Citrus Sinensis ID: 043056

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------56
MAEIILTIVVEVVKCLAPPAYRQISYLRESKCTGNVQNLKAEVENLKSERVSTQHKVDEAKRKGEEIEENVENWLARANNVIVEADKFTDDEATANKRCFKGLCPNLKTRRRLSKEAERQKEAAVKVREARRFDRISYCTAPEDIRLIFNKDYLPFESRMFTLRNILSALEDPDVNMLGIYGMGGIGKTMLAEEVARKVKSDKLFDQVVFVEVSQNQDIRKLQGEIADKLGLKFHEESESGRANSLFKRIKAEKKILIILDNIWENLDLRVVGIPHGDGHKDCKVLLTARSLDVLSGKMDSRPNFSIGVLNEEEAWNLFKKMAGDYIEGSEFQSVARDVAKECAGLPVSVVTIARALRNKRLFEWKDALEQLRRPSSTNFKDIQQTAYKAIELSYNKLEGEELKNIFLLIGYTAIASIDALLMCGMGLGLFQGVNKMEVARARVRTLVHKLKASCMLLDHISKNEEFFSMHDVVRDIAISIASREQNALTATNEQVGGFREWSDKSAVKHYTSIVLHDIKANVLPEVVECPQLKLLFIHADKESSSLTIPNNFFKRMIQ
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHccccccccccEEEEEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccEEEEEEccHHHHcccccccccEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccHHHHcccccccccHHHHHHHHccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccEEEcccccEEEEcHHHHHHHHHHHHHcccEEEEEcccccccccccccccEEEEEEEEEccccccccccccccccccEEEccccccccccccccHHHHHccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccEEEEEccHHcHccHHHccccccccccccEEEEEEccHHHHHHHccccccEEEccccHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHccccccHcHHHHHHccHcccccHHHHHHHHHHHccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccEEEEEEEcccccccccccccccccEEEEEEcccccccEEccHHHHHcccc
MAEIILTIVVEVVKclappayrqisylreskctgnvQNLKAEVENLKSERVSTQHKVDEAKRKGEEIEENVENWLARANNVIveadkftddeaTANKrcfkglcpnlktRRRLSKEAERQKEAAVKVREArrfdrisyctapedIRLIFnkdylpfesRMFTLRNILSaledpdvnmlgiygmggigKTMLAEEVARKVKSDKLFDQVVFVEVSQNQDIRKLQGEIADKLGlkfheesesgRANSLFKRIKAEKKILIILDNIWENLdlrvvgiphgdghkDCKVLLTARSLDvlsgkmdsrpnfsigvlNEEEAWNLFKKMAGdyiegsefQSVARDVAKECAGLPVSVVTIARALRNKRLFEWKDALEqlrrpsstnfkDIQQTAYKAIELSYNKLEGEELKNIFLLIGYTAIASIDALLMCGMGLGLFQGVNKMEVARARVRTLVHKLKASCMLLDhiskneeffsMHDVVRDIAISIASREQNALtatneqvggfrewsdksavKHYTSIVLHDikanvlpevvecpqlklLFIHadkesssltipnNFFKRMIQ
MAEIILTIVVEVVKCLAPPAYRQISYLRESKCTGNVQNLKAEvenlkservstqhkvdeakrkgeeieenveNWLARANNVIVEADkftddeatankrcfkglcpnlktrrrlskeaerqkeaavkvrearrfdrisyctapedirLIFNKDYLPFESRMFTLRNILSALEDPDVNMLGIYGMGGIGKTMLAEEVARKVKSDKLFDQVVFVevsqnqdirkLQGEIADKLGLkfheesesgranslfkrIKAEKKILIILDNIWENLDLRVVGIPHGDGHKDCKVLLTARSLDvlsgkmdsrpnfsIGVLNEEEAWNLFKKMAGDYIEGSEFQSVARDVAKECAGLPVSVVTIARALRNKRLFEWKDAleqlrrpsstnfkdIQQTAYKAIELSYNKLEGEELKNIFLLIGYTAIASIDALLMCGMGLGLFQGVNKMEVARARVRTLVHKLKASCMLLDHISKNEEFFSMHDVVRDIAISIASREQNAltatneqvggfrewSDKSAVKHYTSIVLHDIKANVLPEVVECPQLKLLfihadkesssltipnnffkrmiq
MAEIILTIVVEVVKCLAPPAYRQISYLRESKCTGNVQNLKAEVENLKSERVSTQHKVDEAKRKGEEIEENVENWLARANNVIVEADKFTDDEATANKRCFKGLCPNLKTRRRLSKEAERQKEAAVKVREARRFDRISYCTAPEDIRLIFNKDYLPFESRMFTLRNILSALEDPDVNMLGIYGMGGIGKTMLAEEVARKVKSDKLFDQVVFVEVSQNQDIRKLQGEIADKLGLKFHEESESGRANSLFKRIKAEKKILIILDNIWENLDLRVVGIPHGDGHKDCKVLLTARSLDVLSGKMDSRPNFSIGVLNEEEAWNLFKKMAGDYIEGSEFQSVARDVAKECAGLPVSVVTIARALRNKRLFEWKDALEQLRRPSSTNFKDIQQTAYKAIELSYNKLEGEELKNIFLLIGYTAIASIDALLMCGMGLGLFQGVNKMEVARARVRTLVHKLKASCMLLDHISKNEEFFSMHDVVRDIAISIASREQNALTATNEQVGGFREWSDKSAVKHYTSIVLHDIKANVLPEVVECPQLKLLFIHADKESSSLTIPNNFFKRMIQ
***IILTIVVEVVKCLAPPAYRQISYLRESKCTGNVQ*********************************VENWLARANNVIVEADKFTDDEATANKRCFKGLCPNL*******************VREARRFDRISYCTAPEDIRLIFNKDYLPFESRMFTLRNILSALEDPDVNMLGIYGMGGIGKTMLAEEVARKVKSDKLFDQVVFVEVSQNQDIRKLQGEIADKLGLKF**********SLFKRIKAEKKILIILDNIWENLDLRVVGIPHGDGHKDCKVLLTARSLDVLSGKMDSRPNFSIGVLNEEEAWNLFKKMAGDYIEGSEFQSVARDVAKECAGLPVSVVTIARALRNKRLFEWKDALEQLR****TNFKDIQQTAYKAIELSYNKLEGEELKNIFLLIGYTAIASIDALLMCGMGLGLFQGVNKMEVARARVRTLVHKLKASCMLLDHISKNEEFFSMHDVVRDIAISIASREQNALTATNEQVGGFREWSDKSAVKHYTSIVLHDIKANVLPEVVECPQLKLLFIHAD******************
MAEIILTIVVEVVKCLAPPAYRQISYLRESKCTGNVQNLKAEVENLKSERVSTQHKVDEAKRKGEEIEENVENWLARANNVIVEADKFTDDEATANKRCFKGLCPNLKTRRRLSKEAERQK************************************SRMFTLRNILSALEDPDVNMLGIYGMGGIGKTMLAEEVARKVKSDKLFDQVVFVEVSQNQDIRKLQGEIADKL*******************IKAEKKILIILDNIWENLDLRVVGIPHGDGHKDCKVLLTARSLDVLSGKMDSRPNFSIGVLNEEEAWNLFKKMAGDYIEGSEFQSVARDVAKECAGLPVSVVTIARALRNKRLFEWKDALEQLRRP******D**QTAYKAIELSYNKLEGEELKNIFLLIGYTAIASIDALLMCGMGLGLFQGVNKMEVARARVRTLVHKLKASCMLLDHISKNEEFFSMHDVVRDIAISIASREQNALTATNEQV***REWSDKSAVKHYTSIVLHDIKANVLPEVVECPQLKLLFIHADKESSSLTIPNNFFKRMIQ
MAEIILTIVVEVVKCLAPPAYRQISYLRESKCTGNVQNLKAEVENL*******************EIEENVENWLARANNVIVEADKFTDDEATANKRCFKGLCPNLKTR*******************ARRFDRISYCTAPEDIRLIFNKDYLPFESRMFTLRNILSALEDPDVNMLGIYGMGGIGKTMLAEEVARKVKSDKLFDQVVFVEVSQNQDIRKLQGEIADKLGLKFHEESESGRANSLFKRIKAEKKILIILDNIWENLDLRVVGIPHGDGHKDCKVLLTARSLDVLSGKMDSRPNFSIGVLNEEEAWNLFKKMAGDYIEGSEFQSVARDVAKECAGLPVSVVTIARALRNKRLFEWKDALEQLRRPSSTNFKDIQQTAYKAIELSYNKLEGEELKNIFLLIGYTAIASIDALLMCGMGLGLFQGVNKMEVARARVRTLVHKLKASCMLLDHISKNEEFFSMHDVVRDIAISIASREQNALTATNEQVGGFREWSDKSAVKHYTSIVLHDIKANVLPEVVECPQLKLLFIHADKESSSLTIPNNFFKRMIQ
MAEIILTIVVEVVKCLAPPAYRQISYLRESKCTGNVQNLKAEVENLKSERVSTQHKVDEAKRKGEEIEENVENWLARANNVIVEADKFTDDEATANKRCFKGLCPNLKTRRRLSKEAERQKEAAVKVREARRFDRISYCT****IRLIFN**YLPFESRMFTLRNILSALEDPDVNMLGIYGMGGIGKTMLAEEVARKVKSDKLFDQVVFVEVSQNQDIRKLQGEIADKLGLKFHEESESGRANSLFKRIKAEKKILIILDNIWENLDLRVVGIPHGDGHKDCKVLLTARSLDVLSGKMDSRPNFSIGVLNEEEAWNLFKKMAGDYIEGSEFQSVARDVAKECAGLPVSVVTIARALRNKRLFEWKDALEQLRRPSSTNFKDIQQTAYKAIELSYNKLEGEELKNIFLLIGYTAIASIDALLMCGMGLGLFQGVNKMEVARARVRTLVHKLKASCMLLDHISKNEEFFSMHDVVRDIAISIASREQNALTATNEQVGGFREWSDKSAVKHYTSIVLHDIKANVLPEVVECPQLKLLFIHADKESSSLTIPNNFFKRMI*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEIILTIVVEVVKCLAPPAYRQISYLRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxANNVIVEADKFTDDEATANKRCFKGLCPNLKTxxxxxxxxxxxxxxxxxxxxxRRFDRISYCTAPEDIRLIFNKDYLPFESRMFTLRNILSALEDPDVNMLGIYGMGGIGKTMLAEEVARKVKSDKLFDQVVFVEVSQNQDIRKLQGEIADKLGLKFHEESESGRANSLFKRIKAEKKILIILDNIWENLDLRVVGIPHGDGHKDCKVLLTARSLDVLSGKMDSRPNFSIGVLNEEEAWNLFKKMAGDYIEGSEFQSVARDVAKECAGLPVSVVTIARALRNKRLFEWKDALEQLRRPSSTNFKDIQQTAYKAIELSYNKLEGEELKNIFLLIGYTAIASIDALLMCGMGLGLFQGVNKMEVARARVRTLVHKLKASCMLLDHISKNEEFFSMHDVVRDIAISIASREQNALTATNEQVGGFREWSDKSAVKHYTSIVLHDIKANVLPEVVECPQLKLLFIHADKESSSLTIPNNFFKRMIQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query559 2.2.26 [Sep-21-2011]
O22727 967 Probable disease resistan yes no 0.908 0.525 0.274 1e-43
O81825 919 Probable disease resistan no no 0.669 0.406 0.314 1e-42
O64973 889 Disease resistance protei no no 0.901 0.566 0.276 1e-41
Q9T048 985 Disease resistance protei no no 0.669 0.379 0.311 2e-41
P60838 894 Probable disease resistan no no 0.889 0.555 0.285 2e-41
Q940K0 889 Probable disease resistan no no 0.910 0.572 0.276 3e-41
O64789 925 Probable disease resistan no no 0.890 0.538 0.272 5e-41
Q8RXS5 888 Probable disease resistan no no 0.899 0.566 0.267 5e-39
Q8L3R3 885 Disease resistance protei no no 0.774 0.489 0.282 6e-39
P60839 884 Probable disease resistan no no 0.915 0.579 0.256 3e-37
>sp|O22727|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1 Back     alignment and function desciption
 Score =  178 bits (452), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 152/554 (27%), Positives = 272/554 (49%), Gaps = 46/554 (8%)

Query: 12  VVKCLAPPAYRQISYLRESKCTGNVQNLKAEVENLKSERVSTQHKVDEAKRKGEEIEENV 71
           +++CL    Y  I  L +     N++ L+ E+E+L++ +   Q+KV   + + ++  E V
Sbjct: 18  IIRCLCGKGY--IRNLEK-----NLRALQREMEDLRATQHEVQNKVAREESRHQQRLEAV 70

Query: 72  ENWLARANNVIVEA-DKFTDDEATANKRCFKGLCPN-LKTRRRLSKEAERQKEAAVKVRE 129
           + WL R N++ +E  D  +       K C  GLC   + +  +  K      E   K++ 
Sbjct: 71  QVWLDRVNSIDIECKDLLSVSPVELQKLCLCGLCSKYVCSSYKYGKRVFLLLEEVTKLKS 130

Query: 130 ARRFDRISYCTAPEDIRLIFNKDYLPFESRMFTLRNILSALEDPDVNMLGIYGMGGIGKT 189
              FD +S    P     +  +   P   +   L+   + L +  V ++G++GMGG+GKT
Sbjct: 131 EGNFDEVS---QPPPRSEVEERPTQPTIGQEEMLKKAWNRLMEDGVGIMGLHGMGGVGKT 187

Query: 190 MLAEEVARK-VKSDKLFDQVVFVEVSQNQDIRKLQGEIADKLGL---KFHEESESGRANS 245
            L +++  K  ++   FD V+++ VSQ   + KLQ +IA+KL L    +  ++ES +A  
Sbjct: 188 TLFKKIHNKFAETGGTFDIVIWIVVSQGAKLSKLQEDIAEKLHLCDDLWKNKNESDKATD 247

Query: 246 LFKRIKAEKKILIILDNIWENLDLRVVGIPHGDGHKDCKVLLTARSLDVLSGKMDSRPNF 305
           + + +K  K+ +++LD+IWE +DL  +GIP+      CKV  T R   V     D +P  
Sbjct: 248 IHRVLKG-KRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRDQKVCGQMGDHKP-M 305

Query: 306 SIGVLNEEEAWNLFKKMAGDYIEGSE--FQSVARDVAKECAGLPVSVVTIARALRNKRLF 363
            +  L  E+AW LFK   GD    S+     +AR+VA++C GLP+++  I   + +K + 
Sbjct: 306 QVKCLEPEDAWELFKNKVGDNTLRSDPVIVGLAREVAQKCRGLPLALSCIGETMASKTMV 365

Query: 364 -EWKDALEQLRRPSSTNFKDIQQTAYKAIELSYNKLEGEELKNIFLLIGYTAIASIDALL 422
            EW+ A++ L R S+  F D+Q      ++ SY+ LE E +K+ FL   Y A+   D  +
Sbjct: 366 QEWEHAIDVLTR-SAAEFSDMQNKILPILKYSYDSLEDEHIKSCFL---YCALFPEDDKI 421

Query: 423 ---------MCGMGLGLFQGVNKMEVARARVRTLVHKLKASCMLLDHISKNEEFFSMHDV 473
                    +C   +G  Q + +   AR +   ++  L  + +L +     +    MHDV
Sbjct: 422 DTKTLINKWICEGFIGEDQVIKR---ARNKGYEMLGTLIRANLLTNDRGFVKWHVVMHDV 478

Query: 474 VRDIAISIASR--EQNALTATNEQVGGFREWSDKSAVKHYTSIVLHDIKANVLPEVV--- 528
           VR++A+ IAS   +Q        +VG      +   VK + ++    +  N + E+    
Sbjct: 479 VREMALWIASDFGKQKENYVVRARVG----LHEIPKVKDWGAVRRMSLMMNEIEEITCES 534

Query: 529 ECPQLKLLFIHADK 542
           +C +L  LF+ +++
Sbjct: 535 KCSELTTLFLQSNQ 548
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|P60839|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query559
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.983 0.324 0.439 1e-128
224147195554 cc-nbs resistance protein [Populus trich 0.958 0.967 0.452 1e-126
359488288 1340 PREDICTED: LOW QUALITY PROTEIN: probable 0.964 0.402 0.442 1e-125
359488027 1520 PREDICTED: disease resistance protein At 0.980 0.360 0.449 1e-124
359488108 1436 PREDICTED: disease resistance protein At 0.983 0.383 0.432 1e-122
359488095 1347 PREDICTED: probable disease resistance p 0.982 0.407 0.428 1e-122
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.960 0.408 0.449 1e-122
147802546 1409 hypothetical protein VITISV_007222 [Viti 0.910 0.361 0.462 1e-122
147777048 1460 hypothetical protein VITISV_009359 [Viti 0.982 0.376 0.429 1e-121
359488101 1677 PREDICTED: disease resistance protein At 0.983 0.327 0.427 1e-121
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 246/560 (43%), Positives = 359/560 (64%), Gaps = 10/560 (1%)

Query: 1   MAEIILTIVVEVVKCLAPPAYRQISYLRESKCTGNVQNLKAEVENLKSERVSTQHKVDEA 60
           M EI+L++  +V + L  PA RQ+ YL   +   N+++L  +VE L+  R   QH VDEA
Sbjct: 1   MVEIVLSVAAKVSEYLVDPAIRQLGYLFNYR--ANIEDLSQQVEKLRDARARLQHSVDEA 58

Query: 61  KRKGEEIEENVENWLARANNVIVEADKFTDDEATANKRCFKGLCPNLKTRRRLSKEAERQ 120
              G  IE++V  W+ RA+  I  A KF +DE  A K CF GLCPNLK+R +LS+EA ++
Sbjct: 59  IGNGHIIEDDVRKWMKRADGFIQNACKFLEDEKEARKSCFNGLCPNLKSRYQLSREARKK 118

Query: 121 KEAAVKVREARRFDRISYCTAPEDIRLIFNKDYLPFESRMFTLRNILSALEDPDVNMLGI 180
              AV++  A +F+R+SY    ++IR   ++     ESRM TL  ++ AL D ++N +G+
Sbjct: 119 AGVAVEIHGAGQFERVSYRAPLQEIRTAPSE---ALESRMLTLNEVMEALRDANINRIGV 175

Query: 181 YGMGGIGKTMLAEEVARKVKSDKLFDQVVFVEVSQNQDIRKLQGEIADKLGLKFHEESES 240
           +GMGG+GK+ L ++VA + + +KLF +VV V V Q  D + +Q +IADKLG+KF E SE 
Sbjct: 176 WGMGGVGKSTLVKQVAEQAEQEKLFRKVVMVPVIQTPDFKGIQQQIADKLGMKFEEVSEQ 235

Query: 241 GRANSLFKRIKAEKKILIILDNIWENLDLRVVGIPHGDGHKDCKVLLTARSLDVLSGKMD 300
           GRA+ L +RIK E  ILIILD++W  L+L  VGIP  D HK CK++LT+R+  VLS +M 
Sbjct: 236 GRADRLHQRIKQENTILIILDDLWAELELEKVGIPSPDDHKGCKLVLTSRNKQVLSNEMS 295

Query: 301 SRPNFSIGVLNEEEAWNLFKKMAGDYIEGSEFQSVARDVAKECAGLPVSVVTIARALRNK 360
           ++ +F +  L E+E W LFK  AGD IE  E Q +A DVAKECAGLP+++VT+A+AL+NK
Sbjct: 296 TQKDFRVQHLQEDETWILFKNTAGDSIENPELQPIAVDVAKECAGLPIAIVTVAKALKNK 355

Query: 361 RLFEWKDALEQLRRPSSTNFKDIQQTAYKAIELSYNKLEGEELKNIFLLIG-YTAIASID 419
            +  WKDAL+QL   +STN   ++   Y +++LSY  LEG+E+K++FLL G ++    I 
Sbjct: 356 NVSIWKDALQQLNSQTSTNITGMETKVYSSLKLSYEHLEGDEVKSLFLLCGLFSNYIYIR 415

Query: 420 ALLMCGMGLGLFQGVNKMEVARARVRTLVHKLKASCMLLDHISKNEEFFSMHDVVRDIAI 479
            LL  GMGL LFQG N +E A+ R+ TLV  LK+S +LL+  + +     MHDVVR +A+
Sbjct: 416 DLLKYGMGLRLFQGTNTLEEAKNRIDTLVDNLKSSNLLLE--TGHNAVVRMHDVVRSVAL 473

Query: 480 SIASREQNALTATNEQVGGFREWSDKSAVKHYTSIVLHDIKANVLPEVVECPQLKLLFIH 539
            I+S++ +  T   +  G   +W     ++    +   +   + LPE + CP+LK LFI 
Sbjct: 474 DISSKDHHVFT-LQQTTGRVEKWPRIDELQKVIWVNQDECDIHELPEGLVCPKLK-LFIC 531

Query: 540 ADKESSSLTIPNNFFKRMIQ 559
             K +S++ IPN FF+ M Q
Sbjct: 532 CLKTNSAVKIPNTFFEGMKQ 551

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224147195|ref|XP_002336426.1| cc-nbs resistance protein [Populus trichocarpa] gi|222834979|gb|EEE73428.1| cc-nbs resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488108|ref|XP_003633701.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488095|ref|XP_002270726.2| PREDICTED: probable disease resistance protein At4g27220-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147802546|emb|CAN77665.1| hypothetical protein VITISV_007222 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147777048|emb|CAN65562.1| hypothetical protein VITISV_009359 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488101|ref|XP_002263761.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query559
TAIR|locus:2008510 967 AT1G61190 "AT1G61190" [Arabido 0.915 0.529 0.269 5.5e-48
TAIR|locus:2034770 894 SUMM2 "AT1G12280" [Arabidopsis 0.944 0.590 0.286 5.6e-48
TAIR|locus:2136447 985 AT4G27190 [Arabidopsis thalian 0.935 0.530 0.267 6.6e-46
TAIR|locus:2008440 899 AT1G61180 [Arabidopsis thalian 0.921 0.572 0.274 7.9e-46
TAIR|locus:2201996 889 RPS5 "AT1G12220" [Arabidopsis 0.896 0.563 0.28 1.6e-45
TAIR|locus:2131689 919 AT4G27220 [Arabidopsis thalian 0.889 0.540 0.282 2.3e-45
TAIR|locus:2166320 888 AT5G63020 [Arabidopsis thalian 0.905 0.569 0.263 6.4e-43
TAIR|locus:2201986 885 RFL1 "AT1G12210" [Arabidopsis 0.919 0.580 0.266 5.6e-41
TAIR|locus:2034765 884 AT1G12290 [Arabidopsis thalian 0.932 0.589 0.255 5.2e-40
TAIR|locus:2203881 893 AT1G62630 [Arabidopsis thalian 0.910 0.569 0.270 3.9e-39
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 510 (184.6 bits), Expect = 5.5e-48, P = 5.5e-48
 Identities = 148/550 (26%), Positives = 279/550 (50%)

Query:    12 VVKCLAPPAYRQISYLRESKCTGNVQNLKAEVENLKSERVSTQHKVDEAKRKGEEIEENV 71
             +++CL    Y  I  L +     N++ L+ E+E+L++ +   Q+KV   + + ++  E V
Sbjct:    18 IIRCLCGKGY--IRNLEK-----NLRALQREMEDLRATQHEVQNKVAREESRHQQRLEAV 70

Query:    72 ENWLARANNVIVEA-DKFTDDEATANKRCFKGLCPN-LKTRRRLSKEAERQKEAAVKVRE 129
             + WL R N++ +E  D  +       K C  GLC   + +  +  K      E   K++ 
Sbjct:    71 QVWLDRVNSIDIECKDLLSVSPVELQKLCLCGLCSKYVCSSYKYGKRVFLLLEEVTKLKS 130

Query:   130 ARRFDRISYCTAPEDIRLIFNKDYLPFESRMFTLRNILSALEDPDVNMLGIYGMGGIGKT 189
                FD +S      ++     +   P   +   L+   + L +  V ++G++GMGG+GKT
Sbjct:   131 EGNFDEVSQPPPRSEVE---ERPTQPTIGQEEMLKKAWNRLMEDGVGIMGLHGMGGVGKT 187

Query:   190 MLAEEVARK-VKSDKLFDQVVFVEVSQNQDIRKLQGEIADKLGL---KFHEESESGRANS 245
              L +++  K  ++   FD V+++ VSQ   + KLQ +IA+KL L    +  ++ES +A  
Sbjct:   188 TLFKKIHNKFAETGGTFDIVIWIVVSQGAKLSKLQEDIAEKLHLCDDLWKNKNESDKATD 247

Query:   246 LFKRIKAEKKILIILDNIWENLDLRVVGIPHGDGHKDCKVLLTARSLDVLSGKMDSRPNF 305
             + + +K  K+ +++LD+IWE +DL  +GIP+      CKV  T R   V     D +P  
Sbjct:   248 IHRVLKG-KRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRDQKVCGQMGDHKP-M 305

Query:   306 SIGVLNEEEAWNLFKKMAGDYIEGSE--FQSVARDVAKECAGLPVSVVTIARALRNKRLF 363
              +  L  E+AW LFK   GD    S+     +AR+VA++C GLP+++  I   + +K + 
Sbjct:   306 QVKCLEPEDAWELFKNKVGDNTLRSDPVIVGLAREVAQKCRGLPLALSCIGETMASKTMV 365

Query:   364 -EWKDALEQLRRPSSTNFKDIQQTAYKAIELSYNKLEGEELKNIFLLIG-YTAIASIDAL 421
              EW+ A++ L R S+  F D+Q      ++ SY+ LE E +K+ FL    +     ID  
Sbjct:   366 QEWEHAIDVLTR-SAAEFSDMQNKILPILKYSYDSLEDEHIKSCFLYCALFPEDDKIDTK 424

Query:   422 LMCGMGLGLFQG-VNKMEVARARVRTLVHKLKASCMLLDHISKNEEFFS----MHDVVRD 476
              +  +   + +G + + +V + R R   +++  + +  + ++ +  F      MHDVVR+
Sbjct:   425 TL--INKWICEGFIGEDQVIK-RARNKGYEMLGTLIRANLLTNDRGFVKWHVVMHDVVRE 481

Query:   477 IAISIAS----REQNALTATNEQVGGFREWSDKSAVKHYTSIVLHDIKANVLPEVVECPQ 532
             +A+ IAS    +++N +      +    +  D  AV+   S+++++I+  +  E  +C +
Sbjct:   482 MALWIASDFGKQKENYVVRARVGLHEIPKVKDWGAVRRM-SLMMNEIE-EITCES-KCSE 538

Query:   533 LKLLFIHADK 542
             L  LF+ +++
Sbjct:   539 LTTLFLQSNQ 548
GO:0005575 "cellular_component" evidence=ND
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203881 AT1G62630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query559
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 7e-43
pfam13401124 pfam13401, AAA_22, AAA domain 5e-07
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 0.001
smart00382148 smart00382, AAA, ATPases associated with a variety 0.001
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.002
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 0.003
COG1474366 COG1474, CDC6, Cdc6-related protein, AAA superfami 0.004
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  154 bits (391), Expect = 7e-43
 Identities = 73/246 (29%), Positives = 118/246 (47%), Gaps = 14/246 (5%)

Query: 171 EDPDVNMLGIYGMGGIGKTMLAEEVARKVKSDKLFDQVVFVEVSQNQDIRKLQGEIADKL 230
              ++ ++GI GMGG+GKT LA+++         FD V +V VS+     +LQ +I  +L
Sbjct: 15  MSDNLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTYTEFRLQKDILQEL 74

Query: 231 GL-----KFHEESESGRANSLFKRIKAEKKILIILDNIWENLDLRVVGIPHGDGHKDCKV 285
           GL         ESE   A  + + +   K+ L++LD++WE  D   +G+P  DG    +V
Sbjct: 75  GLDDSDWVEKNESE--LAVKIKEALL-RKRFLLVLDDVWEKNDWDKIGVPFPDGENGSRV 131

Query: 286 LLTARSLDVLSGKMDSRPNFSIGVLNEEEAWNLFKKMAG--DYIEGSEFQSVARDVAKEC 343
           ++T RS  V      +     +  L  EE+W LF       +     E + VA+++ ++C
Sbjct: 132 IVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKC 191

Query: 344 AGLPVSVVTIARALRNKR-LFEWKDALEQLRRPSSTNFKDIQQTAYKAIELSYNKLEGEE 402
            GLP+++  +   L  K  + EW+  LEQL        +D        + LSY+ L    
Sbjct: 192 KGLPLALKVLGGLLAFKSTVQEWEHVLEQLNN--ELAGRDGLNEVLSILSLSYDNLP-MH 248

Query: 403 LKNIFL 408
           LK  FL
Sbjct: 249 LKRCFL 254

Length = 285
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|224391 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 559
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PRK04841 903 transcriptional regulator MalT; Provisional 99.67
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 99.54
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.35
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.33
COG3899 849 Predicted ATPase [General function prediction only 99.32
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.31
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.29
PF05729166 NACHT: NACHT domain 99.24
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.22
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.16
PRK13342413 recombination factor protein RarA; Reviewed 98.92
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.91
PRK06893229 DNA replication initiation factor; Validated 98.86
COG3903414 Predicted ATPase [General function prediction only 98.86
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.83
PRK12402337 replication factor C small subunit 2; Reviewed 98.81
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.79
PF13173128 AAA_14: AAA domain 98.77
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.76
PRK05564313 DNA polymerase III subunit delta'; Validated 98.76
PTZ001121164 origin recognition complex 1 protein; Provisional 98.75
PRK00440319 rfc replication factor C small subunit; Reviewed 98.74
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 98.71
PRK04195482 replication factor C large subunit; Provisional 98.69
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.69
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 98.69
PLN03025319 replication factor C subunit; Provisional 98.69
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.69
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.61
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.61
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 98.61
PTZ00202550 tuzin; Provisional 98.6
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 98.59
KOG2028554 consensus ATPase related to the helicase subunit o 98.57
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 98.57
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.56
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.56
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 98.55
PRK09112351 DNA polymerase III subunit delta'; Validated 98.55
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 98.53
PRK07940394 DNA polymerase III subunit delta'; Validated 98.52
PRK07471365 DNA polymerase III subunit delta'; Validated 98.49
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.48
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 98.48
cd01128249 rho_factor Transcription termination factor rho is 98.48
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.48
PRK13341 725 recombination factor protein RarA/unknown domain f 98.48
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 98.48
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 98.47
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.47
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 98.45
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 98.45
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.44
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.43
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 98.43
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 98.41
PRK09376416 rho transcription termination factor Rho; Provisio 98.41
PRK08727233 hypothetical protein; Validated 98.4
PRK08084235 DNA replication initiation factor; Provisional 98.4
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.4
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 98.4
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.31
PF14516331 AAA_35: AAA-like domain 98.31
PRK09087226 hypothetical protein; Validated 98.31
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.3
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.28
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.28
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.25
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.24
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.24
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 98.24
TIGR00767415 rho transcription termination factor Rho. Members 98.22
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.22
PRK03992389 proteasome-activating nucleotidase; Provisional 98.22
PHA02544316 44 clamp loader, small subunit; Provisional 98.21
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.19
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.19
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 98.18
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 98.16
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 98.14
PRK14087450 dnaA chromosomal replication initiation protein; P 98.13
PRK05642234 DNA replication initiation factor; Validated 98.13
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 98.13
PRK07399314 DNA polymerase III subunit delta'; Validated 98.13
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.13
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.13
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 98.13
CHL00095 821 clpC Clp protease ATP binding subunit 98.12
COG2255332 RuvB Holliday junction resolvasome, helicase subun 98.12
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 98.09
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 98.09
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.08
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 98.07
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 98.06
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.06
PRK11331459 5-methylcytosine-specific restriction enzyme subun 97.99
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.98
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.98
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.96
PRK05707328 DNA polymerase III subunit delta'; Validated 97.96
CHL00181287 cbbX CbbX; Provisional 97.95
PF00004132 AAA: ATPase family associated with various cellula 97.95
PRK00149450 dnaA chromosomal replication initiation protein; R 97.94
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.9
PRK10865 857 protein disaggregation chaperone; Provisional 97.87
smart00382148 AAA ATPases associated with a variety of cellular 97.87
PRK14086617 dnaA chromosomal replication initiation protein; P 97.87
KOG2543438 consensus Origin recognition complex, subunit 5 [R 97.85
PRK14088440 dnaA chromosomal replication initiation protein; P 97.84
PRK06620214 hypothetical protein; Validated 97.83
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 97.83
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 97.82
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 97.79
CHL00176638 ftsH cell division protein; Validated 97.79
PRK12422445 chromosomal replication initiation protein; Provis 97.78
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 97.78
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 97.76
PRK08769319 DNA polymerase III subunit delta'; Validated 97.74
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 97.74
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 97.71
PRK08058329 DNA polymerase III subunit delta'; Validated 97.68
PRK06871325 DNA polymerase III subunit delta'; Validated 97.67
PRK10536262 hypothetical protein; Provisional 97.65
TIGR00763775 lon ATP-dependent protease La. This protein is ind 97.64
PRK06090319 DNA polymerase III subunit delta'; Validated 97.59
KOG0731774 consensus AAA+-type ATPase containing the peptidas 97.57
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.55
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 97.55
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 97.52
PRK08118167 topology modulation protein; Reviewed 97.5
CHL00195489 ycf46 Ycf46; Provisional 97.49
PRK08116268 hypothetical protein; Validated 97.49
PRK07993334 DNA polymerase III subunit delta'; Validated 97.48
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 97.47
PRK04132846 replication factor C small subunit; Provisional 97.47
PRK06964342 DNA polymerase III subunit delta'; Validated 97.47
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 97.46
PF05659147 RPW8: Arabidopsis broad-spectrum mildew resistance 97.43
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.41
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 97.37
PRK12608380 transcription termination factor Rho; Provisional 97.35
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.34
PRK10865857 protein disaggregation chaperone; Provisional 97.34
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.33
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 97.31
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 97.31
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 97.28
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.28
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 97.26
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 97.25
PRK07261171 topology modulation protein; Provisional 97.25
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.24
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 97.22
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.2
PRK08181269 transposase; Validated 97.19
COG0470325 HolB ATPase involved in DNA replication [DNA repli 97.18
COG0593408 DnaA ATPase involved in DNA replication initiation 97.18
PHA00729226 NTP-binding motif containing protein 97.18
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 97.18
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.15
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 97.13
CHL00095821 clpC Clp protease ATP binding subunit 97.13
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.12
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 97.05
KOG0734752 consensus AAA+-type ATPase containing the peptidas 97.04
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 97.03
PRK06526254 transposase; Provisional 97.03
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.02
PRK08939306 primosomal protein DnaI; Reviewed 97.01
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.01
KOG1969 877 consensus DNA replication checkpoint protein CHL12 96.98
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.97
PRK09183259 transposase/IS protein; Provisional 96.96
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 96.96
PRK12377248 putative replication protein; Provisional 96.94
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.91
PRK08699325 DNA polymerase III subunit delta'; Validated 96.91
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.87
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 96.87
PRK06696223 uridine kinase; Validated 96.86
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.82
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 96.81
TIGR02012321 tigrfam_recA protein RecA. This model describes or 96.8
PRK00771437 signal recognition particle protein Srp54; Provisi 96.79
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 96.79
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 96.78
PRK07952244 DNA replication protein DnaC; Validated 96.74
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.73
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.72
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 96.71
PRK09354349 recA recombinase A; Provisional 96.71
cd00983325 recA RecA is a bacterial enzyme which has roles in 96.7
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.7
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 96.7
KOG2228408 consensus Origin recognition complex, subunit 4 [R 96.69
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 96.68
PRK09270229 nucleoside triphosphate hydrolase domain-containin 96.67
PRK05541176 adenylylsulfate kinase; Provisional 96.65
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 96.65
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.6
PRK09361225 radB DNA repair and recombination protein RadB; Pr 96.56
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.55
COG2884223 FtsE Predicted ATPase involved in cell division [C 96.54
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 96.54
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 96.53
PRK06921266 hypothetical protein; Provisional 96.5
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 96.5
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 96.48
PRK07132299 DNA polymerase III subunit delta'; Validated 96.46
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 96.46
KOG0736953 consensus Peroxisome assembly factor 2 containing 96.46
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 96.46
PRK06547172 hypothetical protein; Provisional 96.45
PRK04296190 thymidine kinase; Provisional 96.45
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 96.44
PRK07667193 uridine kinase; Provisional 96.44
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.42
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.41
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 96.37
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.37
cd01394218 radB RadB. The archaeal protein radB shares simila 96.37
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.36
TIGR02236310 recomb_radA DNA repair and recombination protein R 96.33
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 96.32
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.31
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 96.31
PRK04301317 radA DNA repair and recombination protein RadA; Va 96.3
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 96.29
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 96.27
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.26
PHA02244383 ATPase-like protein 96.25
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 96.25
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.23
cd01124187 KaiC KaiC is a circadian clock protein primarily f 96.23
PTZ00035337 Rad51 protein; Provisional 96.2
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 96.19
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 96.19
PRK15455 644 PrkA family serine protein kinase; Provisional 96.19
TIGR00959428 ffh signal recognition particle protein. This mode 96.15
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.15
PRK08233182 hypothetical protein; Provisional 96.13
PRK05480209 uridine/cytidine kinase; Provisional 96.13
KOG1514767 consensus Origin recognition complex, subunit 1, a 96.11
PRK13531498 regulatory ATPase RavA; Provisional 96.11
PTZ00301210 uridine kinase; Provisional 96.11
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 96.1
PRK04328249 hypothetical protein; Provisional 96.1
cd03115173 SRP The signal recognition particle (SRP) mediates 96.09
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.09
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.08
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 96.08
PRK06067234 flagellar accessory protein FlaH; Validated 96.07
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 96.06
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 96.05
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 96.05
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 96.05
PRK05439311 pantothenate kinase; Provisional 96.04
PF12061402 DUF3542: Protein of unknown function (DUF3542); In 96.04
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 96.03
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.02
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 96.02
PF00154322 RecA: recA bacterial DNA recombination protein; In 96.01
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.01
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 95.99
PLN03186342 DNA repair protein RAD51 homolog; Provisional 95.99
TIGR01817534 nifA Nif-specific regulatory protein. This model r 95.98
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 95.98
TIGR00235207 udk uridine kinase. Model contains a number of lon 95.95
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 95.94
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 95.94
PRK10867433 signal recognition particle protein; Provisional 95.94
PRK06762166 hypothetical protein; Provisional 95.93
PRK14974336 cell division protein FtsY; Provisional 95.93
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 95.9
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 95.88
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 95.87
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 95.82
CHL00206 2281 ycf2 Ycf2; Provisional 95.82
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 95.81
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 95.81
PRK06835329 DNA replication protein DnaC; Validated 95.8
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 95.77
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 95.76
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 95.75
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 95.75
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 95.74
TIGR00064272 ftsY signal recognition particle-docking protein F 95.72
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 95.71
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.71
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 95.69
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 95.68
TIGR02974329 phageshock_pspF psp operon transcriptional activat 95.67
PRK03839180 putative kinase; Provisional 95.65
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 95.65
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 95.63
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 95.63
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 95.61
PRK11823446 DNA repair protein RadA; Provisional 95.61
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 95.6
PRK00131175 aroK shikimate kinase; Reviewed 95.6
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 95.59
PTZ00494664 tuzin-like protein; Provisional 95.58
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 95.56
PRK05917290 DNA polymerase III subunit delta'; Validated 95.56
PRK00409782 recombination and DNA strand exchange inhibitor pr 95.56
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 95.55
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 95.54
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 95.53
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 95.53
cd02117212 NifH_like This family contains the NifH (iron prot 95.52
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 95.51
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 95.46
PRK09519 790 recA DNA recombination protein RecA; Reviewed 95.45
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 95.43
PRK04040188 adenylate kinase; Provisional 95.41
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 95.41
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 95.4
COG4240300 Predicted kinase [General function prediction only 95.37
PRK08927442 fliI flagellum-specific ATP synthase; Validated 95.36
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 95.36
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 95.34
PRK08972444 fliI flagellum-specific ATP synthase; Validated 95.34
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 95.34
PRK13765 637 ATP-dependent protease Lon; Provisional 95.34
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 95.33
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.33
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 95.33
PF1324576 AAA_19: Part of AAA domain 95.32
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 95.32
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 95.27
PRK09435332 membrane ATPase/protein kinase; Provisional 95.27
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 95.26
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 95.26
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 95.24
PRK13236296 nitrogenase reductase; Reviewed 95.24
PRK00625173 shikimate kinase; Provisional 95.23
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 95.22
PRK06217183 hypothetical protein; Validated 95.22
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 95.2
PHA02774613 E1; Provisional 95.2
PRK06002450 fliI flagellum-specific ATP synthase; Validated 95.17
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 95.16
PRK11608326 pspF phage shock protein operon transcriptional ac 95.14
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 95.12
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 95.11
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 95.1
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 95.09
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 95.09
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 95.09
PRK15429686 formate hydrogenlyase transcriptional activator Fh 95.08
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 95.07
PRK13235274 nifH nitrogenase reductase; Reviewed 95.07
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 95.05
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.04
PRK13232273 nifH nitrogenase reductase; Reviewed 95.03
PRK08149428 ATP synthase SpaL; Validated 95.02
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 95.01
PRK00889175 adenylylsulfate kinase; Provisional 94.99
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 94.99
PRK15453290 phosphoribulokinase; Provisional 94.98
PRK14527191 adenylate kinase; Provisional 94.97
PTZ00088229 adenylate kinase 1; Provisional 94.97
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 94.95
PRK00300205 gmk guanylate kinase; Provisional 94.95
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 94.94
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 94.93
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 94.9
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 94.9
PRK14737186 gmk guanylate kinase; Provisional 94.88
PLN02165334 adenylate isopentenyltransferase 94.86
PF07726131 AAA_3: ATPase family associated with various cellu 94.86
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 94.86
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 94.84
PRK03846198 adenylylsulfate kinase; Provisional 94.82
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 94.82
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 94.81
TIGR01040466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 94.81
PRK13230279 nitrogenase reductase-like protein; Reviewed 94.8
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 94.8
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 94.8
COG1936180 Predicted nucleotide kinase (related to CMP and AM 94.77
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 94.76
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 94.76
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 94.75
COG1126240 GlnQ ABC-type polar amino acid transport system, A 94.74
PRK13947171 shikimate kinase; Provisional 94.74
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 94.72
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 94.72
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 94.7
PTZ00185574 ATPase alpha subunit; Provisional 94.69
PRK13949169 shikimate kinase; Provisional 94.68
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 94.68
PRK13975196 thymidylate kinase; Provisional 94.67
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 94.67
PRK14530215 adenylate kinase; Provisional 94.67
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 94.66
PRK14738206 gmk guanylate kinase; Provisional 94.65
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 94.64
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 94.64
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 94.62
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 94.62
PRK06851367 hypothetical protein; Provisional 94.61
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 94.6
PRK06936439 type III secretion system ATPase; Provisional 94.57
COG0003322 ArsA Predicted ATPase involved in chromosome parti 94.57
PRK12339197 2-phosphoglycerate kinase; Provisional 94.56
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 94.56
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 94.55
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 94.55
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 94.52
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 94.51
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 94.51
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 94.5
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 94.5
PRK05022509 anaerobic nitric oxide reductase transcription reg 94.5
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 94.47
PRK05057172 aroK shikimate kinase I; Reviewed 94.47
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 94.46
PRK12678672 transcription termination factor Rho; Provisional 94.46
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 94.44
PRK05922434 type III secretion system ATPase; Validated 94.41
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 94.41
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 94.41
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 94.39
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 94.38
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. 94.37
COG0714329 MoxR-like ATPases [General function prediction onl 94.36
TIGR03496411 FliI_clade1 flagellar protein export ATPase FliI. 94.35
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 94.33
PRK00698205 tmk thymidylate kinase; Validated 94.32
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 94.32
PRK14529223 adenylate kinase; Provisional 94.3
COG1136226 SalX ABC-type antimicrobial peptide transport syst 94.29
PRK13407334 bchI magnesium chelatase subunit I; Provisional 94.28
PRK09099441 type III secretion system ATPase; Provisional 94.27
PLN02200234 adenylate kinase family protein 94.26
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 94.25
cd01878204 HflX HflX subfamily. A distinct conserved domain w 94.25
PRK13695174 putative NTPase; Provisional 94.25
PLN02796347 D-glycerate 3-kinase 94.24
PRK07594433 type III secretion system ATPase SsaN; Validated 94.24
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 94.23
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 94.21
PRK04182180 cytidylate kinase; Provisional 94.2
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 94.16
PRK13234295 nifH nitrogenase reductase; Reviewed 94.13
COG4088261 Predicted nucleotide kinase [Nucleotide transport 94.13
PRK09825176 idnK D-gluconate kinase; Provisional 94.12
TIGR01039461 atpD ATP synthase, F1 beta subunit. The sequences 94.11
PRK09280463 F0F1 ATP synthase subunit beta; Validated 94.1
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 94.09
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 94.08
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 94.08
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 94.06
PRK13948182 shikimate kinase; Provisional 94.06
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 94.02
cd03116159 MobB Molybdenum is an essential trace element in t 94.01
TIGR01287275 nifH nitrogenase iron protein. This model describe 93.98
PRK13946184 shikimate kinase; Provisional 93.97
PRK06761282 hypothetical protein; Provisional 93.95
PLN02348395 phosphoribulokinase 93.95
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 93.95
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 93.9
PRK09302509 circadian clock protein KaiC; Reviewed 93.9
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 93.9
PRK06793432 fliI flagellum-specific ATP synthase; Validated 93.89
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 93.88
PRK04196460 V-type ATP synthase subunit B; Provisional 93.85
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 93.85
PRK14531183 adenylate kinase; Provisional 93.85
PRK13768253 GTPase; Provisional 93.82
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 93.81
PRK14532188 adenylate kinase; Provisional 93.8
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 93.79
PRK07276290 DNA polymerase III subunit delta'; Validated 93.78
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 93.78
CHL00060494 atpB ATP synthase CF1 beta subunit 93.76
PRK10416318 signal recognition particle-docking protein FtsY; 93.75
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 93.73
PF00005137 ABC_tran: ABC transporter This structure is on hol 93.72
KOG2170344 consensus ATPase of the AAA+ superfamily [General 93.72
PRK10875615 recD exonuclease V subunit alpha; Provisional 93.7
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 93.7
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 93.68
PRK08356195 hypothetical protein; Provisional 93.61
COG4136213 ABC-type uncharacterized transport system, ATPase 93.59
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 93.58
PF1355562 AAA_29: P-loop containing region of AAA domain 93.58
PRK05688451 fliI flagellum-specific ATP synthase; Validated 93.56
PRK03731171 aroL shikimate kinase II; Reviewed 93.54
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 93.53
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 93.52
PRK07721438 fliI flagellum-specific ATP synthase; Validated 93.5
PHA02530300 pseT polynucleotide kinase; Provisional 93.5
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 93.46
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 93.45
TIGR03497413 FliI_clade2 flagellar protein export ATPase FliI. 93.43
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=3.7e-72  Score=614.11  Aligned_cols=512  Identities=25%  Similarity=0.412  Sum_probs=419.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhcCccchHHHHHHHHHHHHHHHHHHhhhhHHHhhc-----------------hhcc
Q 043056           38 NLKAEVENLKSERVSTQHKVDEAKRKGEEIEENVENWLARANNVIVEADKFTDDEATAN-----------------KRCF  100 (559)
Q Consensus        38 ~~~~~~~~l~~~l~~i~~~l~~a~~~~~~~~~~v~~Wl~~v~~~ayd~ed~ld~~~~~~-----------------~~~~  100 (559)
                      +.++.+..|+++|..++.++++++.++ .....+..|...+++++|+++|.++.+....                 .-|+
T Consensus        25 ~~~~~i~~Lk~~L~~l~~~l~d~~a~~-~~~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~~~l~~~~~~~~~~c~  103 (889)
T KOG4658|consen   25 GKDNYILELKENLKALQSALEDLDAKR-DDLERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKANDLLSTRSVERQRLCL  103 (889)
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHhhc-chHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhhhhHHHHHHHhh
Confidence            777889999999999999999999987 4477899999999999999999998764211                 1111


Q ss_pred             cCcC-CChhhhhHHHHHHHHHHHHHHHHHhcCCCcccccc-CCCccccccccCCCCCccchHHHHHHHHHHcCCCCceEE
Q 043056          101 KGLC-PNLKTRRRLSKEAERQKEAAVKVREARRFDRISYC-TAPEDIRLIFNKDYLPFESRMFTLRNILSALEDPDVNML  178 (559)
Q Consensus       101 ~~~~-~~~~~~~~i~~~i~~~~~~l~~i~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~gR~~~~~~l~~~L~~~~~~vi  178 (559)
                      .+.+ ......+.+++++-++...++.+...+.|..+... .+.+.....+...... +|.+..++++.+.|.+++..++
T Consensus       104 ~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~~~~e~~~~~~~~~-VG~e~~~~kl~~~L~~d~~~iv  182 (889)
T KOG4658|consen  104 CGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDPREKVETRPIQSESD-VGLETMLEKLWNRLMEDDVGIV  182 (889)
T ss_pred             hhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccccccchhhcccCCCCcccc-ccHHHHHHHHHHHhccCCCCEE
Confidence            1111 23344455666666666666666555556555432 1112222222222233 9999999999999997777999


Q ss_pred             EEEcCCCCcHHHHHHHHHHHhc-ccCCCCeEEEEEeCCCcCHHHHHHHHHHHhCCCCcCCCh---hhhHHHHHHHHHcCC
Q 043056          179 GIYGMGGIGKTMLAEEVARKVK-SDKLFDQVVFVEVSQNQDIRKLQGEIADKLGLKFHEESE---SGRANSLFKRIKAEK  254 (559)
Q Consensus       179 ~I~G~~GiGKTtLa~~v~~~~~-~~~~f~~~~wv~~s~~~~~~~~~~~i~~~l~~~~~~~~~---~~~~~~l~~~l~~~k  254 (559)
                      +|+||||+||||||++++|+.. ++++|+.++||+||+.++...++.+|++.++........   .+....+.+.|. +|
T Consensus       183 ~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~-~k  261 (889)
T KOG4658|consen  183 GIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEEWEDKEEDELASKLLNLLE-GK  261 (889)
T ss_pred             EEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhc-cC
Confidence            9999999999999999999998 899999999999999999999999999999874443322   344455555555 89


Q ss_pred             eEEEEEeCCCcccccchhcCCCCCCCCCcEEEEEecCcchhccCCCCCCeeecCCCCHHHHHHHHHHHhCCC--CCCcch
Q 043056          255 KILIILDNIWENLDLRVVGIPHGDGHKDCKVLLTARSLDVLSGKMDSRPNFSIGVLNEEEAWNLFKKMAGDY--IEGSEF  332 (559)
Q Consensus       255 r~LlVlDdv~~~~~~~~l~~~~~~~~~gs~IivTTR~~~va~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~--~~~~~~  332 (559)
                      ||||||||||+..+|+.++.++|....||+|++|||++.|+...++....+++..|+++|||.||++.++..  ...+.+
T Consensus       262 rfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i  341 (889)
T KOG4658|consen  262 RFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDI  341 (889)
T ss_pred             ceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccccccccH
Confidence            999999999999999999999999999999999999999987668888999999999999999999999844  344568


Q ss_pred             HHHHHHHHHHhCCChHHHHHHHHHHhcC-ChHHHHHHHHHhcCCCCCCccchHHHHHHHHHHhhcCCCChhHHHHHHHhc
Q 043056          333 QSVARDVAKECAGLPVSVVTIARALRNK-RLFEWKDALEQLRRPSSTNFKDIQQTAYKAIELSYNKLEGEELKNIFLLIG  411 (559)
Q Consensus       333 ~~~~~~I~~~c~GlPLai~~~~~~L~~~-~~~~w~~~l~~l~~~~~~~~~~~~~~i~~~l~~sy~~L~~~~lk~cfl~~s  411 (559)
                      +++|++++++|+|+|||++++|++|+.+ +..+|+.+.+.+.+....+.++..+.++.+|.+||++||++ +|.||+|||
T Consensus       342 ~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~-lK~CFLyca  420 (889)
T KOG4658|consen  342 EELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEE-LKSCFLYCA  420 (889)
T ss_pred             HHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHH-HHHHHHhhc
Confidence            9999999999999999999999999988 88899999999988766666667899999999999999966 999999999


Q ss_pred             cCC---CCChHHHHHHHhhcccccccchHHHHHHHHHHHHHHHHHccccccccC-CCcceEEecHHHHHHHHHHhc----
Q 043056          412 YTA---IASIDALLMCGMGLGLFQGVNKMEVARARVRTLVHKLKASCMLLDHIS-KNEEFFSMHDVVRDIAISIAS----  483 (559)
Q Consensus       412 ~fp---~i~~~~Li~~w~aeg~i~~~~~~~~~~~~~~~~i~~L~~~sll~~~~~-~~~~~~~mHdlv~d~a~~~~~----  483 (559)
                      +||   .|+++.|+.+|+||||+.+....+.+++.+.+++.+|+.++|+..... ++..+|+|||+|||+|.++++    
T Consensus       421 lFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~  500 (889)
T KOG4658|consen  421 LFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGK  500 (889)
T ss_pred             cCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccc
Confidence            999   788899999999999998866667788999999999999999987653 234689999999999999999    


Q ss_pred             -ccccceEeccccccCcccccccccccCceEEEecCCCCccCCCCcccCCcchhhhhcccCC-CCccCChHHHhcccC
Q 043056          484 -REQNALTATNEQVGGFREWSDKSAVKHYTSIVLHDIKANVLPEVVECPQLKLLFIHADKES-SSLTIPNNFFKRMIQ  559 (559)
Q Consensus       484 -~e~~~~~~~~~~~~~~~~~~~~~~~~~~r~lsl~~~~~~~l~~~~~~~~Lr~L~l~~~~~~-~~~~ip~~~f~~m~~  559 (559)
                       +++.+  +.++.  ++.+.+....|..+||++++++....++.+..+++|+|  |+...+. .+..+|..||.+||.
T Consensus       501 ~~e~~i--v~~~~--~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~t--Lll~~n~~~l~~is~~ff~~m~~  572 (889)
T KOG4658|consen  501 QEENQI--VSDGV--GLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRT--LLLQRNSDWLLEISGEFFRSLPL  572 (889)
T ss_pred             cccceE--EECCc--CccccccccchhheeEEEEeccchhhccCCCCCCccce--EEEeecchhhhhcCHHHHhhCcc
Confidence             66633  33322  45556777788899999999999999999999999999  5544554 488999999999973

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00494 tuzin-like protein; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK13234 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK04196 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query559
1z6t_A591 Structure Of The Apoptotic Protease-activating Fact 5e-05
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 6e-05
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 1e-04
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 6e-04
>pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591 Back     alignment and structure 
Iteration: 1

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 105/245 (42%), Gaps = 53/245 (21%)
Query: 180 IYGMGGIGKTMLAEEVAR--KVKSDKLFDQVVFVEVSQNQD----IRKLQG--------- 224
           I+GM G GK++LA E  R   +        V +V V + QD    + KLQ          
Sbjct: 152 IHGMAGCGKSVLAAEAVRDHSLLEGCFPGGVHWVSVGK-QDKSGLLMKLQNLCTRLDQDE 210
Query: 225 EIADKLGLKFHEESESGRANSLFKRIKAEKKILIILDNIWENLDLRVVGIPHGDGHKDCK 284
             + +L L   E  +  R   L K  ++    L+ILD++W++  L+            C+
Sbjct: 211 SFSQRLPLNIEEAKDRLRILMLRKHPRS----LLILDDVWDSWVLKAFD-------SQCQ 259
Query: 285 VLLTARSLDVLSGKMDSRPNFSIGV---LNEE---EAWNLFKKMAGDYIEGSEFQSVARD 338
           +LLT R   V    M   P + + V   L +E   E  +LF  M     + ++    A  
Sbjct: 260 ILLTTRDKSVTDSVMG--PKYVVPVESSLGKEKGLEILSLFVNM-----KKADLPEQAHS 312
Query: 339 VAKECAGLPVSVVTIARALRNKRLF--EWKDALEQL--------RRPSSTNFKDIQQTAY 388
           + KEC G P+ V  I   LR+   F   W+  L+QL        R+ SS +++ + +   
Sbjct: 313 IIKECKGSPLVVSLIGALLRD---FPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMS 369
Query: 389 KAIEL 393
            ++E+
Sbjct: 370 ISVEM 374
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query559
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-52
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-44
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 5e-35
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 7e-21
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 6e-04
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score =  187 bits (476), Expect = 1e-52
 Identities = 58/508 (11%), Positives = 151/508 (29%), Gaps = 48/508 (9%)

Query: 65  EEIEENVENWLARANNVIVEADKFTDDEATANKRCFKGLCPNLKTRRRLSKEAERQKEAA 124
           E+  E +     R   +      +    +            N   +  L+   E   + A
Sbjct: 38  EDHSELISKMSTRLERIANFLRIYRRQASELGPLIDFF---NYNNQSHLADFLEDYIDFA 94

Query: 125 VKVREARRFDRISYCTAPEDIRLIFNKDYLPFESRMFT-------LRNILSALEDPDVNM 177
           +   +  R   I+   + + +        +P +   +        +   L  + D D   
Sbjct: 95  INEPDLLRPVVIAPQFSRQMLDRKLLLGNVPKQMTCYIREYHVDRVIKKLDEMCDLDSFF 154

Query: 178 LGIYGMGGIGKTMLAEEVAR--KVKSDKLFDQVVFVEVSQN---------QDIRKLQGEI 226
           L ++G  G GK+++A +            +D +V+++ S            DI  +    
Sbjct: 155 LFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSE 214

Query: 227 ADKLGLKFHEESESGRANSLFKR-IKAEKKILIILDNIWENLDLRVVGIPHGDGHKDCKV 285
            D L     E   S     +    +      L + D++ +   +R             + 
Sbjct: 215 DDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ------ELRLRC 268

Query: 286 LLTARSLDVLSGKMDSRPNFSIGVLNEEEAWNLFKKMAGDYIEGSEFQSVARDVAKECAG 345
           L+T R +++ +    +     +  L  +E ++  +        G + + V     +  +G
Sbjct: 269 LVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSG 328

Query: 346 LPVSVVTIARALRNKRLFEWKDALEQLRRPSSTNFKDIQQTAY----KAIELSYNKLEGE 401
            P +++   ++   K   +      +L        + I   +Y     A++     L  +
Sbjct: 329 NPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLS-D 387

Query: 402 ELKNIFLLIG----YTAIASIDALLMCGMGLGLFQGVNKME-VARARVRTLVHKLKASCM 456
           E ++             I  +                 +++     R++ L  +      
Sbjct: 388 EDRSALAFAVVMPPGVDI-PVKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKR----GA 442

Query: 457 LLDHISKNEEFFSMHDVVRDIAISIASRE--QNALTATNEQVGGFREWSDKSAVKHYTSI 514
           LL         F +  ++      +   +   N ++   +++      +     +H  S 
Sbjct: 443 LLSGKRMPVLTFKIDHIIHMFLKHVVDAQTIANGISILEQRLLEIGNNNVSVPERHIPSH 502

Query: 515 VLHDIK---ANVLPEVVECPQLKLLFIH 539
                +   + + P+  E   ++     
Sbjct: 503 FQKFRRSSASEMYPKTTEETVIRPEDFP 530
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query559
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 100.0
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 100.0
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.75
2fna_A357 Conserved hypothetical protein; structural genomic 99.72
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.66
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 99.52
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.5
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.47
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.42
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.4
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.38
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.36
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.17
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.13
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.01
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.9
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.85
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 98.84
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.72
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 98.63
3bos_A242 Putative DNA replication factor; P-loop containing 98.59
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.58
3pvs_A447 Replication-associated recombination protein A; ma 98.55
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 98.55
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.55
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.54
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.47
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.47
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 98.45
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.44
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 98.43
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 98.41
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 98.38
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.37
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.35
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 98.35
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 98.33
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 98.32
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.3
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 98.28
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.24
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.2
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 98.2
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 98.19
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 98.18
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 98.15
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.08
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 98.08
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 98.06
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 98.05
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 98.02
2gno_A305 DNA polymerase III, gamma subunit-related protein; 97.94
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.93
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.92
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.91
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 97.89
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.88
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 97.88
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.85
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 97.83
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.77
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 97.75
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.71
2r62_A268 Cell division protease FTSH homolog; ATPase domain 97.71
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 97.64
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 97.54
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 97.44
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.35
3co5_A143 Putative two-component system transcriptional RES 97.33
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 97.31
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.26
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.19
1ojl_A304 Transcriptional regulatory protein ZRAR; response 97.17
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 97.16
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.14
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 97.11
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.09
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.05
3io5_A333 Recombination and repair protein; storage dimer, i 97.03
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.96
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.85
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 96.85
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.77
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.77
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.76
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.76
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.69
2z43_A324 DNA repair and recombination protein RADA; archaea 96.58
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.56
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 96.56
2qgz_A308 Helicase loader, putative primosome component; str 96.54
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.5
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.48
1xp8_A366 RECA protein, recombinase A; recombination, radior 96.41
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.36
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.32
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.32
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.28
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 96.25
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.21
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 96.2
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 96.03
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 95.99
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 95.9
3ice_A422 Transcription termination factor RHO; transcriptio 95.89
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.87
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.86
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.8
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 95.69
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 95.67
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.65
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.61
3vaa_A199 Shikimate kinase, SK; structural genomics, center 95.54
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.54
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.51
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.49
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 95.48
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.48
2xxa_A433 Signal recognition particle protein; protein trans 95.46
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 95.45
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.43
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.42
2r44_A331 Uncharacterized protein; putative ATPase, structur 95.41
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 95.41
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.4
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 95.4
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 95.37
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 95.37
1vma_A306 Cell division protein FTSY; TM0570, structural gen 95.36
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 95.34
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 95.33
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.31
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 95.3
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 95.29
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 95.25
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 95.23
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.22
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 95.22
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.21
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 95.2
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 95.16
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 95.16
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 95.15
2hf9_A226 Probable hydrogenase nickel incorporation protein 95.14
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 95.14
1via_A175 Shikimate kinase; structural genomics, transferase 95.13
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 95.13
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 95.12
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 95.11
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 95.11
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.09
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 95.09
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 95.09
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 95.07
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 95.06
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.05
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.04
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 95.0
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 95.0
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 95.0
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 94.99
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 94.98
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.98
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 94.97
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 94.97
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 94.95
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 94.95
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.93
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 94.93
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 94.92
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 94.92
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 94.91
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 94.9
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.89
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 94.89
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 94.89
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 94.89
3fwy_A314 Light-independent protochlorophyllide reductase I 94.84
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 94.83
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 94.81
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 94.79
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 94.78
2vli_A183 Antibiotic resistance protein; transferase, tunica 94.75
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 94.74
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 94.73
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 94.72
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 94.71
3tlx_A243 Adenylate kinase 2; structural genomics, structura 94.71
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 94.7
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 94.7
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 94.68
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.67
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 94.66
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.64
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 94.59
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 94.58
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 94.56
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 94.54
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 94.54
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 94.52
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 94.5
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 94.49
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 94.48
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 94.48
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 94.48
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 94.47
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 94.46
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 94.45
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 94.4
1tue_A212 Replication protein E1; helicase, replication, E1E 94.39
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 94.39
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 94.32
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 94.29
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 94.26
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 94.13
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 94.12
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 94.1
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 94.1
3r20_A233 Cytidylate kinase; structural genomics, seattle st 94.06
3l0o_A427 Transcription termination factor RHO; helicase, RH 94.03
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 94.01
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 94.01
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.0
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 93.98
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 93.97
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 93.96
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 93.95
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 93.94
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 93.91
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 93.84
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 93.83
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 93.82
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 93.81
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 93.79
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 93.77
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 93.76
2r6a_A454 DNAB helicase, replicative helicase; replication, 93.75
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 93.72
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 93.72
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 93.7
3end_A307 Light-independent protochlorophyllide reductase ir 93.65
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 93.64
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 93.64
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 93.63
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 93.63
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 93.62
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 93.62
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 93.61
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 93.55
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 93.54
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 93.51
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 93.49
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 93.49
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 93.41
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 93.33
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 93.31
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 93.3
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 93.25
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 93.23
2eyu_A261 Twitching motility protein PILT; pilus retraction 93.23
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 93.2
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 93.19
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 93.18
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 93.18
1b0u_A262 Histidine permease; ABC transporter, transport pro 93.15
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 93.14
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 93.12
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 93.09
2og2_A359 Putative signal recognition particle receptor; nuc 93.09
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 93.07
1ji0_A240 ABC transporter; ATP binding protein, structural g 93.05
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 93.03
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 93.02
1g6h_A257 High-affinity branched-chain amino acid transport 93.02
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 93.01
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 93.0
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 93.0
1sgw_A214 Putative ABC transporter; structural genomics, P p 92.96
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 92.96
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 92.94
3mfy_A588 V-type ATP synthase alpha chain; A-type ATP syntha 92.91
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 92.89
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 92.87
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 92.86
2ghi_A260 Transport protein; multidrug resistance protein, M 92.79
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 92.78
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 92.78
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 92.77
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 92.75
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 92.75
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 92.74
2qe7_A502 ATP synthase subunit alpha; blockage of ATP hydrol 92.7
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 92.7
3vr4_A600 V-type sodium ATPase catalytic subunit A; V-ATPase 92.66
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 92.65
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 92.6
2r9v_A515 ATP synthase subunit alpha; TM1612, structural gen 92.6
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 92.58
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 92.58
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 92.57
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 92.56
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 92.56
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 92.52
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 92.52
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 92.48
2wji_A165 Ferrous iron transport protein B homolog; membrane 92.46
2ged_A193 SR-beta, signal recognition particle receptor beta 92.42
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 92.42
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 92.42
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 92.4
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 92.33
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 92.24
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 92.22
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 92.13
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 92.1
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 92.06
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 92.04
2ck3_A510 ATP synthase subunit alpha\, mitochondrial; hydrol 92.04
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 91.97
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 91.94
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 91.91
3kta_A182 Chromosome segregation protein SMC; structural mai 91.83
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 91.83
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 91.82
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 91.78
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 91.77
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 91.76
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 91.68
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 91.67
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 91.64
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 91.59
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 91.57
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 91.57
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 91.54
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 91.51
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 91.51
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 91.5
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 91.46
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 91.43
1nrj_B218 SR-beta, signal recognition particle receptor beta 91.34
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 91.34
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 91.33
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 91.31
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 91.29
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 91.26
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 91.23
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 91.23
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 91.22
3oaa_A513 ATP synthase subunit alpha; rossmann fold, hydrola 91.18
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 91.16
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 91.16
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 91.14
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 91.14
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 91.1
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 91.1
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 91.07
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 91.05
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 91.01
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 91.01
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 91.0
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 90.98
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 90.94
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 90.93
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 90.91
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 90.91
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 90.86
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 90.86
2ewv_A372 Twitching motility protein PILT; pilus retraction 90.83
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 90.79
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 90.77
1fx0_A507 ATP synthase alpha chain; latent ATPase, thermal s 90.77
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 90.77
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 90.75
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 90.75
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 90.75
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 90.73
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 90.73
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 90.73
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 90.66
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 90.65
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 90.64
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 90.63
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 90.62
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 90.62
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 90.6
2www_A349 Methylmalonic aciduria type A protein, mitochondri 90.6
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 90.6
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 90.58
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 90.52
3gqb_A578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 90.52
3cwq_A209 Para family chromosome partitioning protein; alpha 90.51
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 90.5
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 90.49
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 90.42
1p9r_A418 General secretion pathway protein E; bacterial typ 90.41
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 90.39
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 90.37
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 90.34
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 90.32
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 90.32
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 90.27
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 90.26
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 90.26
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 90.25
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 90.23
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 90.22
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 90.21
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 90.21
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 90.12
3t1o_A198 Gliding protein MGLA; G domain containing protein, 90.09
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 90.07
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 90.04
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 90.04
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 90.02
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 90.0
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 89.95
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 89.93
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 89.9
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 89.83
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 89.83
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 89.81
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 89.78
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 89.78
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 89.76
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 89.74
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 89.73
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 89.72
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 89.69
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 89.69
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 89.68
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 89.65
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 89.63
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 89.54
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 89.52
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 89.5
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 89.48
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 89.47
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 89.44
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 89.43
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 89.41
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 89.34
2fh5_B214 SR-beta, signal recognition particle receptor beta 89.33
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 89.3
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 89.3
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 89.3
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 89.29
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 89.26
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 89.25
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 89.23
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 89.2
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 89.2
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 89.18
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 89.18
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 89.17
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 89.15
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 89.1
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 89.05
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 89.03
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 89.03
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 88.96
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 88.96
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 88.94
3lxx_A239 GTPase IMAP family member 4; structural genomics c 88.94
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 88.87
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 88.79
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 88.79
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 88.74
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 88.71
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 88.7
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 88.69
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 88.66
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 88.66
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 88.57
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 88.55
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 88.48
3llu_A196 RAS-related GTP-binding protein C; structural geno 88.47
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 88.38
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 88.36
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 88.33
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 88.26
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 88.24
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 88.23
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 88.18
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 88.18
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 88.14
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 88.14
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 88.05
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 88.03
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 87.98
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 87.94
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 87.93
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 87.91
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 87.88
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 87.88
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 87.84
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 87.82
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 87.44
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 87.4
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-51  Score=443.02  Aligned_cols=385  Identities=12%  Similarity=0.115  Sum_probs=254.9

Q ss_pred             cchHHHHHHHHHHcCC---CCceEEEEEcCCCCcHHHHHHHHHH--HhcccCCCCeEEEEEeCCCc--CHHHHHHHHHHH
Q 043056          157 ESRMFTLRNILSALED---PDVNMLGIYGMGGIGKTMLAEEVAR--KVKSDKLFDQVVFVEVSQNQ--DIRKLQGEIADK  229 (559)
Q Consensus       157 ~gR~~~~~~l~~~L~~---~~~~vi~I~G~~GiGKTtLa~~v~~--~~~~~~~f~~~~wv~~s~~~--~~~~~~~~i~~~  229 (559)
                      +||+.++++|.++|..   +..++|+|+||||+||||||+++|+  +.+.+.+|++++||++++.+  +...++..|+.+
T Consensus       131 ~GR~~~~~~l~~~L~~~~~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~vs~~~~~~~~~~~~~il~~  210 (549)
T 2a5y_B          131 YIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLM  210 (549)
T ss_dssp             CCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHhcccCCCceEEEEEcCCCCCHHHHHHHHHHhhhHHHhccCCcEEEEEECCCCCCCHHHHHHHHHHH
Confidence            4999999999999863   3679999999999999999999998  56677889999999999985  899999999999


Q ss_pred             hCCCCc--CC------ChhhhHHHHHHHHHcCCeEEEEEeCCCcccccchhcCCCCCCCCCcEEEEEecCcchhccCCCC
Q 043056          230 LGLKFH--EE------SESGRANSLFKRIKAEKKILIILDNIWENLDLRVVGIPHGDGHKDCKVLLTARSLDVLSGKMDS  301 (559)
Q Consensus       230 l~~~~~--~~------~~~~~~~~l~~~l~~~kr~LlVlDdv~~~~~~~~l~~~~~~~~~gs~IivTTR~~~va~~~~~~  301 (559)
                      ++....  ..      +.......+.+.+...|||||||||||+..++ .+.     ..+||+||||||+..++......
T Consensus       211 l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~-~~~-----~~~gs~ilvTTR~~~v~~~~~~~  284 (549)
T 2a5y_B          211 LKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETI-RWA-----QELRLRCLVTTRDVEISNAASQT  284 (549)
T ss_dssp             HTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHH-HHH-----HHTTCEEEEEESBGGGGGGCCSC
T ss_pred             HhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhh-ccc-----ccCCCEEEEEcCCHHHHHHcCCC
Confidence            986522  11      11223456666666324999999999998754 111     12799999999999987532224


Q ss_pred             CCeeecCCCCHHHHHHHHHHHhCCCCCCcchHHHHHHHHHHhCCChHHHHHHHHHHhcCChHHHHHHHHHhcCCCCCCcc
Q 043056          302 RPNFSIGVLNEEEAWNLFKKMAGDYIEGSEFQSVARDVAKECAGLPVSVVTIARALRNKRLFEWKDALEQLRRPSSTNFK  381 (559)
Q Consensus       302 ~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~I~~~c~GlPLai~~~~~~L~~~~~~~w~~~l~~l~~~~~~~~~  381 (559)
                      ...|+|++|+.++||+||.+.++....++.+.+++++|+++|+|+||||+++|+.|+.++ ++|...+....+...    
T Consensus       285 ~~~~~l~~L~~~ea~~Lf~~~a~~~~~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~~-w~~~~~l~~~l~~~~----  359 (549)
T 2a5y_B          285 CEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKT-FEKMAQLNNKLESRG----  359 (549)
T ss_dssp             EEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSS-HHHHHHHHHHHHHHC----
T ss_pred             CeEEECCCCCHHHHHHHHHHHhcCCCCchhHHHHHHHHHHHhCCChHHHHHHHHHhccch-HHHHHHhHHHhhccc----
Confidence            468999999999999999999886554578888999999999999999999999998764 334333332111000    


Q ss_pred             chHHHHHHHHHHhhcCCCChhHHHHHH-----------HhccCC-CCChHHHHHHHhhc--ccccccchHHHHHHHHHHH
Q 043056          382 DIQQTAYKAIELSYNKLEGEELKNIFL-----------LIGYTA-IASIDALLMCGMGL--GLFQGVNKMEVARARVRTL  447 (559)
Q Consensus       382 ~~~~~i~~~l~~sy~~L~~~~lk~cfl-----------~~s~fp-~i~~~~Li~~w~ae--g~i~~~~~~~~~~~~~~~~  447 (559)
                        ..++..++.+||++||++ +|.||+           |||+|| +++..  +++|+|+  ||+.+.......++..+ +
T Consensus       360 --~~~i~~~l~~Sy~~L~~~-lk~~f~~Ls~~er~l~~~ls~fp~~~~i~--i~~w~a~~~G~i~~~~~~~~~~~~~~-~  433 (549)
T 2a5y_B          360 --LVGVECITPYSYKSLAMA-LQRCVEVLSDEDRSALAFAVVMPPGVDIP--VKLWSCVIPVDICSNEEEQLDDEVAD-R  433 (549)
T ss_dssp             --SSTTCCCSSSSSSSHHHH-HHHHHHTSCHHHHHHTTGGGSSCTTCCEE--HHHHHHHSCC-------CCCTHHHHH-H
T ss_pred             --HHHHHHHHhcccccccHH-HHHHHhccchhhhhHhhheeeeCCCCeee--eeeeeeeccceeccCCCCCCHHHHHH-H
Confidence              233577889999999998 999999           999999 66666  8999999  99975321111223333 8


Q ss_pred             HHHHHHccccccccCCCcceEEecHHHHHHHHHHhcccccceEeccccccCcccccccccccCceEEEecCCCCccCCCC
Q 043056          448 VHKLKASCMLLDHISKNEEFFSMHDVVRDIAISIASREQNALTATNEQVGGFREWSDKSAVKHYTSIVLHDIKANVLPEV  527 (559)
Q Consensus       448 i~~L~~~sll~~~~~~~~~~~~mHdlv~d~a~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~r~lsl~~~~~~~l~~~  527 (559)
                      +++|+++||++....+...+|+|||+||+||++++.+++..-... ....++..+.........||++.+...+......
T Consensus       434 l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~~~~~~~~~-~~~~rl~~~~~~~~~~~~r~~~~~~~~~~~~~~~  512 (549)
T 2a5y_B          434 LKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQTIANGIS-ILEQRLLEIGNNNVSVPERHIPSHFQKFRRSSAS  512 (549)
T ss_dssp             HHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCTHHHHHHHT-TSTTTSSCC-------------------------
T ss_pred             HHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHhcCCCCccchhhhhhhhhhcccchh
Confidence            999999999997755444789999999999999988765311000 0001233344444556678887766554332222


Q ss_pred             cccCCc-chhhhhcccCCCCccCChHHHhcccC
Q 043056          528 VECPQL-KLLFIHADKESSSLTIPNNFFKRMIQ  559 (559)
Q Consensus       528 ~~~~~L-r~L~l~~~~~~~~~~ip~~~f~~m~~  559 (559)
                      ..+|.+ ....+-...-..+.++|..||++|+|
T Consensus       513 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  545 (549)
T 2a5y_B          513 EMYPKTTEETVIRPEDFPKFMQLHQKFYDSLKN  545 (549)
T ss_dssp             --------CCSCCCTTSTTCSCTTHHHHTCC--
T ss_pred             ccCccccccceeeccchHHHHHHHHHHHHHHHH
Confidence            223433 22112222223567889999999986
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 559
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 4e-34
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  128 bits (322), Expect = 4e-34
 Identities = 35/263 (13%), Positives = 84/263 (31%), Gaps = 26/263 (9%)

Query: 157 ESRMFTLRNILSALEDPDVNMLGIYGMGGIGKTMLAEEVARK--VKSDKLFDQVVFVEVS 214
           E  +  +   L  + D D   L ++G  G GK+++A +   K        +D +V+++ S
Sbjct: 26  EYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDS 85

Query: 215 QNQDIRKLQGEIADKLGLKFHEESESGRAN----------SLFKRIKAEKKILIILDNIW 264
                          L LK  ++  +  +            +   +      L + D++ 
Sbjct: 86  GTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVV 145

Query: 265 ENLDLRVVGIPHGDGHKDCKVLLTARSLDVLSGKMDSRPNFSIGVLNEEEAWNLFKKMAG 324
           +                  + L+T R +++ +    +     +  L  +E ++  +    
Sbjct: 146 QEET------IRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGM 199

Query: 325 DYIEGSEFQSVARDVAKECAGLPVSVVTIARALRNKRLFEWKDALEQLRRPSSTNFKDIQ 384
               G + + V     +  +G P +++   ++   K   +      +L        + I 
Sbjct: 200 PMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECI- 258

Query: 385 QTAYKAIELSYNKLEGEELKNIF 407
                    SY  L    L+   
Sbjct: 259 ------TPYSYKSL-AMALQRCV 274

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query559
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 100.0
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.29
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.95
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.94
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.85
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.84
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.81
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.75
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.72
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.7
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.59
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.59
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.53
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.51
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.49
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.43
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.41
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.4
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.33
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.33
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.22
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.13
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.97
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.47
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.97
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.92
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.9
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.89
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.88
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.83
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.77
d1okkd2207 GTPase domain of the signal recognition particle r 96.73
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.72
d2qy9a2211 GTPase domain of the signal recognition particle r 96.69
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.67
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.66
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.61
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.6
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.58
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.53
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.51
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.51
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.49
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.49
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.46
d1vmaa2213 GTPase domain of the signal recognition particle r 96.44
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.41
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.39
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.35
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.3
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.27
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.21
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.15
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.14
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.12
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.12
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.1
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.07
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.07
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.06
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.04
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 96.0
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.98
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.93
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 95.93
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.86
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.8
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.8
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.78
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 95.77
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.71
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.7
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.64
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.62
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.62
d1xpua3289 Transcription termination factor Rho, ATPase domai 95.56
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.52
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.48
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.43
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.39
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.37
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.36
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 95.31
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.29
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.26
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.22
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.12
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 95.12
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.12
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.08
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.97
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.76
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.68
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 94.67
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.58
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.5
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.46
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.27
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 94.19
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 94.11
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 93.93
d1g2912240 Maltose transport protein MalK, N-terminal domain 93.89
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 93.8
d2awna2232 Maltose transport protein MalK, N-terminal domain 93.78
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 93.74
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 93.71
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 93.67
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 93.66
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 93.51
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.5
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 93.49
d1svma_362 Papillomavirus large T antigen helicase domain {Si 93.47
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 93.47
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 93.42
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 93.41
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.37
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 93.37
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 93.22
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.16
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 93.15
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 93.15
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 93.14
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 93.11
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 93.11
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 93.04
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 92.9
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.9
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 92.9
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 92.84
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 92.78
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 92.75
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 92.56
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 92.53
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 92.52
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 92.41
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 92.34
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 92.32
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 92.32
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.3
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 92.24
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.24
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 92.08
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 92.03
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.86
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.82
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 91.82
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 91.79
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 91.76
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 91.72
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.71
d2fh5b1207 Signal recognition particle receptor beta-subunit 91.69
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 91.68
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 91.57
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 91.55
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.55
d2hyda1255 Putative multidrug export ATP-binding/permease pro 91.53
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 91.53
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 91.53
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 91.5
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 91.47
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 91.47
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 91.45
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 91.43
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.39
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.38
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 91.36
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 91.22
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 91.22
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.17
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.17
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 91.13
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 91.13
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.12
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 91.04
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 90.95
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 90.92
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 90.9
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.89
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 90.84
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 90.77
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 90.75
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 90.75
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.73
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 90.68
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 90.63
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 90.51
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 90.33
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 90.31
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 90.27
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 90.24
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 90.12
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 90.11
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 90.06
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 90.06
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 89.93
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 89.92
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 89.88
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 89.88
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 89.85
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 89.84
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 89.77
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 89.73
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 89.66
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 89.61
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.58
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 89.52
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 89.4
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 89.36
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 89.29
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 89.29
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 89.23
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 89.22
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 89.18
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 88.98
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 88.63
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 88.49
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 88.14
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 88.05
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 87.33
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 87.25
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.03
d1tuea_205 Replication protein E1 helicase domain {Human papi 86.64
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 86.6
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 86.4
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 85.79
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 85.55
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 85.26
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 84.97
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 84.91
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 84.69
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 83.98
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 83.89
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 83.21
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 82.54
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 82.02
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 81.51
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 81.49
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 81.45
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 81.2
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=100.00  E-value=1.5e-41  Score=329.70  Aligned_cols=244  Identities=13%  Similarity=0.163  Sum_probs=194.5

Q ss_pred             CCCccchHHHHHHHHHHcC---CCCceEEEEEcCCCCcHHHHHHHHHHHhc--ccCCCCeEEEEEeCCCcCHHHHHHHHH
Q 043056          153 YLPFESRMFTLRNILSALE---DPDVNMLGIYGMGGIGKTMLAEEVARKVK--SDKLFDQVVFVEVSQNQDIRKLQGEIA  227 (559)
Q Consensus       153 ~~~~~gR~~~~~~l~~~L~---~~~~~vi~I~G~~GiGKTtLa~~v~~~~~--~~~~f~~~~wv~~s~~~~~~~~~~~i~  227 (559)
                      ...++||+.++++|+++|.   +.+.++|+|+||||+||||||+++|++..  .+.+|++++|+++++.++...+...+.
T Consensus        19 ~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~~   98 (277)
T d2a5yb3          19 QMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTD   98 (277)
T ss_dssp             CCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHH
T ss_pred             CCceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHHHHH
Confidence            3447899999999999985   56678999999999999999999999854  566899999999999988777766654


Q ss_pred             HH---hCCCCcC-------CChhhhHHHHHHHHHcCCeEEEEEeCCCcccccchhcCCCCCCCCCcEEEEEecCcchhcc
Q 043056          228 DK---LGLKFHE-------ESESGRANSLFKRIKAEKKILIILDNIWENLDLRVVGIPHGDGHKDCKVLLTARSLDVLSG  297 (559)
Q Consensus       228 ~~---l~~~~~~-------~~~~~~~~~l~~~l~~~kr~LlVlDdv~~~~~~~~l~~~~~~~~~gs~IivTTR~~~va~~  297 (559)
                      ..   ++.....       .........+......++|+|+||||||+...|..+.      ..||+||||||+..++..
T Consensus        99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~------~~~srilvTTR~~~v~~~  172 (277)
T d2a5yb3          99 ILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ------ELRLRCLVTTRDVEISNA  172 (277)
T ss_dssp             HHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH------HTTCEEEEEESBGGGGGG
T ss_pred             HHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhccCCeeEecchhhHHhhhhhhc------ccCceEEEEeehHHHHHh
Confidence            43   3221111       1111222233444445799999999999998887653      248999999999999764


Q ss_pred             CCCCCCeeecCCCCHHHHHHHHHHHhCCCCCCcchHHHHHHHHHHhCCChHHHHHHHHHHhcCChHHHHHHHHHhcCCCC
Q 043056          298 KMDSRPNFSIGVLNEEEAWNLFKKMAGDYIEGSEFQSVARDVAKECAGLPVSVVTIARALRNKRLFEWKDALEQLRRPSS  377 (559)
Q Consensus       298 ~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~I~~~c~GlPLai~~~~~~L~~~~~~~w~~~l~~l~~~~~  377 (559)
                      .......|+|++|+.+||++||+.+++.....+..++++++|+++|+|+||||+++|+.|+.++.+.|.+..+.|.....
T Consensus       173 ~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~~  252 (277)
T d2a5yb3         173 ASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGL  252 (277)
T ss_dssp             CCSCEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCS
T ss_pred             cCCCCceEECCCCCHHHHHHHHHHHhCCccCchhhHHHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhcCcH
Confidence            44455789999999999999999999876666777899999999999999999999999999999999999988864332


Q ss_pred             CCccchHHHHHHHHHHhhcCCCChhHHHHHHHh
Q 043056          378 TNFKDIQQTAYKAIELSYNKLEGEELKNIFLLI  410 (559)
Q Consensus       378 ~~~~~~~~~i~~~l~~sy~~L~~~~lk~cfl~~  410 (559)
                             .++..++.+||++||++ +|.||.++
T Consensus       253 -------~~v~~il~~sY~~L~~~-lk~c~~~l  277 (277)
T d2a5yb3         253 -------VGVECITPYSYKSLAMA-LQRCVEVL  277 (277)
T ss_dssp             -------STTCCCSSSSSSSHHHH-HHHHHHTS
T ss_pred             -------HHHHHHHHHHHhcccHH-HHHHHHhC
Confidence                   33577899999999999 99999764
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure