 |
| >gnl|CDD|205121 pfam12874, zf-met, Zinc-finger of C2H2 type | Back alignment and domain information |
|---|
Score = 40.2 bits (95), Expect = 1e-05
Identities = 14/25 (56%), Positives = 17/25 (68%)
Query: 65 WSCALCQVSSTSKRNLDEHLRGKKH 89
+ C LC V+ TS+ L HLRGKKH
Sbjct: 1 FYCELCNVTFTSESQLKSHLRGKKH 25
|
This is a zinc-finger domain with the CxxCx(12)Hx(6)H motif, found in multiple copies in a wide range of proteins from plants to metazoans. Some member proteins, particularly those from plants, are annotated as being RNA-binding. Length = 25 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| KOG2785 | 390 | consensus C2H2-type Zn-finger protein [General fun | 98.98 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 98.62 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 98.46 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 98.13 | |
| PF06220 | 38 | zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi | 96.3 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 96.03 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 95.86 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 95.57 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 95.12 | |
| KOG0227 | 222 | consensus Splicing factor 3a, subunit 2 [RNA proce | 95.11 | |
| PLN02748 | 468 | tRNA dimethylallyltransferase | 94.95 | |
| KOG4727 | 193 | consensus U1-like Zn-finger protein [General funct | 94.34 | |
| COG5246 | 222 | PRP11 Splicing factor 3a, subunit 2 [RNA processin | 94.18 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 93.15 | |
| PF07535 | 49 | zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc | 92.87 | |
| PTZ00448 | 373 | hypothetical protein; Provisional | 92.82 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 92.82 | |
| smart00586 | 49 | ZnF_DBF Zinc finger in DBF-like proteins. | 92.75 | |
| KOG3032 | 264 | consensus Uncharacterized conserved protein [Funct | 92.69 | |
| KOG4722 | 672 | consensus Zn-finger protein [General function pred | 88.44 | |
| KOG3408 | 129 | consensus U1-like Zn-finger-containing protein, pr | 88.33 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 85.8 | |
| PF04988 | 165 | AKAP95: A-kinase anchoring protein 95 (AKAP95); In | 85.76 | |
| smart00734 | 26 | ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 | 83.25 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 83.15 | |
| KOG2837 | 309 | consensus Protein containing a U1-type Zn-finger a | 82.47 |
| >KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
Probab=98.98 E-value=6.6e-11 Score=107.85 Aligned_cols=69 Identities=20% Similarity=0.269 Sum_probs=60.9
Q ss_pred eeccCCCCCCCcccccCCCCCCCCCCcCCC------------cCCCeeeeccccccccchHHHHHhhcccchHHHHHHhH
Q 043013 30 QVKPYPNLCGSKQEATTLPADSGKPCSTGS------------KKPMHWSCALCQVSSTSKRNLDEHLRGKKHKAKEEGLE 97 (179)
Q Consensus 30 l~Kpd~n~ygvKRKaktlp~~s~Ev~~~k~------------K~~~eWsCalCqvt~TSE~~L~nHL~GKKHKAk~aaL~ 97 (179)
=+|++||+||+|||++.+||++.|.|..++ ...+.-.|.+|...+.|+.+..+||.+++|+.++..+.
T Consensus 22 HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~a~~~hl~Sk~h~~~~~~~~ 101 (390)
T KOG2785|consen 22 HYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPKAHENHLKSKKHVENLSNHQ 101 (390)
T ss_pred HhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChhhHHHHHHHhhcchhhhhhh
Confidence 379999999999999999999988886665 34457899999999999999999999999999988755
Q ss_pred H
Q 043013 98 R 98 (179)
Q Consensus 98 a 98 (179)
.
