Citrus Sinensis ID: 043086

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MKHKRNALHAFISFFLLQFFLLHALASASNTNSNRKSSPLEFFKLFQGTQKGDTVKGINALKKYLHTLGYLSNHNHNHAAAAADGDYFDENLESAVKTYQRNFNLNPTGHMDLKTVSMMGKPRCGVPDVINGTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISCAFLPGTRTDVQEPDYDAADVKISFQRGDHGDGYPFDGPGPYNLLAHSFPPTDGRFHYDGDENWTVGAVPGAVDMQTVALHELRHVLGLAHRP
ccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHccccccccccHHcHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHccccccccccccccccccccccEEEEEEEEcccccccHHHHHHHHHHHcccccEEEEccccccccEEEEEEccccccccccccccccccEEEEcccccccEEEccccccccccccccccHHHHHHHHHHHHccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccEEEcccccccccHHHHHHHHHHHHHcccccccccHHHHHHHcccccccccccccEEcccccccccccEEEEEEccccHHHHHHHHHHHHHHHcccEEEEEccccccEEEEEEcccccccccccccccccEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHccccccc
MKHKRNALHAFISFFLLQFFLLHALASasntnsnrkssplEFFKLfqgtqkgdtVKGINALKKYLHTLgylsnhnhnhaaaaadgdyfdENLESAVKTYQRnfnlnptghmdlktvsmmgkprcgvpdvingttrmqggpahyhthyvfypgrpkwpatkQIIScaflpgtrtdvqepdydaadvkisfqrgdhgdgypfdgpgpynllahsfpptdgrfhydgdenwtvgavpgavdMQTVALHELRHVLGLAHRP
MKHKRNALHAFISFFLLQFFLLHALASASNTNSNRKSSPLEFFKLFQGTQKGDTVKGINALKKYLHTLGYLSNHNHNHAAAAADGDYFDENLESAVKTYQrnfnlnptgHMDLKTVSMMGKPRCGVPDVINGTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISCAFLPGTRTDVQEPDYDAADVKISFQRGDHGDGYPFDGPGPYNLLAHSFPPTDGRFHYDGDENWTVGAVPGAVDMQTVALHELRHVLGLAHRP
MKHKRNALHafisffllqffllhalasasNTNSNRKSSPLEFFKLFQGTQKGDTVKGINALKKYLHTLGYLSnhnhnhaaaaaDGDYFDENLESAVKTYQRNFNLNPTGHMDLKTVSMMGKPRCGVPDVINGTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISCAFLPGTRTDVQEPDYDAADVKISFQRgdhgdgypfdgpgpYNLLAHSFPPTDGRFHYDGDENWTVGAVPGAVDMQTVALHELRHVLGLAHRP
******ALHAFISFFLLQFFLLHALA*************LEFFKLFQGTQKGDTVKGINALKKYLHTLGYLSNHNHNHAAAAADGDYFDENLESAVKTYQRNFNLNPTGHMDLKTVSMMGKPRCGVPDVINGTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISCAFLPGTRTDVQEPDYDAADVKISFQRGDHGDGYPFDGPGPYNLLAHSFPPTDGRFHYDGDENWTVGAVPGAVDMQTVALHELRHVLGL****
*********AFISFFLLQFFLLHALASAS******KSSPLEFFK****************LKKYLHTLGYL********************LESAVKTYQRNFNLNPTGHMDLKTVSMMGKPRCGVPDVINGTTR**GGPAHYHTHYVFYPGRPKWPATKQIISCAFLPGTRTDVQEPDYDAADVKISFQRGDHGDGYPFDGPGPYNLLAHSFPPTDGRFHYDGDENWTVGAVPGAVDMQTVALHELRHVLGLA***
MKHKRNALHAFISFFLLQFFLLHALASA********SSPLEFFKLFQGTQKGDTVKGINALKKYLHTLGYLSNHNHNHAAAAADGDYFDENLESAVKTYQRNFNLNPTGHMDLKTVSMMGKPRCGVPDVINGTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISCAFLPGTRTDVQEPDYDAADVKISFQRGDHGDGYPFDGPGPYNLLAHSFPPTDGRFHYDGDENWTVGAVPGAVDMQTVALHELRHVLGLAHRP
MKHKRNALHAFISFFLLQFFLLHALASASNTNSNRKSSPLEFFKLFQGTQKGDTVKGINALKKYLHTLGYLSNHNHNHAAAAADGDYFDENLESAVKTYQRNFNLNPTGHMDLKTVSMMGKPRCGVPDVINGTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISCAFLPGTRTDVQEPDYDAADVKISFQRGDHGDGYPFDGPGPYNLLAHSFPPTDGRFHYDGDENWTVGAVPGAVDMQTVALHELRHVLGL****
iiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKHKRNALHAFISFFLLQFFLLHALASASNTNSNRKSSPLEFFKLFQGTQKGDTVKGINALKKYLHTLGYLSNHNHNHAAAAADGDYFDENLESAVKTYQRNFNLNPTGHMDLKTVSMMGKPRCGVPDVINGTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISCAFLPGTRTDVQEPDYDAADVKISFQRGDHGDGYPFDGPGPYNLLAHSFPPTDGRFHYDGDENWTVGAVPGAVDMQTVALHELRHVLGLAHRP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query257 2.2.26 [Sep-21-2011]
P29136305 Metalloendoproteinase 1 O no no 0.774 0.652 0.378 2e-37
P09237267 Matrilysin OS=Homo sapien yes no 0.571 0.550 0.359 4e-21
O60882 483 Matrix metalloproteinase- no no 0.793 0.422 0.304 8e-21
O55123 476 Stromelysin-2 OS=Mus musc yes no 0.591 0.319 0.375 2e-20
O18767 481 Matrix metalloproteinase- yes no 0.548 0.293 0.353 4e-20
P79287 483 Matrix metalloproteinase- yes no 0.548 0.291 0.345 5e-20
P57748 482 Matrix metalloproteinase- no no 0.540 0.288 0.365 1e-19
Q6Y4Q5 478 Stromelysin-1 OS=Canis fa no no 0.579 0.311 0.397 1e-19
P91953 591 50 kDa hatching enzyme OS N/A no 0.630 0.274 0.356 1e-19
P07152 476 Stromelysin-2 OS=Rattus n no no 0.591 0.319 0.369 2e-19
>sp|P29136|MEP1_SOYBN Metalloendoproteinase 1 OS=Glycine max PE=1 SV=2 Back     alignment and function desciption
 Score =  155 bits (393), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 122/238 (51%), Gaps = 39/238 (16%)

Query: 46  FQGTQKGDTVKGINALKKYLHTLGYLSNHNHNHAAAAADGDYFDENLESAVKTYQRNFNL 105
           F     G   KG++ +K Y H LGY+ N  H         D FD+ L SA+KTYQ+N+NL
Sbjct: 42  FTTYHPGQNYKGLSNVKNYFHHLGYIPNAPHF-------DDNFDDTLVSAIKTYQKNYNL 94

Query: 106 NPTGHMDLKTVSMMGKPRCGVPDVINGTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISC 165
           N TG  D+ T+  +  PRCGVPD+I  T +         + Y F+   P+W A    ++ 
Sbjct: 95  NVTGKFDINTLKQIMTPRCGVPDIIINTNKTTS--FGMISDYTFFKDMPRWQAGTTQLTY 152

Query: 166 AFLPGTRTD----------------------VQEPDYDAADVKISFQRGDHGDGYPFDGP 203
           AF P  R D                       +   Y+ A++KI F   +HGD YPFDGP
Sbjct: 153 AFSPEPRLDDTFKSAIARAFSKWTPVVNIAFQETTSYETANIKILFASKNHGDPYPFDGP 212

