Citrus Sinensis ID: 043224
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 516 | ||||||
| 224103473 | 591 | predicted protein [Populus trichocarpa] | 0.982 | 0.857 | 0.581 | 1e-176 | |
| 225428572 | 589 | PREDICTED: probable E3 ubiquitin-protein | 0.988 | 0.865 | 0.581 | 1e-176 | |
| 302142421 | 555 | unnamed protein product [Vitis vinifera] | 0.922 | 0.857 | 0.617 | 1e-175 | |
| 449455196 | 589 | PREDICTED: probable E3 ubiquitin-protein | 0.986 | 0.864 | 0.577 | 1e-175 | |
| 225458418 | 564 | PREDICTED: probable E3 ubiquitin-protein | 0.922 | 0.843 | 0.617 | 1e-174 | |
| 356545317 | 580 | PREDICTED: probable E3 ubiquitin-protein | 0.982 | 0.874 | 0.546 | 1e-169 | |
| 356538827 | 580 | PREDICTED: probable E3 ubiquitin-protein | 0.976 | 0.868 | 0.540 | 1e-165 | |
| 356538831 | 595 | PREDICTED: probable E3 ubiquitin-protein | 0.976 | 0.847 | 0.540 | 1e-165 | |
| 255556141 | 592 | Protein ariadne-1, putative [Ricinus com | 0.994 | 0.866 | 0.577 | 1e-165 | |
| 359475257 | 573 | PREDICTED: probable E3 ubiquitin-protein | 0.957 | 0.862 | 0.558 | 1e-164 |
| >gi|224103473|ref|XP_002313070.1| predicted protein [Populus trichocarpa] gi|222849478|gb|EEE87025.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 626 bits (1614), Expect = e-176, Method: Compositional matrix adjust.
Identities = 311/535 (58%), Positives = 389/535 (72%), Gaps = 28/535 (5%)
Query: 2 EDYGNSDDEHQYLDDDE------VDIDDNGYGFEAPATENMARASASSMVIPKESLLAAQ 55
EDYG S++E Y DD D DD+ + P +++ VI KESLLAAQ
Sbjct: 5 EDYGFSEEEDYYYADDGDSHDGLADNDDSALQWAPPK-------GSTTKVITKESLLAAQ 57
Query: 56 MGDLLRVMDLLSLKEKHARTLLIHYRWDVEKVFAVLVEEGKDKLFAQAGVTVVEN-DHQV 114
DL RVMDLLSLKE HARTLLIHYRWDVEK+ AVLVE+GK LF +AGVTVVEN D +V
Sbjct: 58 REDLRRVMDLLSLKEHHARTLLIHYRWDVEKLLAVLVEKGKSCLFTEAGVTVVENVDDEV 117
Query: 115 PLSQCSSTFCCNICCDDVSPQEVTTMDCGHCFCNNCWTEHFIVKINDGQSRRIKCMALKC 174
P S SST C+IC +D + T M+CGHCFCNNCWTEHFI+KIN+GQSRRI+CMA +C
Sbjct: 118 PPSS-SSTITCDICIEDATADNATRMECGHCFCNNCWTEHFIIKINEGQSRRIQCMAHRC 176
Query: 175 NVVCDEAKIRCLVSARDSNIADKFERFLLESYIDDNRRVKWCPSVPHCGNAIQVEADELC 234
+ +CDEA +R LVS R N+A+KF+RFLLESYI+DN+ VKWCPS+PHCG AI+VE DE C
Sbjct: 177 SAICDEAIVRNLVSRRHPNLAEKFDRFLLESYIEDNKMVKWCPSIPHCGKAIRVEEDEFC 236
Query: 235 EVECACGFQFCFSCSSVAHSPCSCLMWELWSKKFEVESLSLNWISSHTKPCPKCCKPIEK 294
EVEC+CG QFCFSC S AHSPCSCLMWE WSKK ES ++NWI+ HTKPCPKC KP+EK
Sbjct: 237 EVECSCGLQFCFSCLSEAHSPCSCLMWERWSKKCHDESETVNWITVHTKPCPKCYKPVEK 296
Query: 295 NGGCNMVRCKCGITFNWISG------------LEYSNG-YIEVSEERPEHGKWRLESYYH 341
NGGCN+V C CG +F W+ G +S G Y E E++ E K L Y H
Sbjct: 297 NGGCNLVSCICGQSFCWVCGGATGRDHTWSRIAGHSCGRYKEDREKQTERAKRDLYRYMH 356
Query: 342 CHKLYKAHTESFRLEYEMKEDIQDKIKILGEKDTSSKDFGWIKDGLNKLFRARRILSFSY 401
H +KAHT+SF+LE ++KE I DK+ + E++ KDF W+ +GLN+LFR+RR+LS+SY
Sbjct: 357 YHNRFKAHTDSFKLESKLKESILDKVSVAEERELRLKDFSWVTNGLNRLFRSRRVLSYSY 416
Query: 402 PFAFYMFADDLLKNEMTREERKIKQNFFEDQQQQFETNIERLSLILEENFEKYSEHQLKD 461
PFAFYMF ++ K+EMT EER+IK+N FEDQQQQ E+N+E+LS+ LEE F+++S+ ++ D
Sbjct: 417 PFAFYMFGEEFFKDEMTDEEREIKKNLFEDQQQQLESNVEKLSMFLEEPFQQFSQDKVMD 476
Query: 462 FRMRVITQSVTADYLCRNLYEWIETDLLGSLKHSVHKIAPFNSAAVEKASKIPYC 516
RMRVI SVT D LC+ +YE IE+DLLGSL H IAP+ S +E+AS++ C
Sbjct: 477 IRMRVINLSVTIDTLCQKMYECIESDLLGSLHLGTHHIAPYKSKGIERASELSSC 531