T Consensus 102 r 102 (390)
T KOG2785|consen 102 R 102 (390)
T ss_pred c
Confidence 3
|
|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0227 consensus Splicing factor 3a, subunit 2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >KOG4727 consensus U1-like Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PF07535 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PTZ00448 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >smart00586 ZnF_DBF Zinc finger in DBF-like proteins | Back alignment and domain information |
|---|
| >KOG3032 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4722 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >PF04988 AKAP95: A-kinase anchoring protein 95 (AKAP95); InterPro: IPR007071 A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex | Back alignment and domain information |
|---|
| >smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2837 consensus Protein containing a U1-type Zn-finger and implicated in RNA splicing or processing [RNA processing and modification] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 98.01 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 97.95 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 97.2 | |
| 3cw1_L | 77 | U1 small nuclear ribonucleoprotein C; PRE-mRNA spl | 95.62 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 94.66 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 94.56 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.08 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 94.03 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 93.97 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 93.83 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 93.81 | |
| 4dgw_A | 402 | PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A | 93.75 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.7 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 93.61 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 93.46 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 93.31 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 93.17 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.12 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 92.92 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.87 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 92.0 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 92.83 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 92.81 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.78 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 92.71 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.66 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.61 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 92.6 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 92.58 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.51 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 92.5 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 92.49 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.47 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 92.47 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.45 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 92.43 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.41 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 92.34 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 92.33 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 92.32 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.3 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 92.24 | |
| 2yrk_A | 55 | Zinc finger homeobox protein 4; structure genomics | 92.24 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 92.23 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 92.2 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 92.19 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 92.16 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 92.1 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 92.09 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 92.08 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 92.06 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.02 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 92.01 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 92.0 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 92.0 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.99 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.99 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.97 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 91.97 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 91.21 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.96 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 91.93 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.92 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.92 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.9 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 91.89 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.89 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.84 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 91.78 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.77 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 91.76 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.76 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.75 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.75 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.73 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 91.72 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.71 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.69 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 91.68 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.68 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.67 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.66 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.66 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 91.64 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 91.63 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.62 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.61 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 91.61 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.51 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.48 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 91.45 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 91.44 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.43 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 91.39 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 91.37 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.34 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.32 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.29 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 91.26 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 91.23 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.23 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.19 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.16 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 91.14 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 91.14 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 90.46 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.07 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 91.05 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.04 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 91.03 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 91.02 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.02 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.0 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.0 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.0 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 90.96 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 90.94 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 90.92 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 90.91 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 90.89 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.89 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 90.83 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 90.83 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 90.83 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 90.81 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 90.8 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 90.77 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 90.76 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.75 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 90.71 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 90.71 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.66 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 90.59 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 90.56 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.53 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.52 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 90.45 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.42 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 90.24 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 90.23 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 90.2 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 90.11 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 89.77 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 89.76 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 89.75 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 89.65 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 89.58 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 89.46 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 89.29 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 89.18 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 89.16 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 89.08 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 88.8 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 88.33 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 88.32 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 88.29 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 88.27 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 88.21 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 88.07 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 88.0 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 87.99 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 87.89 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 87.86 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 87.85 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 87.57 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 87.57 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 87.54 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 87.51 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 87.22 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 86.94 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 86.71 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 86.48 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 86.4 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 86.15 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 85.92 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 85.75 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 85.64 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 85.38 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 85.36 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 85.3 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 84.95 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 84.65 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 84.35 | |
| 4f9c_B | 144 | Protein DBF4 homolog A; Ser/Thr protein kinase, tr | 84.31 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 84.05 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 83.89 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 83.77 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 83.72 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 83.56 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 83.3 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 83.28 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 83.25 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 83.05 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 82.72 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 81.52 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 80.74 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 80.69 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 80.56 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 80.37 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 80.32 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 80.19 |
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
Probab=98.01 E-value=2.4e-06 Score=64.37 Aligned_cols=36 Identities=19% Similarity=0.286 Sum_probs=32.6
Q ss_pred CCCeeeeccccccccchHHHHHhhcccchHHHHHHh
Q 043013 61 KPMHWSCALCQVSSTSKRNLDEHLRGKKHKAKEEGL 96 (179)
Q Consensus 61 ~~~eWsCalCqvt~TSE~~L~nHL~GKKHKAk~aaL 96 (179)
....|.|.+|++.|+|+..|.+|+.||+|+.++..+
T Consensus 90 ~~~~~~C~~C~~~f~s~~~~~~H~~gk~H~~~~~~~ 125 (127)
T 1zu1_A 90 EDRSKCCPVCNMTFSSPVVAESHYIGKTHIKNLRLR 125 (127)
T ss_dssp CCTTTEETTTTEECSSHHHHHHHHTSHHHHHHHHHH
T ss_pred CCCCeEcCCCCCEeCCHHHHHHHHCCHHHHHHHHHh
Confidence 445789999999999999999999999999998765
|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f9c_B Protein DBF4 homolog A; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_B* 4f9b_B* 4f9a_B* | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 97.77 | |
| d1zu1a2 | 55 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 96.82 | |
| d1zu1a1 | 72 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 93.5 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 93.31 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 92.63 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 92.56 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 92.15 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 92.13 | |
| d2yrka1 | 48 | Zinc finger homeobox protein 4, ZFHX4 {Human (Homo | 91.95 | |
| d2vrda1 | 61 | Spliceosomal protein U1C {Human (Homo sapiens) [Ta | 91.92 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 91.76 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 91.56 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 90.77 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 89.49 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 88.6 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 88.22 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 86.59 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 85.56 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 85.04 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 84.5 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 80.87 |
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: HkH motif-containing C2H2 finger domain: Zinc finger protein 593, ZNF593 species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.77 E-value=4.6e-06 Score=57.45 Aligned_cols=35 Identities=29% Similarity=0.446 Sum_probs=32.7
Q ss_pred eeeeccccccccchHHHHHhhcccchHHHHHHhHH
Q 043013 64 HWSCALCQVSSTSKRNLDEHLRGKKHKAKEEGLER 98 (179)
Q Consensus 64 eWsCalCqvt~TSE~~L~nHL~GKKHKAk~aaL~a 98 (179)
.|.|-.|.+.|.|+..|++|+.+|+||-.+.+|+.
T Consensus 15 qfYCv~C~K~F~se~~l~~H~ksKkHKrrvk~L~~ 49 (67)
T d1zr9a1 15 LHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSV 49 (67)
T ss_dssp CSEETTTTEECSSHHHHHHHTTCHHHHHHHHHHTS
T ss_pred EEecccccCccCCHHHHHHHHcccHHHHHHHHhcc
Confidence 59999999999999999999999999999988854
|
| >d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|