Query: 204 GPYNLLAHSFPPTDGRFHYDGDENW------TVGAVPGAVDMQTVALHELRHVLGLAH 255
           G   +L H+F PTDGR H+D DE W      T   V  A D+++VA+HE+ H+LGL H
Sbjct: 213 G--GILGHAFAPTDGRCHFDADEYWVASGDVTKSPVTSAFDLESVAVHEIGHLLGLGH 268
Specificity similar to that of mammalian matrix metalloproteases. May act against cell wall components.
Glycine max (taxid: 3847)
EC: 3EC: .EC: 4EC: .EC: 2EC: 4EC: .EC: -
>sp|P09237|MMP7_HUMAN Matrilysin OS=Homo sapiens GN=MMP7 PE=1 SV=1 Back     alignment and function description
>sp|O60882|MMP20_HUMAN Matrix metalloproteinase-20 OS=Homo sapiens GN=MMP20 PE=1 SV=3 Back     alignment and function description
>sp|O55123|MMP10_MOUSE Stromelysin-2 OS=Mus musculus GN=Mmp10 PE=2 SV=1 Back     alignment and function description
>sp|O18767|MMP20_BOVIN Matrix metalloproteinase-20 OS=Bos taurus GN=MMP20 PE=1 SV=1 Back     alignment and function description
>sp|P79287|MMP20_PIG Matrix metalloproteinase-20 OS=Sus scrofa GN=MMP20 PE=2 SV=1 Back     alignment and function description
>sp|P57748|MMP20_MOUSE Matrix metalloproteinase-20 OS=Mus musculus GN=Mmp20 PE=2 SV=1 Back     alignment and function description
>sp|Q6Y4Q5|MMP3_CANFA Stromelysin-1 OS=Canis familiaris GN=MMP3 PE=2 SV=1 Back     alignment and function description
>sp|P91953|HE_HEMPU 50 kDa hatching enzyme OS=Hemicentrotus pulcherrimus PE=1 SV=1 Back     alignment and function description
>sp|P07152|MMP10_RAT Stromelysin-2 OS=Rattus norvegicus GN=Mmp10 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query257
359485078319 PREDICTED: metalloendoproteinase 1-like 0.922 0.742 0.483 4e-61
147790365319 hypothetical protein VITISV_011608 [Viti 0.836 0.673 0.514 2e-60
255552736311 Metalloendoproteinase 1 precursor, putat 0.836 0.691 0.517 2e-60
225452582315 PREDICTED: metalloendoproteinase 1-like 0.906 0.739 0.479 2e-59
449442791314 PREDICTED: metalloendoproteinase 1-like 0.844 0.691 0.488 1e-56
225452580319 PREDICTED: metalloendoproteinase 1 [Viti 0.871 0.702 0.469 1e-56
449449409313 PREDICTED: metalloendoproteinase 1-like 0.926 0.760 0.434 4e-55
147807819305 hypothetical protein VITISV_030256 [Viti 0.879 0.740 0.476 2e-54
449449419319 PREDICTED: metalloendoproteinase 1-like 0.844 0.680 0.446 4e-54
449449417316 PREDICTED: metalloendoproteinase 1-like 0.953 0.775 0.419 4e-54
>gi|359485078|ref|XP_003633209.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  240 bits (613), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 132/273 (48%), Positives = 167/273 (61%), Gaps = 36/273 (13%)

Query: 12  ISFFLLQFFLLHALASASNTNSNRKSSPLEFFKLFQGTQKGDTVKGINALKKYLHTLGYL 71
           +SF  L  F+    + A+  N     SP EF K  +G QKG  VK I+ LKKYL   GYL
Sbjct: 8   MSFIFLFLFMFPITSHANGENP----SPFEFIKDLEGCQKGHKVKDIHKLKKYLQQFGYL 63

Query: 72  SNHNHNHAAAAADGDYFDENLESAVKTYQRNFNLNPTGHMDLKTVSMMGKPRCGVPDVIN 131
           S ++H+     AD D FD+ LE A+KTYQ N+ L  +G++D +TVS+M KPRCGV D+IN
Sbjct: 64  S-YSHSEYQTHADNDDFDDLLEFAIKTYQTNYYLKASGNLDSETVSVMVKPRCGVADIIN 122

Query: 132 GTTRMQGGPAHY-------HT--HYVFYPGRPKWPATKQIISCAFLPGTR---------- 172
           GT+RM+ G   Y       HT  HY F+ G P+WP +   ++ AFL GT           
Sbjct: 123 GTSRMRSGSRSYPHGYGSLHTVAHYSFFAGSPRWPPSNTHLTYAFLSGTSSTTMSAVTRA 182

Query: 173 ----------TDVQEPDYDAADVKISFQRGDHGDGYPFDGPGPYNLLAHSFPPTDGRFHY 222
                     T  +  DY  AD+KI FQRGDHGDG+PFDGPG    +AHSF PTDGR H+
Sbjct: 183 FGQWASATDFTFAETQDYTNADMKIGFQRGDHGDGFPFDGPG--GTIAHSFSPTDGRLHF 240

Query: 223 DGDENWTVGAVPGAVDMQTVALHELRHVLGLAH 255
           DGDE+W VGAV GA D++TVALHE+ H+LGL H
Sbjct: 241 DGDESWVVGAVAGAFDVETVALHEIGHLLGLGH 273

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147790365|emb|CAN59960.1| hypothetical protein VITISV_011608 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255552736|ref|XP_002517411.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis] gi|223543422|gb|EEF44953.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225452582|ref|XP_002275556.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449442791|ref|XP_004139164.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225452580|ref|XP_002280833.1| PREDICTED: metalloendoproteinase 1 [Vitis vinifera] gi|147807820|emb|CAN73129.1| hypothetical protein VITISV_030257 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449449409|ref|XP_004142457.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] gi|449527361|ref|XP_004170680.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147807819|emb|CAN73128.1| hypothetical protein VITISV_030256 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449449419|ref|XP_004142462.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] gi|449492747|ref|XP_004159088.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449449417|ref|XP_004142461.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query257
TAIR|locus:2025891 360 AT1G59970 [Arabidopsis thalian 0.501 0.358 0.379 2.6e-32
TAIR|locus:2130928 364 AT4G16640 [Arabidopsis thalian 0.513 0.362 0.357 4.2e-27
TAIR|locus:2020548 378 MMP "matrix metalloproteinase" 0.474 0.322 0.374 2.8e-19
TAIR|locus:2032467 384 AT1G24140 [Arabidopsis thalian 0.513 0.343 0.355 2.5e-18
TAIR|locus:2055605 342 AT2G45040 [Arabidopsis thalian 0.451 0.339 0.311 4.7e-18
UNIPROTKB|F1NZ61 472 MMP27 "Uncharacterized protein 0.579 0.315 0.341 1.2e-13
UNIPROTKB|Q6Y4Q5 478 MMP3 "Stromelysin-1" [Canis lu 0.599 0.322 0.339 2.1e-13
ZFIN|ZDB-GENE-040426-2132 680 mmp9 "matrix metalloproteinase 0.525 0.198 0.348 3.9e-13
UNIPROTKB|Q5ZMQ8263 MMP7 "Uncharacterized protein" 0.622 0.608 0.308 5.6e-13
UNIPROTKB|F1Q2W4263 MMP7 "Uncharacterized protein" 0.626 0.612 0.299 5.6e-13
TAIR|locus:2025891 AT1G59970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 258 (95.9 bits), Expect = 2.6e-32, Sum P(2) = 2.6e-32
 Identities = 52/137 (37%), Positives = 76/137 (55%)

Query:    34 NRKSSPLEFFKLFQGTQKGDTVKGINALKKYLHTLGYLSXXXXXXXXXXXDGDYFDENLE 93
             N   +  E F    G   G+ + G++ LK+Y    GY++             D FD+ L+
Sbjct:    36 NATQNAWETFSKLAGCHIGENINGLSKLKQYFRRFGYITTTGNCT-------DDFDDVLQ 88

Query:    94 SAVKTYQRNFNLNPTGHMDLKTVSMMGKPRCGVPDVINGTTRMQGGPAHYHTH-YVFYPG 152
             SA+ TYQ+NFNL  TG +D  T+  + KPRCG PD+I+G + M GG     T  Y F+PG
Sbjct:    89 SAINTYQKNFNLKVTGKLDSSTLRQIVKPRCGNPDLIDGVSEMNGGKILRTTEKYSFFPG 148

Query:   153 RPKWPATKQIISCAFLP 169
             +P+WP  K+ ++ AF P
Sbjct:   149 KPRWPKRKRDLTYAFAP 165
GO:0004222 "metalloendopeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008152 "metabolic process" evidence=IEA
GO:0008237 "metallopeptidase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0031012 "extracellular matrix" evidence=IEA
GO:0031225 "anchored to membrane" evidence=TAS
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2130928 AT4G16640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020548 MMP "matrix metalloproteinase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032467 AT1G24140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055605 AT2G45040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZ61 MMP27 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6Y4Q5 MMP3 "Stromelysin-1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2132 mmp9 "matrix metalloproteinase 9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMQ8 MMP7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q2W4 MMP7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.240.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
pfam00413159 pfam00413, Peptidase_M10, Matrixin 4e-29
cd04278157 cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, 7e-29
pfam0147157 pfam01471, PG_binding_1, Putative peptidoglycan bi 2e-10
cd04279156 cd04279, ZnMc_MMP_like_1, Zinc-dependent metallopr 1e-07
smart00235139 smart00235, ZnMc, Zinc-dependent metalloprotease 2e-05
>gnl|CDD|215908 pfam00413, Peptidase_M10, Matrixin Back     alignment and domain information 
 Score =  107 bits (269), Expect = 4e-29
 Identities = 50/116 (43%), Positives = 61/116 (52%), Gaps = 15/116 (12%)

Query: 150 YPGRPKWPATKQIISCAF------LPGTRTDVQEPDYDAADVKISFQRGDHGDGYPFDGP 203
           Y         ++ I  AF       P T T+V       AD+KI F RG+HGDGYPFDGP
Sbjct: 14  YTPDLSRDEVRRAIRRAFKVWSEVTPLTFTEVPT---GTADIKIGFGRGEHGDGYPFDGP 70

Query: 204 GPYNLLAHSFPP--TDGRFHYDGDENWTVGA--VPGAVDMQTVALHELRHVLGLAH 255
           G   +LAH+F P    G  H+D DE WTVG    P   ++  VA HE+ H LGL H
Sbjct: 71  G--GVLAHAFFPGPIGGDIHFDDDEQWTVGNSSGPEGTNLFLVAAHEIGHALGLGH 124

The members of this family are enzymes that cleave peptides. These proteases require zinc for catalysis. Length = 159
>gnl|CDD|239805 cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information
>gnl|CDD|216518 pfam01471, PG_binding_1, Putative peptidoglycan binding domain Back     alignment and domain information
>gnl|CDD|239806 cd04279, ZnMc_MMP_like_1, Zinc-dependent metalloprotease; MMP_like sub-family 1 Back     alignment and domain information
>gnl|CDD|214576 smart00235, ZnMc, Zinc-dependent metalloprotease Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 257
KOG1565 469 consensus Gelatinase A and related matrix metallop 100.0
cd04278157 ZnMc_MMP Zinc-dependent metalloprotease, matrix me 99.85
PF00413154 Peptidase_M10: Matrixin This Prosite motif covers 99.77
PF0147157 PG_binding_1: Putative peptidoglycan binding domai 99.48
cd04279156 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MM 99.36
smart00235140 ZnMc Zinc-dependent metalloprotease. Neutral zinc 99.27
cd04268165 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_ 99.04
cd04277186 ZnMc_serralysin_like Zinc-dependent metalloproteas 98.91
TIGR02869201 spore_SleB spore cortex-lytic enzyme. Members of t 98.85
cd04327198 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MM 98.55
cd00203167 ZnMc Zinc-dependent metalloprotease. This super-fa 98.32
cd04276197 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MM 98.25
PRK10594 608 murein L,D-transpeptidase; Provisional 98.21
COG3409185 Putative peptidoglycan-binding domain-containing p 97.88
PF12388211 Peptidase_M57: Dual-action HEIGH metallo-peptidase 97.66
COG2989 561 Uncharacterized protein conserved in bacteria [Fun 97.47
PF05572154 Peptidase_M43: Pregnancy-associated plasma protein 97.12
PF13582124 Reprolysin_3: Metallo-peptidase family M12B Reprol 97.03
COG3023257 ampD N-acetyl-anhydromuramyl-L-alanine amidase [Ce 96.85
PF13583206 Reprolysin_4: Metallo-peptidase family M12B Reprol 96.67
PF0882374 PG_binding_2: Putative peptidoglycan binding domai 96.61
COG5549236 Predicted Zn-dependent protease [Posttranslational 96.61
cd04273207 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, A 96.57
cd04275225 ZnMc_pappalysin_like Zinc-dependent metalloproteas 96.49
PF13688196 Reprolysin_5: Metallo-peptidase family M12; PDB: 2 96.29
COG3409185 Putative peptidoglycan-binding domain-containing p 96.19
cd04280180 ZnMc_astacin_like Zinc-dependent metalloprotease, 96.18
PF02031132 Peptidase_M7: Streptomyces extracellular neutral p 96.18
COG1913181 Predicted Zn-dependent proteases [General function 96.15
PRK13267179 archaemetzincin-like protein; Reviewed 96.09
PF07998194 Peptidase_M54: Peptidase family M54; InterPro: IPR 95.98
PF13574173 Reprolysin_2: Metallo-peptidase family M12B Reprol 95.96
) family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01400">PF01400191 Astacin: Astacin (Peptidase family M12A) This Pros 95.94
cd04267192 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADA 95.86
cd04283182 ZnMc_hatching_enzyme Zinc-dependent metalloproteas 95.85
cd04269194 ZnMc_adamalysin_II_like Zinc-dependent metalloprot 95.78
cd04281200 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1 95.36
cd04271228 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, A 95.01
PF01421199 Reprolysin: Reprolysin (M12B) family zinc metallop 94.98
cd04270244 ZnMc_TACE_like Zinc-dependent metalloprotease; TAC 94.73
cd04272220 ZnMc_salivary_gland_MPs Zinc-dependent metalloprot 94.59
cd04282230 ZnMc_meprin Zinc-dependent metalloprotease, meprin 94.48
PF11350203 DUF3152: Protein of unknown function (DUF3152); In 93.5
PF05548 314 Peptidase_M11: Gametolysin peptidase M11; InterPro 93.29
PF10462305 Peptidase_M66: Peptidase M66; InterPro: IPR019503 92.76
KOG3714 411 consensus Meprin A metalloprotease [Posttranslatio 92.26
PF0937472 PG_binding_3: Predicted Peptidoglycan domain; Inte 91.16
TIGR03296 286 M6dom_TIGR03296 M6 family metalloprotease domain. 90.4
PF04298 222 Zn_peptidase_2: Putative neutral zinc metallopepti 90.23
COG3824136 Predicted Zn-dependent protease [General function 88.76
PF12044423 Metallopep: Putative peptidase family; InterPro: I 86.98
PTZ00257 622 Glycoprotein GP63 (leishmanolysin); Provisional 86.05
PTZ00337 567 surface protease GP63; Provisional 85.12
PF09471264 Peptidase_M64: IgA Peptidase M64; InterPro: IPR019 85.11
PF0626297 DUF1025: Possibl zinc metallo-peptidase; InterPro: 84.1
KOG3607 716 consensus Meltrins, fertilins and related Zn-depen 83.24
PF05547 645 Peptidase_M6: Immune inhibitor A peptidase M6; Int 81.46
PF01457 521 Peptidase_M8: Leishmanolysin This Prosite motif co 80.65
>KOG1565 consensus Gelatinase A and related matrix metalloproteases [Posttranslational modification, protein turnover, chaperones; Extracellular structures] Back     alignment and domain information 
Probab=100.00  E-value=9.9e-44  Score=342.10  Aligned_cols=174  Identities=44%  Similarity=0.792  Sum_probs=151.7

Q ss_pred             cHHHHHHHHHhcCCCCCCCccccccccCCCcccHHHHHHHHHHHHhcCCCCCCCCChhhhhccCCCccccCCCCCCcccc
Q 043086           57 GINALKKYLHTLGYLSNHNHNHAAAAADGDYFDENLESAVKTYQRNFNLNPTGHMDLKTVSMMGKPRCGVPDVINGTTRM  136 (257)
Q Consensus        57 ~v~~~q~yL~~fGYl~~~~~~~~~~~~~~~~~~~~~~~AIk~FQ~~~gL~~TG~lD~~T~~~M~~PRCGvpD~~~~~~~~  136 (257)
                      ++..++.||++|||+...+...    .  ...+..+++||+.||++++|++||++|.+|++.|.+|||||||.       
T Consensus        29 ~~~~~~~yl~~~~y~~~~~~~~----~--~~~~~~~~~al~~~q~~~~l~~tG~lD~~Tl~~m~~prCgvpd~-------   95 (469)
T KOG1565|consen   29 DKVALQDYLECYGYLPPTDLTA----T--RASQNVLEDALKMMQDFFGLPVTGKLDNATLALMNKPRCGVPDG-------   95 (469)
T ss_pred             chhHHHHHhhhcccCCCccccc----c--ccCchhhHHHHHhhhhhcCccccCCcchhhhhhccCCCcCCCCC-------
Confidence            6788999999999998874211    1  11578899999999999999999999999999999999999991       