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225428572|ref|XP_002284665.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI1 isoform 1 [Vitis vinifera] gi|297741410|emb|CBI32541.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302142421|emb|CBI19624.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449455196|ref|XP_004145339.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI1-like [Cucumis sativus] gi|449471519|ref|XP_004153333.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI1-like [Cucumis sativus] gi|449502370|ref|XP_004161621.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225458418|ref|XP_002283665.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356545317|ref|XP_003541090.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356538827|ref|XP_003537902.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI1-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356538831|ref|XP_003537904.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI1-like isoform 3 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255556141|ref|XP_002519105.1| Protein ariadne-1, putative [Ricinus communis] gi|223541768|gb|EEF43316.1| Protein ariadne-1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359475257|ref|XP_003631625.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI1 isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 516 | ||||||
| TAIR|locus:2052920 | 593 | ARI2 "ARIADNE 2" [Arabidopsis | 0.986 | 0.858 | 0.516 | 2.6e-143 | |
| TAIR|locus:2116184 | 597 | ARI1 "ARIADNE 1" [Arabidopsis | 0.988 | 0.854 | 0.495 | 3.7e-142 | |
| TAIR|locus:2089104 | 537 | ARI3 "ARIADNE 3" [Arabidopsis | 0.976 | 0.938 | 0.402 | 1.7e-100 | |
| DICTYBASE|DDB_G0286961 | 520 | rbrA "IBR zinc finger-containi | 0.629 | 0.625 | 0.301 | 4.5e-51 | |
| DICTYBASE|DDB_G0278981 | 563 | DDB_G0278981 "ariadne-2-like p | 0.753 | 0.690 | 0.275 | 1.4e-50 | |
| UNIPROTKB|A2VEA3 | 555 | ARIH1 "E3 ubiquitin-protein li | 0.837 | 0.778 | 0.263 | 4.7e-48 | |
| UNIPROTKB|F1PG97 | 554 | ARIH1 "Uncharacterized protein | 0.835 | 0.777 | 0.265 | 9.8e-48 | |
| TAIR|locus:2065954 | 562 | ARI7 "ARIADNE 7" [Arabidopsis | 0.571 | 0.524 | 0.347 | 3.3e-47 | |
| TAIR|locus:2045223 | 514 | ARI10 "ARIADNE 10" [Arabidopsi | 0.777 | 0.780 | 0.292 | 3.3e-47 | |
| MGI|MGI:1344363 | 555 | Arih1 "ariadne ubiquitin-conju | 0.837 | 0.778 | 0.263 | 4.2e-47 |
| TAIR|locus:2052920 ARI2 "ARIADNE 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1401 (498.2 bits), Expect = 2.6e-143, P = 2.6e-143
Identities = 271/525 (51%), Positives = 355/525 (67%)
Query: 1 MEDYGNSDDEHQYLDDDEVDIDDNGYGFEAPATENMARASASSMVIPKESLLAAQMGDLL 60
M+D + ++E Y D+ + NG + + ++ S + VI KESLLAAQ DL
Sbjct: 1 MDDNLSGEEEDYYYSSDQESL--NGIDNDESVSIPVSSRSNTVKVITKESLLAAQREDLR 58
Query: 61 RVMDLLSLKEKHARTLLIHYRWDVEKVFAVLVEEGKDKLFAQAGVTVVENDH-QVPLSQC 119
RVM+LLS+KE HARTLLIHYRWDVEK+FAVLVE+GKD LF+ AGVT++EN +S
Sbjct: 59 RVMELLSVKEHHARTLLIHYRWDVEKLFAVLVEKGKDSLFSGAGVTLLENQSCDSSVSGS 118
Query: 120 SSTFCCNICCDDVSPQEVTTMDCGHCFCNNCWTEHFIVKINDGQSRRIKCMALKCNVVCD 179
SS C+IC +DV ++T MDCGH FCNNCWT HF VKIN+GQS+RI CMA KCN +CD
Sbjct: 119 SSMMSCDICVEDVPGYQLTRMDCGHSFCNNCWTGHFTVKINEGQSKRIICMAHKCNAICD 178
Query: 180 EAKIRCLVSARDSNIADKFERFLLESYIDDNRRVKWCPSVPHCGNAIQVEADELCEVECA 239
E +R LVS ++A+KF+RFLLESYI+DN+ VKWCPS PHCGNAI+VE DELCEVEC+
Sbjct: 179 EDVVRALVSKSQPDLAEKFDRFLLESYIEDNKMVKWCPSTPHCGNAIRVEDDELCEVECS 238
Query: 240 CGFQFCFSCSSVAHSPCSCLMWELWSKKFEVESLSLNWISSHTXXXXXXXXXIEKNGGCN 299
CG QFCFSCSS AHSPCSC+MWELW KK ES ++NWI+ HT +EKNGGCN
Sbjct: 239 CGLQFCFSCSSQAHSPCSCVMWELWRKKCFDESETVNWITVHTKPCPKCHKPVEKNGGCN 298
Query: 300 MVRCKCGITFNWISGLE------------YSNG-YIEVSEERPEHGKWRLESYYHCHKLY 346
+V C C +F W+ G +S G + E E++ E K L+ Y H H Y
Sbjct: 299 LVTCLCRQSFCWLCGEATGRDHTWARISGHSCGRFQEDKEKQMERAKRDLKRYMHYHNRY 358
Query: 347 KAHTESFRLEYEMKEDIQDKIKILGEKDTSSKDFGWIKDGLNKLFRARRILSFSYPFAFY 406
KAH +S +LE ++ +I K+ I +++ KDF W +GL++LFR+RR+LS+SYPFAFY
Sbjct: 359 KAHIDSSKLEAKLSNNISKKVSISEKRELQLKDFSWATNGLHRLFRSRRVLSYSYPFAFY 418
Query: 407 MFADDLLKNEMTREERKIKXXXXXXXXXXXXTNIERLSLILEENFEKYSEHQLKDFRMRV 466
MF D+L K+EM+ EER+IK N+E+LS LEE F+++++ ++ R++V
Sbjct: 419 MFGDELFKDEMSSEEREIKQNLFEDQQQQLEANVEKLSKFLEEPFDQFADDKVMQIRIQV 478
Query: 467 ITQSVTADYLCRNLYEWIETDLLGSLKHSVHKIAPFNSAAVEKAS 511
I SV D LC N+YE IE DLLGSL+ +H I P+ S +E+AS
Sbjct: 479 INLSVAVDTLCENMYECIENDLLGSLQLGIHNITPYRSNGIERAS 523
|
|
| TAIR|locus:2116184 ARI1 "ARIADNE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089104 ARI3 "ARIADNE 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0286961 rbrA "IBR zinc finger-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0278981 DDB_G0278981 "ariadne-2-like protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A2VEA3 ARIH1 "E3 ubiquitin-protein ligase ARIH1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PG97 ARIH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2065954 ARI7 "ARIADNE 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2045223 ARI10 "ARIADNE 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1344363 Arih1 "ariadne ubiquitin-conjugating enzyme E2 binding protein homolog 1 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pg.C_LG_IX0532 | hypothetical protein (592 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 516 | |||
| smart00647 | 64 | smart00647, IBR, In Between Ring fingers | 2e-14 | |
| pfam01485 | 63 | pfam01485, IBR, IBR domain | 5e-11 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 6e-04 |
| >gnl|CDD|214763 smart00647, IBR, In Between Ring fingers | Back alignment and domain information |
|---|
Score = 67.4 bits (165), Expect = 2e-14
Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 3/65 (4%)
Query: 196 DKFERFLLESYIDDNRRVKWCPSVPHCGNAIQVEADELC-EVEC-ACGFQFCFSCSSVAH 253
+K+ER LLESY++ N +KWCP+ P C AI V +E C V C CGF FCF C H
Sbjct: 1 EKYERLLLESYVESNPDLKWCPA-PDCSAAIIVTEEEGCNRVTCPKCGFSFCFRCKVPWH 59
Query: 254 SPCSC 258
SP SC
Sbjct: 60 SPVSC 64
|
the domains occurs between pairs og RING fingers. Length = 64 |
| >gnl|CDD|216524 pfam01485, IBR, IBR domain | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 516 | |||
| KOG1815 | 444 | consensus Predicted E3 ubiquitin ligase [Posttrans | 100.0 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 100.0 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 100.0 | |
| KOG0006 | 446 | consensus E3 ubiquitin-protein ligase (Parkin prot | 99.93 | |
| smart00647 | 64 | IBR In Between Ring fingers. the domains occurs be | 99.38 | |
| PF01485 | 64 | IBR: IBR domain; InterPro: IPR002867 Zinc finger ( | 99.26 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.3 | |
| smart00647 | 64 | IBR In Between Ring fingers. the domains occurs be | 98.18 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.12 | |
| PF01485 | 64 | IBR: IBR domain; InterPro: IPR002867 Zinc finger ( | 98.1 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.07 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.01 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.93 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 97.81 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 97.77 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 97.72 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 97.69 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 97.66 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.48 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 97.4 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 97.38 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 97.26 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 97.18 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.04 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 96.97 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.85 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 96.83 | |
| PF14555 | 43 | UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A | 96.52 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.35 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 96.34 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 96.13 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 96.07 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.06 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 95.96 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.72 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 95.54 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.18 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 95.13 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 95.06 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 95.01 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 94.69 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 94.64 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.58 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 93.83 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 93.7 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 93.68 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.15 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 92.46 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.44 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 92.35 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.23 | |
| KOG0006 | 446 | consensus E3 ubiquitin-protein ligase (Parkin prot | 91.89 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 91.77 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.72 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 90.88 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 90.71 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 90.33 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 90.24 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 89.81 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 89.56 | |
| PRK00420 | 112 | hypothetical protein; Validated | 88.61 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 88.28 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.09 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 87.89 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 87.54 | |
| PHA00626 | 59 | hypothetical protein | 87.52 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.46 | |
| smart00661 | 52 | RPOL9 RNA polymerase subunit 9. | 87.34 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 87.02 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 86.76 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 86.35 | |
| KOG1815 | 444 | consensus Predicted E3 ubiquitin ligase [Posttrans | 86.03 | |
| PRK14559 | 645 | putative protein serine/threonine phosphatase; Pro | 85.91 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 85.79 | |
| PRK00432 | 50 | 30S ribosomal protein S27ae; Validated | 85.73 | |
| PF14952 | 44 | zf-tcix: Putative treble-clef, zinc-finger, Zn-bin | 83.58 | |
| PF00627 | 37 | UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma | 83.01 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.88 | |
| PF09297 | 32 | zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do | 82.68 | |
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 82.3 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.03 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 82.0 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 81.08 |
| >KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.6e-74 Score=614.04 Aligned_cols=421 Identities=33% Similarity=0.653 Sum_probs=380.2
Q ss_pred cccCHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHhCCChHHHHHHHhhhChhHHHHHhCcccccCCCCCCCCCCCCcc
Q 043224 44 MVIPKESLLAAQMGDLLRVMDLLSLKEKHARTLLIHYRWDVEKVFAVLVEEGKDKLFAQAGVTVVENDHQVPLSQCSSTF 123 (516)
Q Consensus 44 ~vlt~~~i~~~~~~~i~~v~~~l~i~~~~a~~LL~~~~W~~~~l~e~~~e~~~~~~~~~~gl~~~~~~~~~~~~~~~~~~ 123 (516)
.|+|.+++...|.++|.+|+++|.++..+|++||.||.|+.+++++.|+ .+++.++..+|+.... ......
T Consensus 1 ~vl~~~~~~~~~~~~i~~~~~~ls~~~~~~~~ll~~~~W~~~kl~~~~~-~~~~~~~~~~g~~~~~--------~~~~~~ 71 (444)
T KOG1815|consen 1 EVLTPDDIAALMREDIIEVSDILSLSHAVARILLAHFCWNVEKLLEEWV-EDEETGCFFVGLLLWP--------KKKGDV 71 (444)
T ss_pred CCCchHhhhHHhHhhHHHHHHhhcCCHHHHHHHHHhcCcchHHHHHHHH-hcCcchhhhccccccC--------CCCccc
Confidence 3789999999999999999999999999999999999999999999999 5678888888876543 123568
Q ss_pred cccccccccCCCCeeecCCCCcccHHHHHHHHHhhhhcCCcccccccccccccccCHHHHHHhhCCCChHHHHHHHHHHH
Q 043224 124 CCNICCDDVSPQEVTTMDCGHCFCNNCWTEHFIVKINDGQSRRIKCMALKCNVVCDEAKIRCLVSARDSNIADKFERFLL 203 (516)
Q Consensus 124 ~C~IC~e~~~~~~~~~l~CgH~fC~~C~~~yl~~~I~~g~~~~i~CP~~~C~~~i~~~~i~~ll~~~~~e~~~~y~~~~~ 203 (516)
.|.||++.++. .+..+.|||.||..||..||..+|.+|....|+||.++|...++.++|..+++. ++...+|.++++
T Consensus 72 ~c~ic~~~~~~-~~~~~~c~H~~c~~cw~~yl~~kI~~~~~~~i~cp~~~C~a~v~~~~i~~~~s~--~~~~~ky~~~i~ 148 (444)
T KOG1815|consen 72 QCGICVESYDG-EIIGLGCGHPFCPPCWTGYLGTKIHEGEEAKIKCPAHGCPALVGEDTVEKLVSD--KEDKEKYQRYIL 148 (444)
T ss_pred cCCcccCCCcc-hhhhcCCCcHHHHHHHHHHhhheeeccccccccCCCCCccccCCCceeeeecCC--HHHHHHHHHHHH
Confidence 99999999865 788889999999999999999999998755599999999999999999999983 368999999999
Q ss_pred HHhhhcCCCcccCCCCCCCCceEeecCCCcceeeccCCcccccccccccCCCCCchhHHHHhHHhHHHHHHHHHHhcCcc
Q 043224 204 ESYIDDNRRVKWCPSVPHCGNAIQVEADELCEVECACGFQFCFSCSSVAHSPCSCLMWELWSKKFEVESLSLNWISSHTK 283 (516)
Q Consensus 204 ~~~v~~~~~~~~CP~~p~C~~~i~~~~~~~~~v~C~Cg~~fC~~C~~~~H~p~~C~~~~~w~~k~~~e~~~~~wi~~ntK 283 (516)
++||+.+..++|||+ |+|++++.........|.|.||+.|||+|+.+||.|.+|..+..|+++..+++++.+||..|||
T Consensus 149 ~syve~~~~lkwCP~-~~C~~av~~~~~~~~~v~C~~g~~FC~~C~~~~H~p~~C~~~~~wl~k~~~~se~~~wi~~ntk 227 (444)
T KOG1815|consen 149 RSYVEDNVPLKWCPA-PGCGLAVKFGSLESVEVDCGCGHEFCFACGEESHSPVSCPGAKKWLKKCRDDSETINWILANTK 227 (444)
T ss_pred HHHHhcCCccccCCC-CCCCceeeccCCCccceeCCCCchhHhhccccccCCCcccchHHHHHhhhhhhhhhhhhhccCc
Confidence 999999999999995 9999999975555667999999999999999999999999999999999999999999999999
Q ss_pred cCCCCCccceecCCCCceee-c--cccccccccccccc---------c-cccCCCCcc-hhhhhhhhhhhhhhHHHHHhh
Q 043224 284 PCPKCCKPIEKNGGCNMVRC-K--CGITFNWISGLEYS---------N-GYIEVSEER-PEHGKWRLESYYHCHKLYKAH 349 (516)
Q Consensus 284 ~CPkC~~~IEKn~GCnhMtC-~--C~~~FCw~C~~~w~---------C-~y~~~~~~~-~~~~~~~l~ry~hy~~r~~~h 349 (516)
+||+|.++|||++|||||+| . |+++|||+|++.|. | +|+...... ...++..|.||.|||+||++|
T Consensus 228 ~CP~c~~~iek~~gc~~~~~~~~~c~~~FCw~Cl~~~~~h~~~~~~~c~~~~~~~~~~~~~~a~~~l~r~~~~~~~~~~~ 307 (444)
T KOG1815|consen 228 ECPKCKVPIEKDGGCNHMTCKSASCKHEFCWVCLASLSDHGSSTGYSCNRYVDGKSKSARSKARRSLKRYTHYYNRWMEH 307 (444)
T ss_pred cCCCcccchhccCCccccccccCCcCCeeceeeecccccccccceeeeeeeechhhhhHHHHHHHHHHHHHHHHhhHHhh
Confidence 99999999999999999999 4 99999999999986 8 998766544 778888999999999999999
Q ss_pred hHHHHHHHHHHHHHHHH-HHHhh-ccCCCCchhhHHHHHHHHHHHHHHHHhhhhhhhhcccccchhhhhhcHHHHHHHHH
Q 043224 350 TESFRLEYEMKEDIQDK-IKILG-EKDTSSKDFGWIKDGLNKLFRARRILSFSYPFAFYMFADDLLKNEMTREERKIKQN 427 (516)
Q Consensus 350 ~~s~k~e~~l~~~~~~k-~~~~~-~~~~~~~~~~fl~~a~~~l~~~R~~L~~sY~~~yyl~~~~~~~~~~~~~~~~~~~~ 427 (516)
+.|++++.++...++++ +..+. ...+++++++|+.+|+.+|++||+||+|||+||||+.. +++++
T Consensus 308 q~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~e~r~~l~~s~~~~~~~~~-------------~~~~~ 374 (444)
T KOG1815|consen 308 QVSLKLEGKLLSKVEEVKKPKLSDSLSLSWIDVQFLRDAGDVLVECRRTLKWTYAYAYYLSE-------------NNKRN 374 (444)
T ss_pred hhhhhhhhhhHHHHHHHhhhhhhcccCeeeeeeeeechhHHHHHhhhhhhhhhhhhhhhhcc-------------cchhh
Confidence 99999998877777543 33333 33467999999999999999999999999999999973 24568
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHhhccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhh
Q 043224 428 FFEDQQQQFETNIERLSLILEENFEKYSEHQLKDFRMRVITQSVTADYLCRNLYEWIETDLLG 490 (516)
Q Consensus 428 lFe~~Q~~le~~~E~Ls~~le~~~~~~~~~~~~~~r~~~~~~t~~~~~~~~~l~~~~e~~l~~ 490 (516)
+||++|.+||..+|+||..+++++...+.+++..+|+++.++|.++++++++++..+++||..
T Consensus 375 ~fe~~q~~~~~~~e~ls~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ 437 (444)
T KOG1815|consen 375 LFEDNQTDLESAVEPLSSCLEESLKDISSETLAEFKQKLTDLTSYVRNRFENLLKHLEEGLED 437 (444)
T ss_pred hhHHHHHHHhhhhhhhHHHhccccccCCcccHHHHHhhccccchhhhhHHHHHHHHHHhcccc
Confidence 999999999999999999999987777778899999999999999999999999999999874
|
|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00647 IBR In Between Ring fingers | Back alignment and domain information |
|---|
| >PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >smart00647 IBR In Between Ring fingers | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00420 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PHA00626 hypothetical protein | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00661 RPOL9 RNA polymerase subunit 9 | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14559 putative protein serine/threonine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PRK00432 30S ribosomal protein S27ae; Validated | Back alignment and domain information |
|---|
| >PF14952 zf-tcix: Putative treble-clef, zinc-finger, Zn-binding | Back alignment and domain information |
|---|
| >PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 516 | |||
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 3e-19 | |
| 1wd2_A | 60 | Ariadne-1 protein homolog; ring, IBR, triad, zinc | 2e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 | |
| 2ct7_A | 86 | Ring finger protein 31; IBR, structural genomics, | 3e-06 | |
| 2jmo_A | 80 | Parkin; IBR, E3 ligase, zinc binding domain, RBR; | 2e-04 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 3e-04 |
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
Score = 81.8 bits (202), Expect = 3e-19
Identities = 21/94 (22%), Positives = 40/94 (42%), Gaps = 6/94 (6%)
Query: 120 SSTFCCNICCDDVSPQEVTTM-DCGHCFCNNCWTEHFIVKINDGQSRRIKCMALKCN--V 176
S + C +C + +++TT+ C FC C ++ + I +G I C C
Sbjct: 3 SGSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQG 62
Query: 177 VCDEAKIRCLVSARDSNIADKFERFLLESYIDDN 210
E +I C+V+A I ++++ E +
Sbjct: 63 HLQENEIECMVAA---EIMQRYKKLQFERSGPSS 93
|
| >1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 60 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Length = 86 | Back alignment and structure |
|---|
| >2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 516 | |||
| 1wd2_A | 60 | Ariadne-1 protein homolog; ring, IBR, triad, zinc | 99.75 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 99.65 | |
| 2ct7_A | 86 | Ring finger protein 31; IBR, structural genomics, | 99.39 | |
| 2jmo_A | 80 | Parkin; IBR, E3 ligase, zinc binding domain, RBR; | 99.18 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.03 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.56 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.31 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.29 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.26 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.21 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.18 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.16 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.16 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.16 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.14 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.13 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.12 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.09 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.08 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.04 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.02 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.02 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.02 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 98.01 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.01 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.01 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.01 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.01 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 97.99 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 97.99 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 97.96 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 97.95 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 97.94 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 97.94 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 97.93 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 97.93 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 97.9 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 97.82 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 97.77 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 97.77 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 97.76 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 97.76 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 97.75 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 97.75 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 97.73 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 97.73 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 97.7 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 97.65 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 97.64 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 97.62 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 97.58 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 97.54 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 97.5 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 97.48 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 97.44 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 97.31 | |
| 2ct7_A | 86 | Ring finger protein 31; IBR, structural genomics, | 97.31 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 97.27 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 97.16 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 97.1 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 97.09 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 97.01 | |
| 2jmo_A | 80 | Parkin; IBR, E3 ligase, zinc binding domain, RBR; | 97.0 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 96.92 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 96.89 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 96.85 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 96.82 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 96.74 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 96.67 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 95.96 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 95.83 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 95.74 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 95.64 | |
| 1v92_A | 46 | NSFL1 cofactor P47; 3-helix bundle, recombination; | 95.22 | |
| 1wd2_A | 60 | Ariadne-1 protein homolog; ring, IBR, triad, zinc | 94.32 | |
| 2dal_A | 62 | Protein KIAA0794; FAS associted factor 1, UBA-like | 93.9 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 93.48 | |
| 2dam_A | 67 | ETEA protein; KIAA0887, UBA-like domain, structura | 92.56 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 92.54 | |
| 2di0_A | 71 | Activating signal cointegrator 1 complex subunit 2 | 92.32 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 92.1 | |
| 1wj7_A | 104 | Hypothetical protein (RSGI RUH-015); UBA domain, u | 91.8 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 91.32 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 91.1 | |
| 3e21_A | 45 | HFAF1, FAS-associated factor 1; UBA, alternative s | 90.59 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 90.17 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 90.05 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 89.92 | |
| 2dzl_A | 66 | Protein FAM100B; UBA-like domain, structural genom | 89.42 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 89.38 | |
| 1z96_A | 40 | DNA-damage, UBA-domain protein MUD1; ubiquitin, th | 89.03 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 88.61 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 88.5 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 88.49 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 88.25 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 87.92 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 87.7 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 87.47 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 85.54 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 85.51 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 85.35 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 84.9 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 84.32 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 84.28 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 83.96 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 83.91 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 83.52 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 83.3 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 82.72 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 82.52 | |
| 1ify_A | 49 | HHR23A, UV excision repair protein RAD23 homolog A | 82.43 | |
| 1pft_A | 50 | TFIIB, PFTFIIBN; N-terminal domain, transcription | 82.37 | |
| 3j20_Y | 50 | 30S ribosomal protein S27AE; archaea, archaeal, KI | 82.25 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 82.2 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 82.16 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 82.1 | |
| 2k4x_A | 55 | 30S ribosomal protein S27AE; metal-binding, ribonu | 81.9 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 81.62 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 81.41 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 81.41 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 81.26 | |
| 1vq8_Z | 83 | 50S ribosomal protein L37AE; ribosome 50S, protein | 80.65 |
| >1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
Probab=99.75 E-value=1.4e-19 Score=138.14 Aligned_cols=42 Identities=45% Similarity=1.085 Sum_probs=40.5
Q ss_pred HHhcCcccCCCCCccceecCCCCceee-c--cccccccccccccc
Q 043224 277 WISSHTKPCPKCCKPIEKNGGCNMVRC-K--CGITFNWISGLEYS 318 (516)
Q Consensus 277 wi~~ntK~CPkC~~~IEKn~GCnhMtC-~--C~~~FCw~C~~~w~ 318 (516)
||.++||+||+|+++|||++|||||+| . |+++|||+|+++|+
T Consensus 1 wi~~~~k~CP~C~~~Iek~~GCnhmtC~~~~C~~~FCw~C~~~~~ 45 (60)
T 1wd2_A 1 WIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWE 45 (60)
T ss_dssp CCCCCCCCCTTTCCCCSSCCSCCSSSCCSSGGGSCCSSSSCSCSG
T ss_pred CccccceECcCCCCeeEeCCCCCcEEECCCCcCCEEeeCcCCCcc
Confidence 788999999999999999999999999 4 99999999999997
|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 | Back alignment and structure |
|---|
| >2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 | Back alignment and structure |
|---|
| >1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2di0_A Activating signal cointegrator 1 complex subunit 2; ASCC2, CUE domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 516 | ||||
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 1e-13 | |
| d2ct7a1 | 73 | g.44.1.4 (A:8-80) Ring finger protein 31 {Human (H | 8e-10 | |
| d2ct7a1 | 73 | g.44.1.4 (A:8-80) Ring finger protein 31 {Human (H | 4e-04 | |
| d1wd2a_ | 60 | g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Ho | 1e-09 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 0.001 |
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: UbcM4-interacting protein 4 (KIAA0161) species: Human (Homo sapiens) [TaxId: 9606]
Score = 64.7 bits (157), Expect = 1e-13
Identities = 20/91 (21%), Positives = 38/91 (41%), Gaps = 6/91 (6%)
Query: 120 SSTFCCNICCDDVSPQEVTTM-DCGHCFCNNCWTEHFIVKINDGQSRRIKCMALKC--NV 176
S + C +C + +++TT+ C FC C ++ + I +G I C C
Sbjct: 3 SGSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQG 62
Query: 177 VCDEAKIRCLVSARDSNIADKFERFLLESYI 207
E +I C+V + I ++++ E
Sbjct: 63 HLQENEIECMV---AAEIMQRYKKLQFERSG 90
|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 516 | |||
| d1wd2a_ | 60 | Ariadne-1 protein homolog {Human (Homo sapiens) [T | 99.76 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 99.61 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 99.26 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 98.94 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.24 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.15 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.08 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.04 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.03 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.02 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 97.95 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 97.93 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 97.91 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 97.79 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 97.71 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 97.63 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 97.61 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 96.95 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 96.71 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 96.21 | |
| d1v92a_ | 46 | NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { | 96.12 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 94.57 | |
| d1wd2a_ | 60 | Ariadne-1 protein homolog {Human (Homo sapiens) [T | 94.03 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 93.33 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 93.2 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 92.55 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 92.45 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 88.29 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 87.57 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 87.22 | |
| d2di0a1 | 63 | Activating signal cointegrator 1 complex subunit 2 | 86.98 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 86.86 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 86.24 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 83.41 | |
| d1wffa_ | 85 | ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus | 82.35 | |
| d2k4xa1 | 55 | Ribosomal protein S27ae {Thermoplasma acidophilum | 81.57 |
| >d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: Ariadne-1 protein homolog species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.76 E-value=3.9e-20 Score=139.25 Aligned_cols=42 Identities=45% Similarity=1.100 Sum_probs=40.4
Q ss_pred HHhcCcccCCCCCccceecCCCCceeec---cccccccccccccc
Q 043224 277 WISSHTKPCPKCCKPIEKNGGCNMVRCK---CGITFNWISGLEYS 318 (516)
Q Consensus 277 wi~~ntK~CPkC~~~IEKn~GCnhMtC~---C~~~FCw~C~~~w~ 318 (516)
||..|||+||+|+++|||++|||||+|+ ||++|||+|+++|.
T Consensus 1 wi~~ntK~CP~C~~~ieK~~GCnhM~C~~~~C~~~fCw~C~~~~~ 45 (60)
T d1wd2a_ 1 WIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWE 45 (60)
T ss_dssp CCCCCCCCCTTTCCCCSSCCSCCSSSCCSSGGGSCCSSSSCSCSG
T ss_pred CchhcCcCCCCCCCeEEECCCCCCeEeCCCCCCCeEECCCCCccc
Confidence 7889999999999999999999999994 99999999999996
|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2di0a1 a.5.2.4 (A:8-70) Activating signal cointegrator 1 complex subunit 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|