Q ss_pred             CCCCCccccccccCCCCCCCCCCccceeEeecCCCc-ce----------------eecC------C-CCCccEEEEeecC
Q 043086          137 QGGPAHYHTHYVFYPGRPKWPATKQIISCAFLPGTR-TD----------------VQEP------D-YDAADVKISFQRG  192 (257)
Q Consensus       137 ~~~~~~~~~~~~~~~~~~kW~~~k~~LTy~i~~~~~-~~----------------~v~~------~-~~~aDI~I~f~~~  192 (257)
                               +|+++++++||+  |++|||+|.+++. +.                .|.+      . ...|||+|+|..+
T Consensus        96 ---------~~~~~~~~~kW~--k~~lT~ri~n~~~~l~~~~vr~~~~~Af~~Ws~vtpl~f~e~~~~~~aDi~i~F~~~  164 (469)
T KOG1565|consen   96 ---------RYRYFPGKPKWN--KEHLTYRIKNYTPYLPQAEVRCAKSEAFKLWSDVTPLTFQEVKEEGEADIRISFFPG  164 (469)
T ss_pred             ---------ccccCcccCccc--ccccceeccccCCCCCHHHHHHHHHHHHhhcccCCCCccccCCCCCCCceeeeeecc
Confidence                     577788999999  9999999999853 21                1222      2 3799999999999


Q ss_pred             CCCCCCCCCCCCCCcceeecCCC---CCCCCcccCCCCCccCCCCCCchhHHHHHHhhhhhcCCCCCC
Q 043086          193 DHGDGYPFDGPGPYNLLAHSFPP---TDGRFHYDGDENWTVGAVPGAVDMQTVALHELRHVLGLAHRP  257 (257)
Q Consensus       193 ~hgd~~~fdG~g~~~~lahaf~P---~~g~ihfd~~e~wt~~~~~~~~~l~~va~HEiGH~LGL~HSs  257 (257)
                      .|||++||||+|  |+|||||+|   ..|++|||++|.|+++ ...++||+.||+|||||+|||+||+
T Consensus       165 ~h~d~~PFDG~~--g~laHAf~Pg~~~~G~~hfD~dE~Wt~~-~~~g~~l~~Va~HEiGH~LGL~HS~  229 (469)
T KOG1565|consen  165 DHGDGFPFDGPG--GVLAHAFFPGPGIGGDLHFDKDETWTYG-DSNGVDLFLVAAHEIGHALGLGHSS  229 (469)
T ss_pred             CCCCCCcccCCC--CceecccCCCCCCCCccccCcccceecc-CCccchhHHHhhhhcccccccCCCC
Confidence            999999999999  999999999   6789999999999996 3469999999999999999999996

>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information
>PF00413 Peptidase_M10: Matrixin This Prosite motif covers only the active site Back     alignment and domain information
>PF01471 PG_binding_1: Putative peptidoglycan binding domain; InterPro: IPR002477 This entry represents peptidoglycan binding domain (PGBD), as well as related domains that share the same structure Back     alignment and domain information
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1 Back     alignment and domain information
>smart00235 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily Back     alignment and domain information
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily Back     alignment and domain information
>TIGR02869 spore_SleB spore cortex-lytic enzyme Back     alignment and domain information
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3 Back     alignment and domain information
>cd00203 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2 Back     alignment and domain information
>PRK10594 murein L,D-transpeptidase; Provisional Back     alignment and domain information
>COG3409 Putative peptidoglycan-binding domain-containing protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF12388 Peptidase_M57: Dual-action HEIGH metallo-peptidase; InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57 Back     alignment and domain information
>COG2989 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05572 Peptidase_M43: Pregnancy-associated plasma protein-A; InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13582 Reprolysin_3: Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C Back     alignment and domain information
>COG3023 ampD N-acetyl-anhydromuramyl-L-alanine amidase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13583 Reprolysin_4: Metallo-peptidase family M12B Reprolysin-like Back     alignment and domain information
>PF08823 PG_binding_2: Putative peptidoglycan binding domain; InterPro: IPR014927 This entry may be a peptidoglycan binding domain Back     alignment and domain information
>COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup Back     alignment and domain information
>cd04275 ZnMc_pappalysin_like Zinc-dependent metalloprotease, pappalysin_like subfamily Back     alignment and domain information
>PF13688 Reprolysin_5: Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B Back     alignment and domain information
>COG3409 Putative peptidoglycan-binding domain-containing protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site Back     alignment and domain information
>PF02031 Peptidase_M7: Streptomyces extracellular neutral proteinase (M7) family; InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG1913 Predicted Zn-dependent proteases [General function prediction only] Back     alignment and domain information
>PRK13267 archaemetzincin-like protein; Reviewed Back     alignment and domain information
>PF07998 Peptidase_M54: Peptidase family M54; InterPro: IPR012962 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13574 Reprolysin_2: Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A Back     alignment and domain information
>PF01400 Astacin: Astacin (Peptidase family M12A) This Prosite motif covers only the active site Back     alignment and domain information
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup Back     alignment and domain information
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily Back     alignment and domain information
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily Back     alignment and domain information
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily Back     alignment and domain information
>cd04271 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, ADAM_fungal subgroup Back     alignment and domain information
>PF01421 Reprolysin: Reprolysin (M12B) family zinc metalloprotease This Prosite motif covers only the active site Back     alignment and domain information
>cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily Back     alignment and domain information
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs Back     alignment and domain information
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily Back     alignment and domain information
>PF11350 DUF3152: Protein of unknown function (DUF3152); InterPro: IPR022603 This entry represents Actinobacteria proteins of unknown function Back     alignment and domain information
>PF05548 Peptidase_M11: Gametolysin peptidase M11; InterPro: IPR008752 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10462 Peptidase_M66: Peptidase M66; InterPro: IPR019503 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3714 consensus Meprin A metalloprotease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09374 PG_binding_3: Predicted Peptidoglycan domain; InterPro: IPR018537 This family contains a potential peptidoglycan binding domain Back     alignment and domain information
>TIGR03296 M6dom_TIGR03296 M6 family metalloprotease domain Back     alignment and domain information
>PF04298 Zn_peptidase_2: Putative neutral zinc metallopeptidase; InterPro: IPR007395 Members of this family of bacterial proteins are described as hypothetical proteins or zinc-dependent proteases Back     alignment and domain information
>COG3824 Predicted Zn-dependent protease [General function prediction only] Back     alignment and domain information
>PF12044 Metallopep: Putative peptidase family; InterPro: IPR021917 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PTZ00257 Glycoprotein GP63 (leishmanolysin); Provisional Back     alignment and domain information
>PTZ00337 surface protease GP63; Provisional Back     alignment and domain information
>PF09471 Peptidase_M64: IgA Peptidase M64; InterPro: IPR019026 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF06262 DUF1025: Possibl zinc metallo-peptidase; InterPro: IPR010428 This is a family of bacterial protein with undetermined function Back     alignment and domain information
>KOG3607 consensus Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05547 Peptidase_M6: Immune inhibitor A peptidase M6; InterPro: IPR008757 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF01457 Peptidase_M8: Leishmanolysin This Prosite motif covers only the active site Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
1su3_A 450 X-Ray Structure Of Human Prommp-1: New Insights Int 2e-10
1slm_A255 Crystal Structure Of Fibroblast Stromelysin-1: The 1e-09
1eak_A 421 Catalytic Domain Of Prommp-2 E404q Mutant Length = 6e-08
1ck7_A 631 Gelatinase A (Full-Length) Length = 631 9e-08
2xs3_A166 Structure Of Karilysin Catalytic Mmp Domain Length 7e-06
2xs4_A167 Structure Of Karilysin Catalytic Mmp Domain In Comp 8e-06
1hv5_A165 Crystal Structure Of The Stromelysin-3 (Mmp-11) Cat 3e-05
2jsd_A160 Solution Structure Of Mmp20 Complexed With Nngh Len 2e-04
1l6j_A 425 Crystal Structure Of Human Matrix Metalloproteinase 2e-04
2y6d_A174 The Discovery Of Mmp7 Inhibitors Exploiting A Novel 3e-04
2ddy_A173 Solution Structure Of Matrilysin (Mmp-7) Complexed 3e-04
1mmp_A170 Matrilysin Complexed With Carboxylate Inhibitor Len 3e-04
2y6c_A165 The Discovery Of Mmp7 Inhibitors Exploiting A Novel 3e-04
1cxv_A164 Structure Of Recombinant Mouse Collagenase-3 (Mmp-1 4e-04
1gkc_A163 Mmp9-inhibitor Complex Length = 163 4e-04
1q3a_A165 Crystal Structure Of The Catalytic Domain Of Human 6e-04
3v96_B165 Complex Of Matrix Metalloproteinase-10 Catalytic Do 6e-04
>pdb|1SU3|A Chain A, X-Ray Structure Of Human Prommp-1: New Insights Into Collagenase Action Length = 450 Back     alignment and structure 
Iteration: 1

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/174 (33%), Positives = 73/174 (41%), Gaps = 23/174 (13%)
Query: 96  VKTYQRNFNLNPTGHMDLKTVSMMGKPRCGVPDVINGTTRMQGGPAHYHTHYVFY----- 150
           +K  Q  F L  TG  D +T+ +M +PRCGVPDV       +G P    TH  +      
Sbjct: 45  LKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVL-TEGNPRWEQTHLTYRIENYT 103
Query: 151 PGRPKWPATKQIISCAF------LPGTRTDVQEPDYDAADVKISFQRXXXXXXXXXXXXX 204
           P  P+       I  AF       P T T V E     AD+ ISF R             
Sbjct: 104 PDLPR-ADVDHAIEKAFQLWSNVTPLTFTKVSE---GQADIMISFVRGDHRDNSPFDGPG 159
Query: 205 XYNLLAHSFPP---TDGRFHYDGDENWTVGAVPGAVDMQTVALHELRHVLGLAH 255
               LAH+F P     G  H+D DE WT        ++  VA HEL H LGL+H
Sbjct: 160 --GNLAHAFQPGPGIGGDAHFDEDERWTNNF--REYNLHRVAAHELGHSLGLSH 209
>pdb|1SLM|A Chain A, Crystal Structure Of Fibroblast Stromelysin-1: The C-Truncated Human Proenzyme Length = 255 Back     alignment and structure
>pdb|1EAK|A Chain A, Catalytic Domain Of Prommp-2 E404q Mutant Length = 421 Back     alignment and structure
>pdb|1CK7|A Chain A, Gelatinase A (Full-Length) Length = 631 Back     alignment and structure
>pdb|2XS3|A Chain A, Structure Of Karilysin Catalytic Mmp Domain Length = 166 Back     alignment and structure
>pdb|2XS4|A Chain A, Structure Of Karilysin Catalytic Mmp Domain In Complex With Magnesium Length = 167 Back     alignment and structure
>pdb|1HV5|A Chain A, Crystal Structure Of The Stromelysin-3 (Mmp-11) Catalytic Domain Complexed With A Phosphinic Inhibitor Length = 165 Back     alignment and structure
>pdb|2JSD|A Chain A, Solution Structure Of Mmp20 Complexed With Nngh Length = 160 Back     alignment and structure
>pdb|1L6J|A Chain A, Crystal Structure Of Human Matrix Metalloproteinase Mmp9 (gelatinase B) Length = 425 Back     alignment and structure
>pdb|2Y6D|A Chain A, The Discovery Of Mmp7 Inhibitors Exploiting A Novel Selectivity Trigger Length = 174 Back     alignment and structure
>pdb|2DDY|A Chain A, Solution Structure Of Matrilysin (Mmp-7) Complexed To Constraint Conformational Sulfonamide Inhibitor Length = 173 Back     alignment and structure
>pdb|1MMP|A Chain A, Matrilysin Complexed With Carboxylate Inhibitor Length = 170 Back     alignment and structure
>pdb|2Y6C|A Chain A, The Discovery Of Mmp7 Inhibitors Exploiting A Novel Selectivity Trigger Length = 165 Back     alignment and structure
>pdb|1CXV|A Chain A, Structure Of Recombinant Mouse Collagenase-3 (Mmp-13) Length = 164 Back     alignment and structure
>pdb|1GKC|A Chain A, Mmp9-inhibitor Complex Length = 163 Back     alignment and structure
>pdb|1Q3A|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Matrix Metalloproteinase 10 Length = 165 Back     alignment and structure
>pdb|3V96|B Chain B, Complex Of Matrix Metalloproteinase-10 Catalytic Domain (Mmp-10cd) With Tissue Inhibitor Of Metalloproteinases-1 (Timp-1) Length = 165 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
1su3_A 450 Interstitial collagenase; prodomain, hemopexin dom 2e-37
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibrobl 8e-34
1l6j_A 425 Matrix metalloproteinase-9; twisted beta sheet fla 2e-25
1l6j_A425 Matrix metalloproteinase-9; twisted beta sheet fla 1e-07
1eak_A 421 72 kDa type IV collagenase; hydrolase-hydrolase in 4e-23
1eak_A421 72 kDa type IV collagenase; hydrolase-hydrolase in 8e-08
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 1e-22
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 3e-07
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 4e-15
3ayu_A167 72 kDa type IV collagenase; protease, hydrolase-hy 2e-14
3ba0_A 365 Macrophage metalloelastase; FULL-length MMP-12, he 3e-14
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease 3e-13
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, viru 6e-13
3ma2_D181 Matrix metalloproteinase-14; protein - protein com 1e-12
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; memb 1e-12
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex 5e-12
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, 5e-12
2y6d_A174 Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie 7e-12
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, h 7e-11
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural 1e-10
1y93_A159 Macrophage metalloelastase; matrix metalloproteina 2e-10
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) 5e-10
3bkh_A268 Phikz144, lytic transglycosylase; bacteriophage, e 2e-05
1lbu_A213 Muramoyl-pentapeptide carboxypeptidase; hydrolase, 5e-05
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Length = 450 Back     alignment and structure
 Score =  135 bits (341), Expect = 2e-37
 Identities = 66/209 (31%), Positives = 85/209 (40%), Gaps = 18/209 (8%)

Query: 56  KGINALKKYLHTLGYLSNHNHNHAAAAADGDYFDENLESAVKTYQRNFNLNPTGHMDLKT 115
           + ++ ++KYL     L N          +       +   +K  Q  F L  TG  D +T
Sbjct: 10  QDVDLVQKYLEKYYNLKNDGRQ-----VEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAET 64

Query: 116 VSMMGKPRCGVPDVINGTTRMQGGP---AHYHTHYVFYPGRPKWPATKQIISCAFL---P 169
           + +M +PRCGVPDV               H       Y            I  AF     
Sbjct: 65  LKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSN 124

Query: 170 GTRTDVQEPDYDAADVKISFQRGDHGDGYPFDGPGPYNLLAHSFPPT---DGRFHYDGDE 226
            T     +     AD+ ISF RGDH D  PFDGPG    LAH+F P     G  H+D DE
Sbjct: 125 VTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPG--GNLAHAFQPGPGIGGDAHFDEDE 182

Query: 227 NWTVGAVPGAVDMQTVALHELRHVLGLAH 255
            WT        ++  VA HEL H LGL+H
Sbjct: 183 RWTNN--FREYNLHRVAAHELGHSLGLSH 209
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Length = 255 Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Length = 425 Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Length = 425 Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Length = 421 Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Length = 421 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Length = 631 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Length = 631 Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Length = 168 Back     alignment and structure
>3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* Length = 167 Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Length = 365 Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A Length = 168 Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Length = 167 Back     alignment and structure
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} PDB: 1bqq_M 1buv_M Length = 181 Back     alignment and structure
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Length = 169 Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Length = 163 Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... Length = 173 Back     alignment and structure
>2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* Length = 174 Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Length = 165 Back     alignment and structure
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... Length = 159 Back     alignment and structure
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Length = 159 Back     alignment and structure
>3bkh_A Phikz144, lytic transglycosylase; bacteriophage, endolysin, peptidoglycan, cell WALL degradation, lysozyme, hydrolase; 2.50A {Pseudomonas phage phikz} PDB: 3bkv_A* Length = 268 Back     alignment and structure
>1lbu_A Muramoyl-pentapeptide carboxypeptidase; hydrolase, nuclear receptor; 1.80A {Streptomyces albus} SCOP: a.20.1.1 d.65.1.1 Length = 213 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query257
1eak_A 421 72 kDa type IV collagenase; hydrolase-hydrolase in 100.0
1l6j_A 425 Matrix metalloproteinase-9; twisted beta sheet fla 100.0
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibrobl 100.0
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 100.0
1su3_A 450 Interstitial collagenase; prodomain, hemopexin dom 100.0
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 99.97
3ma2_D181 Matrix metalloproteinase-14; protein - protein com 99.97
1kap_P 479 Alkaline protease; calcium binding protein, zinc m 99.95
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) 99.94
1k7i_A 479 PROC, secreted protease C; metalloprotease, hydrol 99.94
2y6d_A174 Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie 99.93
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, viru 99.93
3ayu_A167 72 kDa type IV collagenase; protease, hydrolase-hy 99.93
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, 99.92
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex 99.92
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease 99.92
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, h 99.92
1y93_A159 Macrophage metalloelastase; matrix metalloproteina 99.91
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; memb 99.91
1g9k_A 463 Serralysin; beta jelly roll, hydrolase; 1.96A {Pse 99.91
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural 99.89
1sat_A 471 Serratia protease; parallel beta helix, parallel b 99.88
3ba0_A 365 Macrophage metalloelastase; FULL-length MMP-12, he 99.87
1c7k_A132 NCNP, zinc endoprotease; alpha and beta protein, m 99.08
1lbu_A213 Muramoyl-pentapeptide carboxypeptidase; hydrolase, 98.93
3bkh_A268 Phikz144, lytic transglycosylase; bacteriophage, e 98.93
4fet_B222 Spore cortex-lytic enzyme prepeptide; transglycosy 98.85
3d2y_A261 N-acetylmuramoyl-L-alanine amidase AMID; zinc amid 98.58
3edh_A201 Bone morphogenetic protein 1; vicinal disulfide, a 97.73
3lq0_A235 Proastacin; metallopeptidase, zymogen activation, 97.69
2cki_A262 Ulilysin; metalloprotease, hydrolase; HET: ARG; 1. 97.05
4axq_A163 Archaemetzincin; metalloprotease, protease, hydrol 96.05
2w15_A202 Zinc metalloproteinase BAP1; hydrolase inhibitor c 95.51
3lmc_A210 Peptidase, zinc-dependent; structural genomics, PS 95.39
1kuf_A203 Atrolysin E, metalloproteinase; alpha/beta protein 95.38
1qua_A197 Acutolysin-C, hemorrhagin III; metalloprotease, he 95.36
1yp1_A202 FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} 95.36
3b8z_A217 Protein adamts-5; alpha/beta, hydrolase; HET: 294; 95.34
1atl_A202 Atrolysin C; metalloendopeptidase, hydrolase-hydro 95.31
1bud_A197 Protein (acutolysin A); metalloproteinase, snake v 95.3
2x7m_A195 Archaemetzincin; metalloprotease, protease, hydrol 95.11
3lqb_A199 Hatching enzyme, LOC792177 protein; hydrolase, met 94.99
2v4b_A 300 Adamts-1; zymogen, protease, hydrolase, metallopro 94.83
4dd8_A208 Disintegrin and metalloproteinase domain-containi 94.79
2ddf_A257 ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapi 94.73
1r55_A214 ADAM 33; metalloprotease, inhibitor, asthma, hydro 94.72
2rjp_A 316 Adamts-4; metalloprotease domain, aggrecanase, cle 94.65
2rjq_A 378 Adamts-5; metalloprotease domain, aggrecanase, cle 94.47
2i47_A288 ADAM 17; TACE-inhibitor complex, hydrolase; HET: I 94.19
2e3x_A 427 Coagulation factor X-activating enzyme light CHAI; 93.81
2dw0_A 419 Catrocollastatin; apoptotic toxin, SVMP, metallopr 93.74
2ero_A 427 VAP-1, vascular apoptosis-inducing protein 1; meta 93.58
3k7n_A 397 K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A { 93.4
3k7l_A 422 Atragin; SVMP, metalloprotease, hydrolase; HET: NA 93.19
3p24_A397 BFT-3; metzincins, metalloendopeptidase, hydrolase 92.0
3g5c_A 510 ADAM 22; alpha/beta fold, cross-linked domain, cel 91.44
2ikb_A167 Hypothetical protein NMB1012; structural genomics, 91.21
4gwm_A 592 Meprin A subunit beta; mulidomain structure, hydro 89.83
2nr7_A195 Secretion activator protein, putative; APCC85792, 88.58
1lml_A 478 Leishmanolysin; metalloprotease, glycoprotein; 1.8 86.02
3e11_A114 Predicted zincin-like metalloprotease; DUF1025 fam 84.1
3ujz_A 869 Metalloprotease STCE; mucin-type glycoprotein, hyd 83.0
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Back     alignment and structure
Probab=100.00  E-value=2.7e-50  Score=380.95  Aligned_cols=147  Identities=41%  Similarity=0.724  Sum_probs=128.3

Q ss_pred             hhcHHHHHHHHHh-cCCCCCCCccccccccCCCcccHHHHHHHHHHHHhcCCCCCCCCChhhhhccCCCccccCCCCCCc
Q 043086           55 VKGINALKKYLHT-LGYLSNHNHNHAAAAADGDYFDENLESAVKTYQRNFNLNPTGHMDLKTVSMMGKPRCGVPDVINGT  133 (257)
Q Consensus        55 ~~~v~~~q~yL~~-fGYl~~~~~~~~~~~~~~~~~~~~~~~AIk~FQ~~~gL~~TG~lD~~T~~~M~~PRCGvpD~~~~~  133 (257)
                      .++++.+|+||++ |||++...            +++++++||++||+++||++||+||++|+++|++|||||||+.   
T Consensus        13 ~~~~~~a~~yL~~~yGyl~~~~------------~~~~~~~Ai~~~Q~f~gL~vTG~LD~~T~~~M~~PRCGvpD~~---   77 (421)
T 1eak_A           13 KTDKELAVQYLNTFYGCPKESC------------NLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVA---   77 (421)
T ss_dssp             CCHHHHHHHHHHHHTCCCSSCC------------CHHHHHHHHHHHHHHSSCCCCCSCCHHHHHHHTSCBCSSCSSC---
T ss_pred             CccHHHHHHHHHHhcCCCCCCC------------chHHHHHHHHHHHHHcCCCCCCccCHHHHHHhcCCCCCCCCcc---
Confidence            3467788999999 99997641            4688999999999999999999999999999999999999972   


Q ss_pred             cccCCCCCccccccccCCCCCCCCCCccceeEeecCCCc-ce----------------eecC------CCCCccEEEEee
Q 043086          134 TRMQGGPAHYHTHYVFYPGRPKWPATKQIISCAFLPGTR-TD----------------VQEP------DYDAADVKISFQ  190 (257)
Q Consensus       134 ~~~~~~~~~~~~~~~~~~~~~kW~~~k~~LTy~i~~~~~-~~----------------~v~~------~~~~aDI~I~f~  190 (257)
                                  +|+++++++||.  |++|||+|.++++ ++                .|++      ...+|||+|+|+
T Consensus        78 ------------~~~~~~~~~kW~--k~~LTY~i~~~~~~l~~~~v~~~i~~AF~~Ws~vtpLtF~ev~~~~ADI~I~F~  143 (421)
T 1eak_A           78 ------------NYNFFPRKPKWD--KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFG  143 (421)
T ss_dssp             ------------SSCCSSCCCCCS--SSEEEEEECCCCTTSCHHHHHHHHHHHHHHHHTSSSCEEEECCSSCCSEEEEEE
T ss_pred             ------------ccccccCCcccc--cceEEEEEecCCCCCCHHHHHHHHHHHHHHHhcccCceeEEcCCCCCCEEEEEe
Confidence                        566778899999  9999999999864 21                2222      345999999999


Q ss_pred             cCCCCCCCCCCCCCCCcceeecCCCC---CCCCcccCCCCCccCC
Q 043086          191 RGDHGDGYPFDGPGPYNLLAHSFPPT---DGRFHYDGDENWTVGA  232 (257)
Q Consensus       191 ~~~hgd~~~fdG~g~~~~lahaf~P~---~g~ihfd~~e~wt~~~  232 (257)
                      +++|||++||||+|  |+|||||+|.   .|+||||++|.|+++.
T Consensus       144 ~g~HgD~~pFDG~g--g~LAHAf~P~~g~~Gd~HFD~dE~Wt~~~  186 (421)
T 1eak_A          144 RWEHGDGYPFDGKD--GLLAHAFAPGTGVGGDSHFDDDELWTLGE  186 (421)
T ss_dssp             CSSCSSSCCCCSSS--SBCEEECCSSSTTTTCEEEETTSCEESSS
T ss_pred             cCCCCCccccCCCC--CccccccCCCCCCCCceeeeeccceeccC
Confidence            99999999999999  9999999996   7999999999999854
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Back     alignment and structure
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Back     alignment and structure
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} SCOP: d.92.1.11 PDB: 1bqq_M 1buv_M Back     alignment and structure
>1kap_P Alkaline protease; calcium binding protein, zinc metalloprotease; 1.64A {Pseudomonas aeruginosa} SCOP: b.80.7.1 d.92.1.6 PDB: 1jiw_P 1akl_A Back     alignment and structure
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Back     alignment and structure
>1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P Back     alignment and structure
>2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Back     alignment and structure
>3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Back     alignment and structure
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... Back     alignment and structure
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Back     alignment and structure
>1g9k_A Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomonas} SCOP: b.80.7.1 d.92.1.6 PDB: 1o0q_A 1o0t_A 1om6_A 1om7_A 1om8_A 1omj_A 1h71_P Back     alignment and structure
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Back     alignment and structure
>1sat_A Serratia protease; parallel beta helix, parallel beta roll, hydrolase (serine protease); 1.75A {Serratia marcescens} SCOP: b.80.7.1 d.92.1.6 PDB: 1af0_A* 1smp_A 1srp_A Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>1c7k_A NCNP, zinc endoprotease; alpha and beta protein, metalloproteinase, hydrolase; 1.00A {Streptomyces caespitosus} SCOP: d.92.1.1 PDB: 1kuh_A Back     alignment and structure
>1lbu_A Muramoyl-pentapeptide carboxypeptidase; hydrolase, nuclear receptor; 1.80A {Streptomyces albus} SCOP: a.20.1.1 d.65.1.1 Back     alignment and structure
>3bkh_A Phikz144, lytic transglycosylase; bacteriophage, endolysin, peptidoglycan, cell WALL degradation, lysozyme, hydrolase; 2.50A {Pseudomonas phage phikz} PDB: 3bkv_A* Back     alignment and structure
>4fet_B Spore cortex-lytic enzyme prepeptide; transglycosylase, cortex hydrolase domain, sodium ION, seMet hydrolase; 1.91A {Bacillus anthracis} Back     alignment and structure
>3d2y_A N-acetylmuramoyl-L-alanine amidase AMID; zinc amidase, PGRP, peptidoglycan recognizing protein, AMPD, acetylmuramyl-L-alanine amidase; HET: AH0; 1.75A {Escherichia coli} PDB: 2bh7_A 2wkx_A 2bgx_A* 3d2z_A Back     alignment and structure
>3edh_A Bone morphogenetic protein 1; vicinal disulfide, alternative splicing, calcium, chondrogenesis, cleavage on PAIR of basic residues, cytokine; 1.25A {Homo sapiens} SCOP: d.92.1.0 PDB: 3edg_A 3edi_A Back     alignment and structure
>3lq0_A Proastacin; metallopeptidase, zymogen activation, proenzyme, protease, D bond, hydrolase, metal-binding, metalloprotease, zymogen; 1.45A {Astacus astacus} PDB: 1iab_A 1iaa_A 1ast_A 1iac_A 1iad_A 1iae_A 1qji_A* 1qjj_A Back     alignment and structure
>2cki_A Ulilysin; metalloprotease, hydrolase; HET: ARG; 1.7A {Methanosarcina acetivorans} PDB: 2j83_A* 3lum_A* 3lun_A* Back     alignment and structure
>4axq_A Archaemetzincin; metalloprotease, protease, hydrolase, metal-bindi; 1.40A {Archaeoglobus fulgidus} PDB: 2xhq_A 3zvs_A 4a3w_A* Back     alignment and structure
>2w15_A Zinc metalloproteinase BAP1; hydrolase inhibitor complex, metal-binding, zinc-depending, metalloprotease, metalloproteinase/inhibitor complex; HET: WR2; 1.05A {Bothrops asper} PDB: 2w12_A* 2w13_A* 2w14_A* 1nd1_A 3gbo_A Back     alignment and structure
>3lmc_A Peptidase, zinc-dependent; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, MUR16; 2.00A {Methanocorpusculum labreanum} Back     alignment and structure
>1kuf_A Atrolysin E, metalloproteinase; alpha/beta protein, hydrolase; 1.35A {Protobothrops mucrosquamatus} SCOP: d.92.1.9 PDB: 1kui_A 1kuk_A 1kug_A 1wni_A Back     alignment and structure
>1qua_A Acutolysin-C, hemorrhagin III; metalloprotease, hemorrhagic toxin, snake venom proteinase; 2.20A {Deinagkistrodon acutus} SCOP: d.92.1.9 Back     alignment and structure
>1yp1_A FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} Back     alignment and structure
>3b8z_A Protein adamts-5; alpha/beta, hydrolase; HET: 294; 1.40A {Homo sapiens} PDB: 3hyg_A* 3hy9_A* 3hy7_A* 3ljt_A* Back     alignment and structure
>1atl_A Atrolysin C; metalloendopeptidase, hydrolase-hydrolase inhibitor complex; HET: 0QI; 1.80A {Crotalus atrox} SCOP: d.92.1.9 PDB: 1htd_A 1dth_A* 3aig_A* 2aig_P* 4aig_A* 1iag_A Back     alignment and structure
>1bud_A Protein (acutolysin A); metalloproteinase, snake venom, MMP, toxin; 1.90A {Deinagkistrodon acutus} SCOP: d.92.1.9 PDB: 1bsw_A Back     alignment and structure
>2x7m_A Archaemetzincin; metalloprotease, protease, hydrolase, metal-bindi; 1.50A {Methanopyrus kandleri} Back     alignment and structure
>3lqb_A Hatching enzyme, LOC792177 protein; hydrolase, metalloprotease, astacin, metal- protease; 1.10A {Danio rerio} Back     alignment and structure
>2v4b_A Adamts-1; zymogen, protease, hydrolase, metalloprotease, heparin-binding, metalloproteinase, metzincin, glycoprotein metal-binding; 2.00A {Homo sapiens} PDB: 2jih_A 3q2g_A* 3q2h_A* Back     alignment and structure
>4dd8_A Disintegrin and metalloproteinase domain-containi 8; batimastat, inflammation, alpha/beta motif, metalloproteinas allergic asthma, tumorigenesis; HET: BAT; 2.10A {Homo sapiens} Back     alignment and structure
>2ddf_A ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapiens} PDB: 2fv5_A* 3l0v_A* 3kme_A* 3l0t_A* 3kmc_A* 3le9_A* 3lea_A* 3lgp_A* 3o64_A* 3ewj_A* 3edz_A* 3e8r_A* 2fv9_A* 1zxc_A* 2oi0_A* 3b92_A* 2a8h_A* 1bkc_A* 3cki_A 1bkc_I* ... Back     alignment and structure
>1r55_A ADAM 33; metalloprotease, inhibitor, asthma, hydrolase; HET: NAG MAN 097; 1.58A {Homo sapiens} SCOP: d.92.1.9 PDB: 1r54_A* Back     alignment and structure
>2rjp_A Adamts-4; metalloprotease domain, aggrecanase, cleavage on PAIR of basic residues, extracellular matrix, glycoprotein, hydrolase, metal-binding; HET: 886; 2.80A {Homo sapiens} PDB: 3b2z_A Back     alignment and structure
>2rjq_A Adamts-5; metalloprotease domain, aggrecanase, cleavage on PAIR of BAS residues, extracellular matrix, glycoprotein, hydrolase, ME binding; HET: NAG BAT; 2.60A {Homo sapiens} Back     alignment and structure
>2i47_A ADAM 17; TACE-inhibitor complex, hydrolase; HET: INN KGY; 1.90A {Homo sapiens} SCOP: d.92.1.10 PDB: 3g42_A* Back     alignment and structure
>2e3x_A Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Back     alignment and structure
>2dw0_A Catrocollastatin; apoptotic toxin, SVMP, metalloproteinase, apoptosis, toxin; HET: NAG BMA MAN GM6; 2.15A {Crotalus atrox} PDB: 2dw1_A* 2dw2_A* 3dsl_A* 3hdb_A* Back     alignment and structure
>2ero_A VAP-1, vascular apoptosis-inducing protein 1; metalloprotease, disintegrin, calcium-binding, ADAM, SVMP, M protein, toxin; HET: NAG; 2.50A {Crotalus atrox} PDB: 2erp_A* 2erq_A* Back     alignment and structure
>3k7n_A K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A {Naja atra} Back     alignment and structure
>3k7l_A Atragin; SVMP, metalloprotease, hydrolase; HET: NAG; 2.50A {Naja atra} Back     alignment and structure
>3p24_A BFT-3; metzincins, metalloendopeptidase, hydrolase; HET: PG4; 1.80A {Bacteroides fragilis} Back     alignment and structure
>3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} Back     alignment and structure
>2ikb_A Hypothetical protein NMB1012; structural genomics, PSI-2, MCSG, PR structure initiative; 1.70A {Neisseria meningitidis} SCOP: d.2.1.9 PDB: 2is5_A* Back     alignment and structure
>4gwm_A Meprin A subunit beta; mulidomain structure, hydrolase; HET: NAG BMA FUC MAN; 1.85A {Homo sapiens} PDB: 4gwn_A* Back     alignment and structure
>2nr7_A Secretion activator protein, putative; APCC85792, porphyromonas gingivalis W83 structural genomics, PSI-2, protein structure initiative; 1.30A {Porphyromonas gingivalis} SCOP: d.2.1.9 Back     alignment and structure
>1lml_A Leishmanolysin; metalloprotease, glycoprotein; 1.86A {Leishmania major} SCOP: d.92.1.3 Back     alignment and structure
>3e11_A Predicted zincin-like metalloprotease; DUF1025 family protein, zincin-like fold, conserved matrix metalloprotease motif; 1.80A {Acidothermus cellulolyticus 11B} SCOP: d.92.1.17 Back     alignment and structure
>3ujz_A Metalloprotease STCE; mucin-type glycoprotein, hydrolase; 2.50A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 257
d1su3a167 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) 4e-19
d1slma165 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (H 8e-19
d1l6ja177 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (H 2e-18
d1eaka176 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (H 4e-17
d1mmqa_166 d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sap 7e-13
d1kapp2246 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas ae 3e-12
d1hv5a_162 d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus 3e-12
d1hy7a_168 d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo 3e-11
d1i76a_163 d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Hum 2e-09
d1y93a1158 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) 3e-09
d1k7ia2241 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrys 4e-09
d2ovxa1159 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human 4e-09
d1xuca1169 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Huma 6e-09
d1hfca_157 d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Hum 2e-08
d1bqqm_174 d.92.1.11 (M:) Membrane-type matrix metalloprotein 3e-08
d1sata2243 d.92.1.6 (A:4-246) Metalloprotease {Serratia marce 4e-08
d1rm8a_169 d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16 9e-08
d1qiba_161 d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) 1e-06
d1lbua183 a.20.1.1 (A:1-83) Zn2+ DD-carboxypeptidase, N-term 3e-04
d1g9ka2242 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp 7e-04
>d1su3a1 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure

class: All alpha proteins
fold: PGBD-like
superfamily: PGBD-like
family: MMP N-terminal domain
domain: Fibroblast collagenase (MMP-1)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 76.7 bits (189), Expect = 4e-19
 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 5/68 (7%)

Query: 62  KKYLHTLGYLSNHNHNHAAAAADGDYFDENLESAVKTYQRNFNLNPTGHMDLKTVSMMGK 121
           +KYL     L N          +       +   +K  Q  F L  TG  D +T+ +M +
Sbjct: 4   QKYLEKYYNLKNDGRQ-----VEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQ 58

Query: 122 PRCGVPDV 129
           PRCGVPDV
Sbjct: 59  PRCGVPDV 66
>d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1eaka1 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Length = 246 Back     information, alignment and structure
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Length = 162 Back     information, alignment and structure
>d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Length = 158 Back     information, alignment and structure
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Length = 241 Back     information, alignment and structure
>d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Length = 243 Back     information, alignment and structure
>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1lbua1 a.20.1.1 (A:1-83) Zn2+ DD-carboxypeptidase, N-terminal domain {Streptomyces albus G [TaxId: 1962]} Length = 83 Back     information, alignment and structure
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query257
d1slma165 Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro 99.9
d1su3a167 Fibroblast collagenase (MMP-1) {Human (Homo sapien 99.89
d1l6ja177 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 99.89
d1eaka176 Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 99.86
d1mmqa_166 Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9 99.81
d1hv5a_162 Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxI 99.77
d1kapp2246 Metalloprotease {Pseudomonas aeruginosa [TaxId: 28 99.75
d1xuca1169 Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxI 99.74
d1k7ia2241 Metalloprotease {Erwinia chrysanthemi [TaxId: 556] 99.74
d1i76a_163 Neutrophil collagenase (MMP-8) {Human (Homo sapien 99.73
d1hy7a_168 Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro 99.72
d1sata2243 Metalloprotease {Serratia marcescens [TaxId: 615]} 99.71
d1hfca_157 Fibroblast collagenase (MMP-1) {Human (Homo sapien 99.67
d2ovxa1159 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 99.64
d1y93a1158 Macrophage elastase (MMP-12) {Human (Homo sapiens) 99.58
d1qiba_161 Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1rm8a_169 Matrix metalloproteinase-16 (MMP-16) {Human (Homo 99.52
d1bqqm_174 Membrane-type matrix metalloproteinase (CDMT1-MMP) 99.46
d1g9ka2242 Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId 99.41
d1lbua183 Zn2+ DD-carboxypeptidase, N-terminal domain {Strep 99.29
d2bgxa181 Probable N-acetylmuramoyl-L-alanine amidase YbjR, 97.41
d1c7ka_132 Zinc protease {Streptomyces caespitosus [TaxId: 53 96.07
d1asta_200 Astacin {European fresh water crayfish (Astacus as 95.96
d1bswa_197 Snake venom metalloprotease {Five-pace snake (Agki 95.94
d1r55a_203 ADAM33 {Human (Homo sapiens) [TaxId: 9606]} 95.88
d1quaa_197 Snake venom metalloprotease {Chinese five-pace sna 95.8
d2i47a1254 TNF-alpha converting enzyme, TACE, catalytic domai 95.7
d1kufa_201 Snake venom metalloprotease {Taiwan habu (Trimeres 95.69
d1atla_200 Snake venom metalloprotease {Western diamonback ra 95.66
d1nd1a_202 Snake venom metalloprotease {Terciopelo (Bothrops 95.34
d1lmla_ 475 Leishmanolysin {Leishmania major [TaxId: 5664]} 90.84
d3e11a1113 Uncharacterized protein Acel_2062 {Acidothermus ce 85.87
d2ikba1163 Hypothetical protein NMB1012 {Neisseria meningitid 85.03
d2nr7a1192 Putative secretion activator PG0293 {Porphyromonas 82.0
>d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: PGBD-like
superfamily: PGBD-like
family: MMP N-terminal domain
domain: Stromelysin-1 (MMP-3)
species: Human (Homo sapiens), fibroblast [TaxId: 9606]

Probab=99.90  E-value=2e-24  Score=153.24  Aligned_cols=64  Identities=31%  Similarity=0.481  Sum_probs=52.4

Q ss_pred             HHHHHHhcCCCCCCCccccccccCCCcccHHHHHHHHHHHHhcCCCCCCCCChhhhhccCCCccccCCC
Q 043086           61 LKKYLHTLGYLSNHNHNHAAAAADGDYFDENLESAVKTYQRNFNLNPTGHMDLKTVSMMGKPRCGVPDV  129 (257)
Q Consensus        61 ~q~yL~~fGYl~~~~~~~~~~~~~~~~~~~~~~~AIk~FQ~~~gL~~TG~lD~~T~~~M~~PRCGvpD~  129 (257)
                      +|+||++|||++....     .........++++||+.||+|+||++||+||++|+++|.+|||||||+
T Consensus         2 ~~~YL~~fgyl~~~~~-----~~~~~~~~~~l~~Ai~~~Q~f~~L~~TG~lD~~T~~~M~~PRCGvpDv   65 (65)
T d1slma1           2 VQKYLENYYDLKKDVK-----QFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDV   65 (65)
T ss_dssp             HHHHHHHHSCCCCC--------------CHHHHHHHHHHHHHTTCCCCSSCCHHHHHHTTSCBCSSCSS
T ss_pred             HHHHHHHcCCCCCCcc-----cccccccHHHHHHHHHHHHHHcCCCccccCCHHHHHHHCcCCCCCCCC
Confidence            7899999999987632     111223457899999999999999999999999999999999999996
>d1su3a1 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaka1 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Back     information, alignment and structure
>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Back     information, alignment and structure
>d1lbua1 a.20.1.1 (A:1-83) Zn2+ DD-carboxypeptidase, N-terminal domain {Streptomyces albus G [TaxId: 1962]} Back     information, alignment and structure
>d2bgxa1 a.20.1.1 (A:180-260) Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c7ka_ d.92.1.1 (A:) Zinc protease {Streptomyces caespitosus [TaxId: 53502]} Back     information, alignment and structure
>d1asta_ d.92.1.8 (A:) Astacin {European fresh water crayfish (Astacus astacus) [TaxId: 6715]} Back     information, alignment and structure
>d1bswa_ d.92.1.9 (A:) Snake venom metalloprotease {Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId: 36307]} Back     information, alignment and structure
>d1r55a_ d.92.1.9 (A:) ADAM33 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quaa_ d.92.1.9 (A:) Snake venom metalloprotease {Chinese five-pace snake (Agkistrodon acutus), acutolysin C [TaxId: 36307]} Back     information, alignment and structure
>d2i47a1 d.92.1.10 (A:220-473) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kufa_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId: 103944]} Back     information, alignment and structure
>d1atla_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]} Back     information, alignment and structure
>d1nd1a_ d.92.1.9 (A:) Snake venom metalloprotease {Terciopelo (Bothrops asper), bap1 [TaxId: 8722]} Back     information, alignment and structure
>d1lmla_ d.92.1.3 (A:) Leishmanolysin {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d3e11a1 d.92.1.17 (A:1-113) Uncharacterized protein Acel_2062 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d2ikba1 d.2.1.9 (A:1-163) Hypothetical protein NMB1012 {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2nr7a1 d.2.1.9 (A:1-192) Putative secretion activator PG0293 {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure