Citrus Sinensis ID: 043238

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420------
MEASALSRIGLAGLAVMGQKLALNVPEKGFQISVYNRTTSKVDETLDRAHREDRPLHSQGLRPLHPTPQIHHHRPLGETSGTSTPSAVSMKPVRRVCFISAWGSPGARKARHGPSLMPGGSFEAYNNIRDILQRVAAHVDDGPCITYIGEGGSGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLVQITADIFKVKDEYGEGELVDKILDKTGMKGTRKWTIQQAAELLVAALTIAASLDCRYLSGLKEERQEAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQALIKNAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHAYERIDRPGSFHTEWTKLARQTGAGVGAFNSAAAFCYLFV
ccccccccEEEEHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccHHHcccccccHHcHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccEEccccccccccccccccccccccccccccccccccc
cccHccEcEEEEcccHHHHHHHHHHHHccccEEEEccccHHHHHHHHccccccccEEcccHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHcccEEEEEEEEcHHHHHHHccEEEEEEccccHHHHHHHHHHHccEccccEcccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccEHHHHHHHHHHHcEccccccccHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccHHHHHHccccccccEcHHHHHHHHHHHccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccEcccccccccEEccccccccccccHHHHHHHHHHHHHcc
MEASALSRIGLAGLAVMGQKlalnvpekgfQISVYNrttskvdetldrahredrplhsqglrplhptpqihhhrplgetsgtstpsavsmkpvrRVCFIsawgspgarkarhgpslmpggsfeaYNNIRDILQRVAAhvddgpcityigeggsgnFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLVQITADIFKvkdeygegelvdkildktgmkgtRKWTIQQAAELLVAALTIAASLDCRYLSGLKEERQEAAKVLKEaglkdevqnvgvhvdkkrLIDDVRQALIKNAyqrnpnlaslvvdpEFAREMVQRQAAWRRVVGLAISagistpgmcaslsyfDTYRRARLPANLVQAQRDLFGahayeridrpgsfhtEWTKLARqtgagvgaFNSAAAFCYLFV
measalsrIGLAGLAVMGQKLALNVPEKGFQISVYNRTTSKVDETLDRAHredrplhsqglrplhptpqihhhrplgetsgtstpsavsmKPVRRVCFISAWGSPGARKARHGPSLMPGGSFEAYNNIRDILQRVAAHVDDGPCITYIGEGGSGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLVQITADIFKvkdeygegelvdkildktgMKGTRKWTIQQAAELLVAALTIAASLDCRYLSGLKEERQEAAKVLkeaglkdevqnvgvhvdkkrLIDDVRQALIknayqrnpnlaSLVVDPEFAREMVQRQAAWRRVVGLAisagistpgmCASLSYFDTYRRARLPANLVQAQRDLFGAHAYERIDRPGSFHTEWTKLARQTGAGVGAFNSAAAFCYLFV
MEASALSRIGLAGLAVMGQKLALNVPEKGFQISVYNRTTSKVDETLDRAHREDRPLHSQGLRPLHPTPQIHHHRPLGETSGTSTPSAVSMKPVRRVCFISAWGSPGARKARHGPSLMPGGSFEAYNNIRDILQRVAAHVDDGPCITYIGEGGSGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLVQITADIFKVKDEYGEGELVDKILDKTGMKGTRKWTIQQAAELLVAALTIAASLDCRYLSGLKEERQEAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQALIKNAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHAYERIDRPGSFHTEWTKLARQTGAGVGAFNSAAAFCYLFV
*******RIGLAGLAVMGQKLALNVPEKGFQISVYNR*******************************************************VRRVCFISAWGS***************GSFEAYNNIRDILQRVAAHVDDGPCITYIGEGGSGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLVQITADIFKVKDEYGEGELVDKILDKTGMKGTRKWTIQQAAELLVAALTIAASLDCRYLSGLKE*****AKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQALIKNAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHAYERIDRPGSFHTEWTKLARQTGAGVGAFNSAAAFCYLF*
****ALS**GLAGLAVMGQKLALNVPEKGFQISVYNRTTSKVDETLDRAHREDRPLHSQGLRPLHPTPQIHHHRPLGETSGTSTPSAVSMKPVRRVCFISAWGSPGARKARHGPSLMPGGSFEAYNNIRDILQRVAAHVDDGPCITYIGEGGSGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLVQITADIFKVKDEYGEGELVDKILDKTGMKGTRKWTIQQAAELLVAALTIAASLDCRYLSGLKEERQEAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQALIKNAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHAYERIDRPGSFHTEWTK************NSAAAFCYLFV
MEASALSRIGLAGLAVMGQKLALNVPEKGFQISVYNRTTSKVDETLDRAHREDRPLHSQGLRPLHPTPQIHHHRPL*************MKPVRRVCFISAWGS*********PSLMPGGSFEAYNNIRDILQRVAAHVDDGPCITYIGEGGSGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLVQITADIFKVKDEYGEGELVDKILDKTGMKGTRKWTIQQAAELLVAALTIAASLDCRYLSGLKEERQEAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQALIKNAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHAYERIDRPGSFHTEWTKLARQTGAGVGAFNSAAAFCYLFV
****ALSRIGLAGLAVMGQKLALNVPEKGFQISVYNRTTSKVDETLDRAHREDRPLHSQGLRPLHPTPQIHHHRPLGETSGTSTPSAVSMKPVRRVCFISAWGSPGARKARHGPSLMPGGSFEAYNNIRDILQRVAAHVDDGPCITYIGEGGSGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLVQITADIFKVKDEYGEGELVDKILDKTGMKGTRKWTIQQAAELLVAALTIAASLDCRYLSGLKEERQEAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQALIKNAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHAYERIDRPGSFHTEWTKLARQTGAGVGAFNSAAAFCYLFV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHi
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEASALSRIGLAGLAVMGQKLALNVPEKGFQISVYNRTTSKVDETLDRAHREDRPLHSQGLRPLHPTPQIHHHRPLGETSGTSTPSAVSMKPVRRVCFISAWGSPGARKARHGPSLMPGGSFEAYNNIRDILQRVAAHVDDGPCITYIGEGGSGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLVQITADIFKVKDEYGEGELVDKILDKTGMKGTRKWTIQQAAELLVAALTIAASLDCRYLSGLKEERQEAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQALIKNAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHAYERIDRPGSFHTEWTKLARQTGAGVGAFNSAAAFCYLFV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query426 2.2.26 [Sep-21-2011]
Q9SH69487 6-phosphogluconate dehydr yes no 0.957 0.837 0.625 1e-166
Q9FFR3487 6-phosphogluconate dehydr no no 0.955 0.835 0.636 1e-166
Q94KU2537 6-phosphogluconate dehydr N/A no 0.962 0.763 0.610 1e-158
Q94KU1483 6-phosphogluconate dehydr N/A no 0.929 0.819 0.558 1e-141
Q9FWA3486 6-phosphogluconate dehydr no no 0.934 0.818 0.546 1e-135
Q2R480508 6-phosphogluconate dehydr yes no 0.938 0.787 0.543 1e-135
Q9LI00480 6-phosphogluconate dehydr no no 0.929 0.825 0.548 1e-133
P21577471 6-phosphogluconate dehydr yes no 0.913 0.825 0.417 1e-90
P80859469 6-phosphogluconate dehydr yes no 0.913 0.829 0.402 9e-87
Q9CHU6472 6-phosphogluconate dehydr yes no 0.913 0.824 0.378 2e-83
>sp|Q9SH69|6PGD1_ARATH 6-phosphogluconate dehydrogenase, decarboxylating 1, chloroplastic OS=Arabidopsis thaliana GN=At1g64190 PE=2 SV=1 Back     alignment and function desciption
 Score =  583 bits (1504), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 304/486 (62%), Positives = 345/486 (70%), Gaps = 78/486 (16%)

Query: 1   MEASALSRIGLAGLAVMGQKLALNVPEKGFQISVYNRTTSKVDETLDRAHREDRPLHSQG 60
           ME++ALSRIGLAGLAVMGQ LALN+ EKGF ISVYNRTTSKVDETLDRA  E     S  
Sbjct: 1   MESAALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQ 60

Query: 61  LRPLHPTPQIHHHRPL------------------------------GETSGTSTPSAVSM 90
             P      I   R L                              G     +T   +S 
Sbjct: 61  YSPRDFVLSIQRPRSLIILVKAGAPVDQTIDAFSEYMEPGDCIIDGGNEWYQNTERRISE 120

Query: 91  KPVRRVCFISAWGSPGARKARHGPSLMPGGSFEAYNNIRDILQRVAAHVDDGPCITYIGE 150
              + + ++    S G   AR+GPSLMPGGSF+AY+NI+DIL++VAA V+DGPC+TYIGE
Sbjct: 121 AEQKGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYDNIKDILEKVAAQVEDGPCVTYIGE 180

Query: 151 GGSGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLVQIT 210
           GGSGNFVKMVHNGIEYGDMQLIS+AYDVLK+VGG+SN ELAEIF EWN GELESFLV+IT
Sbjct: 181 GGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNEELAEIFTEWNSGELESFLVEIT 240

Query: 211 ADIFKVKDEYGEGELVDKILDKTGMKGTRKWTIQQAAELLVAALTIAASLDCRYLSGLKE 270
           +DIF+VKDE+G+GELVDKILDKTGMKGT KWT+QQAAEL VAA TIAASLDCRYLSGLK+
Sbjct: 241 SDIFRVKDEFGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKD 300

Query: 271 ERQEAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQAL---------------------- 308
           ER+ AAKVL+EAGLK+E+ +    +DKKRL+DDVRQAL                      
Sbjct: 301 ERENAAKVLREAGLKEEIGSASSGIDKKRLVDDVRQALYASKICSYAQGMNLLRAKSLEK 360

Query: 309 --------------------------IKNAYQRNPNLASLVVDPEFAREMVQRQAAWRRV 342
                                     IK AYQRNP+LASLVVDPEFA+EMVQRQAAWRRV
Sbjct: 361 SWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPDLASLVVDPEFAKEMVQRQAAWRRV 420

Query: 343 VGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHAYERIDRPGSFHTEWT 402
           VGLA+SAGISTPGMCASL+YFDTYRRARLPANLVQAQRDLFGAH YER DRPG++HTEWT
Sbjct: 421 VGLAVSAGISTPGMCASLAYFDTYRRARLPANLVQAQRDLFGAHTYERTDRPGAYHTEWT 480

Query: 403 KLARQT 408
           KLAR+ 
Sbjct: 481 KLARKN 486
Catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of NADP to NADPH.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 4
>sp|Q9FFR3|6PGD2_ARATH 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic OS=Arabidopsis thaliana GN=At5g41670 PE=2 SV=1 Back     alignment and function description
>sp|Q94KU2|6PGD2_SPIOL 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic OS=Spinacia oleracea GN=pgdP PE=1 SV=1 Back     alignment and function description
>sp|Q94KU1|6PGD1_SPIOL 6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Spinacia oleracea GN=pgdC PE=1 SV=1 Back     alignment and function description
>sp|Q9FWA3|6GPD3_ARATH 6-phosphogluconate dehydrogenase, decarboxylating 3 OS=Arabidopsis thaliana GN=At3g02360 PE=2 SV=1 Back     alignment and function description
>sp|Q2R480|6PGD2_ORYSJ 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic OS=Oryza sativa subsp. japonica GN=G6PGH2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LI00|6PGD1_ORYSJ 6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Oryza sativa subsp. japonica GN=G6PGH1 PE=2 SV=1 Back     alignment and function description
>sp|P21577|6PGD_SYNE7 6-phosphogluconate dehydrogenase, decarboxylating OS=Synechococcus elongatus (strain PCC 7942) GN=gnd PE=1 SV=4 Back     alignment and function description
>sp|P80859|6PGD2_BACSU 6-phosphogluconate dehydrogenase, decarboxylating 2 OS=Bacillus subtilis (strain 168) GN=yqjI PE=1 SV=4 Back     alignment and function description
>sp|Q9CHU6|6PGD_LACLA 6-phosphogluconate dehydrogenase, decarboxylating OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gnd PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query426
255553267495 6-phosphogluconate dehydrogenase, putati 0.971 0.836 0.651 1e-171
255537671495 6-phosphogluconate dehydrogenase, putati 0.971 0.836 0.647 1e-170
449464086495 PREDICTED: 6-phosphogluconate dehydrogen 0.976 0.840 0.634 1e-168
225426063494 PREDICTED: 6-phosphogluconate dehydrogen 0.964 0.831 0.650 1e-168
147798262494 hypothetical protein VITISV_008240 [Viti 0.964 0.831 0.650 1e-168
449522891495 PREDICTED: 6-phosphogluconate dehydrogen 0.976 0.840 0.634 1e-168
222875454495 6-phosphogluconate dehydrogenase [Cucumi 0.976 0.840 0.632 1e-167
356528974495 PREDICTED: 6-phosphogluconate dehydrogen 0.976 0.840 0.634 1e-167
356513305495 PREDICTED: 6-phosphogluconate dehydrogen 0.976 0.840 0.634 1e-166
224053813494 predicted protein [Populus trichocarpa] 0.969 0.836 0.631 1e-165
>gi|255553267|ref|XP_002517676.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis] gi|223543308|gb|EEF44840.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 324/497 (65%), Positives = 358/497 (72%), Gaps = 83/497 (16%)

Query: 1   MEAS-ALSRIGLAGLAVMGQKLALNVPEKGFQISVYNRTTSKVDETLDRAHRE------- 52
           MEAS ALSRIGLAGLAVMGQ LALN+ EKGF ISVYNR+TSKVDET+ RA  E       
Sbjct: 1   MEASVALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRSTSKVDETIHRAQNEGPFPLTG 60

Query: 53  -----DRPLHSQGLRPLHPTPQIHHHRPLGETSGT--------------------STPSA 87
                D  L  Q  RP      +    P+ +T                       +T   
Sbjct: 61  HYTPRDFVLSLQ--RPRSVIILVKAGAPVDQTIAALSEHMEAGDCIIDGGNEWYQNTERR 118

Query: 88  VSMKPVRRVCFISAWGSPGARKARHGPSLMPGGSFEAYNNIRDILQRVAAHVDDGPCITY 147
           +     + + ++    S G   AR GPSLMPGGSFEAYNNI+DILQ+VAA V+DGPC+TY
Sbjct: 119 IDEANQKGLLYLGMGVSGGEEGARFGPSLMPGGSFEAYNNIKDILQKVAAQVEDGPCVTY 178

Query: 148 IGEGGSGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLV 207
           IGEGGSGNFVKMVHNGIEYGDMQLIS+AYDVLK+VGG+SNAELAEIF EWNKGELESFL+
Sbjct: 179 IGEGGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNAELAEIFTEWNKGELESFLI 238

Query: 208 QITADIFKVKDEYGEGELVDKILDKTGMKGTRKWTIQQAAELLVAALTIAASLDCRYLSG 267
           +IT+DIF+VKDE+G+GELVDKILDKTGMKGT KWT+QQAAEL VAA TIAASLDCRYLSG
Sbjct: 239 EITSDIFRVKDEHGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSG 298

Query: 268 LKEERQEAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQAL------------------- 308
           LKEER+ AA+VLKEAGLK+EV+ V   +DKKRLIDDVRQAL                   
Sbjct: 299 LKEERESAAQVLKEAGLKEEVEAVKSGIDKKRLIDDVRQALYASKICSYAQGMNLLRAKS 358

Query: 309 -----------------------------IKNAYQRNPNLASLVVDPEFAREMVQRQAAW 339
                                        IK AYQRNPNLASLVVDPEFAREMVQRQAAW
Sbjct: 359 VEKGWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDPEFAREMVQRQAAW 418

Query: 340 RRVVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHAYERIDRPGSFHT 399
           RRVVGLAISAGISTPGMCASL+YFDTYRRARLPANLVQAQRDLFGAH YERIDRPGSFHT
Sbjct: 419 RRVVGLAISAGISTPGMCASLAYFDTYRRARLPANLVQAQRDLFGAHTYERIDRPGSFHT 478

Query: 400 EWTKLARQTGAGVGAFN 416
           EWTKLAR++ AGVGAFN
Sbjct: 479 EWTKLARKSNAGVGAFN 495

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255537671|ref|XP_002509902.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis] gi|223549801|gb|EEF51289.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449464086|ref|XP_004149760.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225426063|ref|XP_002275970.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147798262|emb|CAN63456.1| hypothetical protein VITISV_008240 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449522891|ref|XP_004168459.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|222875454|gb|ACM68927.1| 6-phosphogluconate dehydrogenase [Cucumis sativus] Back     alignment and taxonomy information
>gi|356528974|ref|XP_003533072.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like [Glycine max] Back     alignment and taxonomy information
>gi|356513305|ref|XP_003525354.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like [Glycine max] Back     alignment and taxonomy information
>gi|224053813|ref|XP_002297992.1| predicted protein [Populus trichocarpa] gi|222845250|gb|EEE82797.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query426
UNIPROTKB|Q9LI00480 G6PGH1 "6-phosphogluconate deh 0.490 0.435 0.680 3.1e-128
TAIR|locus:2024542487 AT1G64190 [Arabidopsis thalian 0.556 0.486 0.7 4.5e-107
TAIR|locus:2160422487 AT5G41670 [Arabidopsis thalian 0.507 0.443 0.762 1.2e-106
UNIPROTKB|Q94KU2537 pgdP "6-phosphogluconate dehyd 0.507 0.402 0.748 4.6e-101
TAIR|locus:2074577486 AT3G02360 [Arabidopsis thalian 0.502 0.440 0.659 7.1e-90
TIGR_CMR|BA_0164469 BA_0164 "6-phosphogluconate de 0.483 0.439 0.526 4.1e-85
MGI|MGI:97553483 Pgd "phosphogluconate dehydrog 0.483 0.426 0.490 3.1e-81
UNIPROTKB|P00349483 PGD "6-phosphogluconate dehydr 0.483 0.426 0.481 5.1e-81
UNIPROTKB|P37756468 gnd "6-phosphogluconate dehydr 0.476 0.433 0.514 6.5e-81
RGD|1583832483 Pgd "phosphogluconate dehydrog 0.483 0.426 0.485 1e-80
UNIPROTKB|Q9LI00 G6PGH1 "6-phosphogluconate dehydrogenase, decarboxylating 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 714 (256.4 bits), Expect = 3.1e-128, Sum P(3) = 3.1e-128
 Identities = 147/216 (68%), Positives = 172/216 (79%)

Query:    94 RRVCFISAWGSPGARKARHGPSLMPGGSFEAYNNIRDILQRVAAHV-DDGPCITYIGEGG 152
             R + ++    S G   AR+GPSLMPGGSFEAY  I DIL +VAA V D GPC+TYIG+GG
Sbjct:   121 RGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQVPDSGPCVTYIGKGG 180

Query:   153 SGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLVQITAD 212
             SGNFVKMVHNGIEYGDMQLIS+AYDVLK VG ++N+EL ++F EWNKGEL SFL++ITAD
Sbjct:   181 SGNFVKMVHNGIEYGDMQLISEAYDVLKSVGKLTNSELQQVFSEWNKGELLSFLIEITAD 240

Query:   213 IFKVKDEYGEGELVDKILDKTGMKGTRKWTIQQAAELLVAALTIAASLDCRYLSGLKEER 272
             IF +KD+ G G LVDK+LDKTGMKGT KWT+QQAAEL VAA TI ASLD R+LSGLK+ER
Sbjct:   241 IFSIKDDQGSGHLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDER 300

Query:   273 QEAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQAL 308
              EAAKV +  G  D   N+ V  DK +LI+DVRQAL
Sbjct:   301 VEAAKVFQ--G--DFSSNLPV--DKAQLIEDVRQAL 330
GO:0009409 "response to cold" evidence=IEP
GO:0009414 "response to water deprivation" evidence=IEP
GO:0009651 "response to salt stress" evidence=IEP
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
TAIR|locus:2024542 AT1G64190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160422 AT5G41670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q94KU2 pgdP "6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic" [Spinacia oleracea (taxid:3562)] Back     alignment and assigned GO terms
TAIR|locus:2074577 AT3G02360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0164 BA_0164 "6-phosphogluconate dehydrogenase, decarboxylating" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
MGI|MGI:97553 Pgd "phosphogluconate dehydrogenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P00349 PGD "6-phosphogluconate dehydrogenase, decarboxylating" [Ovis aries (taxid:9940)] Back     alignment and assigned GO terms
UNIPROTKB|P37756 gnd "6-phosphogluconate dehydrogenase, decarboxylating" [Shigella flexneri (taxid:623)] Back     alignment and assigned GO terms
RGD|1583832 Pgd "phosphogluconate dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P967896PGD_LACLM1, ., 1, ., 1, ., 4, 40.37470.91310.8241yesno
P415806PGD_SHISO1, ., 1, ., 1, ., 4, 40.38240.86150.8247yesno
Q6GGI76PGD_STAAR1, ., 1, ., 1, ., 4, 40.37960.88730.8076yesno
P415826PGD_CITDI1, ., 1, ., 1, ., 4, 40.38540.85910.8224yesno
P572086PGD_BUCAI1, ., 1, ., 1, ., 4, 40.35030.91310.8311yesno
P859686PGD_RAT1, ., 1, ., 1, ., 4, 40.37390.91780.8095yesno
Q931R36PGD_STAAM1, ., 1, ., 1, ., 4, 40.37960.88730.8076yesno
Q94KU16PGD1_SPIOL1, ., 1, ., 1, ., 4, 40.55830.92950.8198N/Ano
P415796PGD_SHIDY1, ., 1, ., 1, ., 4, 40.38240.86150.8247yesno
P633356PGD_STAAW1, ., 1, ., 1, ., 4, 40.37960.88730.8076yesno
P633346PGD_STAAN1, ., 1, ., 1, ., 4, 40.37960.88730.8076yesno
Q5HP426PGD_STAEQ1, ., 1, ., 1, ., 4, 40.38770.91070.8290yesno
P522096PGD_HUMAN1, ., 1, ., 1, ., 4, 40.37600.91780.8095yesno
P377546PGD9_ECOLX1, ., 1, ., 1, ., 4, 40.38770.90140.8205yesno
P377566PGD_SHIFL1, ., 1, ., 1, ., 4, 40.38980.90140.8205yesno
Q9SH696PGD1_ARATH1, ., 1, ., 1, ., 4, 40.62550.95770.8377yesno
Q89AX56PGD_BUCBP1, ., 1, ., 1, ., 4, 40.34380.91070.8290yesno
Q9DCD06PGD_MOUSE1, ., 1, ., 1, ., 4, 40.37810.91780.8095yesno
P808596PGD2_BACSU1, ., 1, ., 1, ., 4, 40.40250.91310.8294yesno
P415766PGD_KLEPN1, ., 1, ., 1, ., 4, 40.38980.90140.8205yesno
P215776PGD_SYNE71, ., 1, ., 1, ., 4, 40.41710.91310.8259yesno
P415726PGD_DROME1, ., 1, ., 1, ., 4, 40.36270.93420.8274yesno
Q9CHU66PGD_LACLA1, ., 1, ., 1, ., 4, 40.37890.91310.8241yesno
Q9ZHD96PGD_BUCAP1, ., 1, ., 1, ., 4, 40.35240.90610.8160yesno
P415786PGD_SHIBO1, ., 1, ., 1, ., 4, 40.38020.86150.8247yesno
P140626PGD_SALTY1, ., 1, ., 1, ., 4, 40.38980.90140.8205yesno
Q6G9546PGD_STAAS1, ., 1, ., 1, ., 4, 40.37960.88730.8076yesno
Q2R4806PGD2_ORYSJ1, ., 1, ., 1, ., 4, 40.54350.93890.7874yesno
Q8CP476PGD_STAES1, ., 1, ., 1, ., 4, 40.38770.91070.8290yesno
Q177616PGD_CAEEL1, ., 1, ., 1, ., 4, 40.34730.92250.8119yesno
Q5HFR26PGD_STAAC1, ., 1, ., 1, ., 4, 40.37960.88730.8076yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.921
4th Layer1.1.1.440.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0008041101
phosphogluconate dehydrogenase (decarboxylating) (EC-1.1.1.44) (495 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_Genewise1_v1.C_LG_XIX0814
hypothetical protein (190 aa)
•    •• 0.920
estExt_fgenesh4_pg.C_LG_I2289
SubName- Full=Putative uncharacterized protein; (226 aa)
    ••• 0.916
fgenesh4_pg.C_LG_XII000285
hypothetical protein (261 aa)
•    •• 0.914
eugene3.00150082
SubName- Full=Putative uncharacterized protein; (261 aa)
•    •• 0.913
grail3.0006058601
6-phosphogluconolactonase (EC-3.1.1.31) (266 aa)
•    •• 0.909
estExt_Genewise1_v1.C_1290095
ribulose-phosphate 3-epimerase (EC-5.1.3.1) (286 aa)
     •• 0.908
gw1.XIII.1456.1
annotation not avaliable (242 aa)
     •• 0.901
gw1.70.218.1
hypothetical protein (264 aa)
     •• 0.900
grail3.0176001401
ribose-5-phosphate isomerase (EC-5.3.1.6) (271 aa)
     •  0.899
fgenesh4_pg.C_LG_XI001338
hypothetical protein (285 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query426
PLN02350493 PLN02350, PLN02350, phosphogluconate dehydrogenase 0.0
COG0362473 COG0362, Gnd, 6-phosphogluconate dehydrogenase [Ca 1e-159
PRK09287459 PRK09287, PRK09287, 6-phosphogluconate dehydrogena 1e-158
TIGR00873467 TIGR00873, gnd, 6-phosphogluconate dehydrogenase ( 1e-142
pfam00393290 pfam00393, 6PGD, 6-phosphogluconate dehydrogenase, 1e-133
PTZ00142470 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogena 1e-133
PRK09599301 PRK09599, PRK09599, 6-phosphogluconate dehydrogena 6e-28
COG1023300 COG1023, Gnd, Predicted 6-phosphogluconate dehydro 2e-23
PRK12490299 PRK12490, PRK12490, 6-phosphogluconate dehydrogena 1e-22
TIGR00872298 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogena 1e-21
pfam03446163 pfam03446, NAD_binding_2, NAD binding domain of 6- 5e-16
PTZ00142470 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogena 6e-13
PRK09287459 PRK09287, PRK09287, 6-phosphogluconate dehydrogena 7e-08
COG2084286 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase 8e-04
>gnl|CDD|215200 PLN02350, PLN02350, phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information 
 Score =  667 bits (1724), Expect = 0.0
 Identities = 298/507 (58%), Positives = 335/507 (66%), Gaps = 105/507 (20%)

Query: 1   MEASALSRIGLAGLAVMGQKLALNVPEKGFQISVYNRTTSKVDETLDRAHRE-DRPLHSQ 59
           M ++ALSRIGLAGLAVMGQ LALN+ EKGF ISVYNRTTSKVDET++RA +E + PL+  
Sbjct: 1   MASAALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYG- 59

Query: 60  GLRPLHPTPQIHHHRPLGETSGTSTPSAVSM-----KPV--------------------- 93
                          P         P +V +      PV                     
Sbjct: 60  ------------FKDPEDFVLSIQKPRSVIILVKAGAPVDQTIKALSEYMEPGDCIIDGG 107

Query: 94  --------RRVCFISAWG--------SPGARKARHGPSLMPGGSFEAYNNIRDILQRVAA 137
                   RR+   +  G        S G   AR+GPSLMPGGSFEAY NI DIL++VAA
Sbjct: 108 NEWYENTERRIKEAAEKGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKNIEDILEKVAA 167

Query: 138 HVDDGPCITYIGEGGSGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEW 197
            VDDGPC+TYIG GG+GNFVKMVHNGIEYGDMQLIS+AYDVLK VGG+SN ELAE+F EW
Sbjct: 168 QVDDGPCVTYIGPGGAGNFVKMVHNGIEYGDMQLISEAYDVLKSVGGLSNEELAEVFAEW 227

Query: 198 NKGELESFLVQITADIFKVKDEYGEGELVDKILDKTGMKGTRKWTIQQAAELLVAALTIA 257
           NKGELESFL++ITADIF VKD+ G+G LVDKILDKTGMKGT KWT+QQAAEL VAA TIA
Sbjct: 228 NKGELESFLIEITADIFSVKDDKGDGYLVDKILDKTGMKGTGKWTVQQAAELSVAAPTIA 287

Query: 258 ASLDCRYLSGLKEERQEAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQAL--------- 308
           ASLD RYLSGLKEER  AAKV KEAGL+D +      VDKK+LIDDVRQAL         
Sbjct: 288 ASLDARYLSGLKEERVAAAKVFKEAGLEDILSADSG-VDKKQLIDDVRQALYASKICSYA 346

Query: 309 ---------------------------------------IKNAYQRNPNLASLVVDPEFA 329
                                                  IK AY RNP+LASL+VDPEFA
Sbjct: 347 QGMNLIRAKSVEKGWNLNLGELARIWKGGCIIRAVFLDRIKKAYDRNPDLASLLVDPEFA 406

Query: 330 REMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHAYE 389
           +EMV+RQAAWRRVV LAI+AGISTPGM ASL+YFDTYRRARLPANLVQAQRD FGAH YE
Sbjct: 407 KEMVERQAAWRRVVSLAINAGISTPGMSASLAYFDTYRRARLPANLVQAQRDYFGAHTYE 466

Query: 390 RIDRPGSFHTEWTKLARQTGAGVGAFN 416
           R+DRPGSFHTEWTKLAR++    G   
Sbjct: 467 RVDRPGSFHTEWTKLARKSKIITGRTA 493

Length = 493
>gnl|CDD|223439 COG0362, Gnd, 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|236453 PRK09287, PRK09287, 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|129951 TIGR00873, gnd, 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|215895 pfam00393, 6PGD, 6-phosphogluconate dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|240287 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236582 PRK09599, PRK09599, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|223954 COG1023, Gnd, Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|237116 PRK12490, PRK12490, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|233163 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|217563 pfam03446, NAD_binding_2, NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>gnl|CDD|240287 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236453 PRK09287, PRK09287, 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|224995 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 426
COG0362473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 100.0
KOG2653487 consensus 6-phosphogluconate dehydrogenase [Carboh 100.0
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 100.0
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 100.0
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 100.0
PRK09287459 6-phosphogluconate dehydrogenase; Validated 100.0
PF00393291 6PGD: 6-phosphogluconate dehydrogenase, C-terminal 100.0
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 100.0
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 100.0
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 100.0
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 100.0
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 100.0
KOG0409327 consensus Predicted dehydrogenase [General functio 100.0
PRK15059292 tartronate semialdehyde reductase; Provisional 100.0
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 100.0
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 100.0
PLN02858 1378 fructose-bisphosphate aldolase 100.0
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 99.97
PLN02858 1378 fructose-bisphosphate aldolase 99.97
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 99.97
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.92
PRK09287459 6-phosphogluconate dehydrogenase; Validated 99.92
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 99.9
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 99.9
COG0362473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 99.9
PF00393291 6PGD: 6-phosphogluconate dehydrogenase, C-terminal 99.88
KOG2653487 consensus 6-phosphogluconate dehydrogenase [Carboh 99.85
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 99.85
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 99.82
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.8
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 99.76
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 99.74
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.71
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.71
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 99.65
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 99.61
PLN02688266 pyrroline-5-carboxylate reductase 99.55
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.54
PRK08229341 2-dehydropantoate 2-reductase; Provisional 99.52
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.51
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 99.5
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 99.46
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.41
PRK07417279 arogenate dehydrogenase; Reviewed 99.41
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.37
PRK08507275 prephenate dehydrogenase; Validated 99.32
PF14833122 NAD_binding_11: NAD-binding of NADP-dependent 3-hy 99.31
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.26
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.22
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 99.2
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.2
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 99.19
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.16
PRK08655437 prephenate dehydrogenase; Provisional 99.12
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.06
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 99.03
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 99.01
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.96
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 98.95
PRK07680273 late competence protein ComER; Validated 98.94
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 98.91
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.82
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.82
PLN02353473 probable UDP-glucose 6-dehydrogenase 98.8
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.79
PRK06545359 prephenate dehydrogenase; Validated 98.75
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 98.73
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.71
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 98.7
PRK12921305 2-dehydropantoate 2-reductase; Provisional 98.68
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 98.63
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 98.63
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 98.59
PRK06249313 2-dehydropantoate 2-reductase; Provisional 98.58
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.56
PLN02256304 arogenate dehydrogenase 98.46
PRK05479330 ketol-acid reductoisomerase; Provisional 98.42
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 98.42
PLN02712667 arogenate dehydrogenase 98.4
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 98.39
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 98.36
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 98.36
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 98.33
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.31
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 98.29
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 98.27
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 98.27
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 98.26
PTZ00431260 pyrroline carboxylate reductase; Provisional 98.25
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 98.25
PRK05708305 2-dehydropantoate 2-reductase; Provisional 98.14
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 98.07
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 97.98
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 97.96
PLN02712 667 arogenate dehydrogenase 97.95
PRK11730715 fadB multifunctional fatty acid oxidation complex 97.87
PRK08818370 prephenate dehydrogenase; Provisional 97.86
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 97.8
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 97.78
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.78
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 97.77
PRK13403335 ketol-acid reductoisomerase; Provisional 97.75
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 97.75
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.58
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 97.56
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 97.51
PRK11154708 fadJ multifunctional fatty acid oxidation complex 97.48
PRK12480330 D-lactate dehydrogenase; Provisional 97.47
PRK07574385 formate dehydrogenase; Provisional 97.38
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.33
PLN03139386 formate dehydrogenase; Provisional 97.31
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 97.26
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.21
PRK13243333 glyoxylate reductase; Reviewed 97.11
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.1
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.09
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 97.01
KOG2380480 consensus Prephenate dehydrogenase (NADP+) [Amino 97.01
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.93
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 96.89
PRK08605332 D-lactate dehydrogenase; Validated 96.78
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 96.72
PRK06141314 ornithine cyclodeaminase; Validated 96.65
PRK13304265 L-aspartate dehydrogenase; Reviewed 96.63
PRK06436303 glycerate dehydrogenase; Provisional 96.57
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 96.53
PRK06223307 malate dehydrogenase; Reviewed 96.5
COG0569225 TrkA K+ transport systems, NAD-binding component [ 96.49
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.46
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 96.44
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 96.35
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 96.28
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.24
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 96.15
PLN00203519 glutamyl-tRNA reductase 96.15
PLN02928347 oxidoreductase family protein 96.14
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.1
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 96.1
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 96.04
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.02
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 96.02
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 95.94
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 95.83
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 95.79
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 95.79
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.66
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 95.58
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 95.55
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 95.44
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 95.43
PRK13301267 putative L-aspartate dehydrogenase; Provisional 95.41
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 95.37
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 95.36
PTZ00082321 L-lactate dehydrogenase; Provisional 95.27
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 95.17
PRK12549284 shikimate 5-dehydrogenase; Reviewed 95.15
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 95.12
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 95.11
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 95.07
PRK13940414 glutamyl-tRNA reductase; Provisional 95.07
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 95.05
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 95.04
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 94.98
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 94.91
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 94.89
PRK08618325 ornithine cyclodeaminase; Validated 94.84
PRK08163396 salicylate hydroxylase; Provisional 94.84
PRK07236386 hypothetical protein; Provisional 94.73
PTZ00117319 malate dehydrogenase; Provisional 94.69
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 94.66
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 94.52
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 94.49
PRK04148134 hypothetical protein; Provisional 94.42
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 94.4
PRK07340304 ornithine cyclodeaminase; Validated 94.39
PTZ00075476 Adenosylhomocysteinase; Provisional 94.39
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 94.35
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 94.35
PRK09496453 trkA potassium transporter peripheral membrane com 94.26
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 94.2
PRK06487317 glycerate dehydrogenase; Provisional 94.19
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 94.11
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.1
PRK08291330 ectoine utilization protein EutC; Validated 94.06
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 93.99
cd01483143 E1_enzyme_family Superfamily of activating enzymes 93.9
PRK06407301 ornithine cyclodeaminase; Provisional 93.89
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 93.81
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 93.79
PRK06823315 ornithine cyclodeaminase; Validated 93.72
PRK11728393 hydroxyglutarate oxidase; Provisional 93.71
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 93.69
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 93.67
COG0673342 MviM Predicted dehydrogenases and related proteins 93.67
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 93.67
PRK06932314 glycerate dehydrogenase; Provisional 93.63
PLN02306386 hydroxypyruvate reductase 93.61
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.56
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 93.51
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 93.5
PRK06847375 hypothetical protein; Provisional 93.35
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 93.26
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 93.15
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 93.15
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 93.14
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 93.14
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 93.14
PRK05868372 hypothetical protein; Validated 93.07
PRK07326237 short chain dehydrogenase; Provisional 93.03
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 93.03
PRK10669558 putative cation:proton antiport protein; Provision 93.03
PRK01390460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.02
PRK06185407 hypothetical protein; Provisional 92.99
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 92.96
PRK11259376 solA N-methyltryptophan oxidase; Provisional 92.96
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 92.95
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 92.94
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.94
PRK06046326 alanine dehydrogenase; Validated 92.91
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 92.9
PLN02494477 adenosylhomocysteinase 92.9
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 92.89
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 92.88
PRK07454241 short chain dehydrogenase; Provisional 92.86
PRK06475400 salicylate hydroxylase; Provisional 92.77
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 92.74
PRK07045388 putative monooxygenase; Reviewed 92.73
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 92.72
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 92.72
PRK14027283 quinate/shikimate dehydrogenase; Provisional 92.71
PRK06753373 hypothetical protein; Provisional 92.67
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 92.63
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 92.62
PRK08017256 oxidoreductase; Provisional 92.56
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 92.51
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 92.49
PRK08132 547 FAD-dependent oxidoreductase; Provisional 92.48
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 92.42
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 92.28
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 92.28
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 92.25
PRK09126392 hypothetical protein; Provisional 92.21
PRK06126 545 hypothetical protein; Provisional 92.18
PRK12548289 shikimate 5-dehydrogenase; Provisional 92.16
PRK09496453 trkA potassium transporter peripheral membrane com 92.15
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 92.1
PRK07588391 hypothetical protein; Provisional 92.1
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 92.09
PRK07538413 hypothetical protein; Provisional 92.03
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 91.99
KOG2305313 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 91.92
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 91.91
PRK07774250 short chain dehydrogenase; Provisional 91.8
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 91.69
PRK03659601 glutathione-regulated potassium-efflux system prot 91.68
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 91.68
PRK08013400 oxidoreductase; Provisional 91.67
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 91.65
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 91.64
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 91.6
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 91.59
COG2910211 Putative NADH-flavin reductase [General function p 91.54
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 91.39
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 91.38
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.36
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 91.33
PRK07589346 ornithine cyclodeaminase; Validated 91.22
PRK12550272 shikimate 5-dehydrogenase; Reviewed 91.12
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 91.04
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 91.03
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 91.01
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 91.0
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 91.0
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.94
PRK00048257 dihydrodipicolinate reductase; Provisional 90.9
PRK07063260 short chain dehydrogenase; Provisional 90.88
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 90.88
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 90.86
PRK08265261 short chain dehydrogenase; Provisional 90.85
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 90.84
PRK06199379 ornithine cyclodeaminase; Validated 90.79
PRK08703239 short chain dehydrogenase; Provisional 90.73
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.71
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 90.66
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 90.64
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 90.59
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.41
PRK05993277 short chain dehydrogenase; Provisional 90.37
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 90.36
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 90.34
CHL00194317 ycf39 Ycf39; Provisional 90.33
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 90.32
PLN02602350 lactate dehydrogenase 90.31
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 90.28
PLN02985514 squalene monooxygenase 90.23
PTZ00367 567 squalene epoxidase; Provisional 90.18
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 90.12
PRK10157428 putative oxidoreductase FixC; Provisional 90.1
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 90.09
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 90.07
PRK06194287 hypothetical protein; Provisional 90.02
PRK06444197 prephenate dehydrogenase; Provisional 90.0
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 89.93
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 89.89
PRK12939250 short chain dehydrogenase; Provisional 89.88
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 89.78
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 89.77
PRK05225487 ketol-acid reductoisomerase; Validated 89.76
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 89.73
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 89.69
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 89.58
PRK08244493 hypothetical protein; Provisional 89.58
PRK02006498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.57
PRK06914280 short chain dehydrogenase; Provisional 89.5
PLN02172461 flavin-containing monooxygenase FMO GS-OX 89.5
PRK06500249 short chain dehydrogenase; Provisional 89.42
PRK03562621 glutathione-regulated potassium-efflux system prot 89.4
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 89.38
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 89.2
PRK02318381 mannitol-1-phosphate 5-dehydrogenase; Provisional 89.1
PRK00676338 hemA glutamyl-tRNA reductase; Validated 89.09
PRK08328231 hypothetical protein; Provisional 88.95
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.94
PRK07024257 short chain dehydrogenase; Provisional 88.93
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 88.88
TIGR01087433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 88.85
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 88.78
PRK13303265 L-aspartate dehydrogenase; Provisional 88.78
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 88.71
PRK08085254 gluconate 5-dehydrogenase; Provisional 88.66
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 88.64
PRK07523255 gluconate 5-dehydrogenase; Provisional 88.57
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 88.54
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.51
PRK06718202 precorrin-2 dehydrogenase; Reviewed 88.47
PLN02948 577 phosphoribosylaminoimidazole carboxylase 88.46
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 88.41
PRK05884223 short chain dehydrogenase; Provisional 88.41
PRK07074257 short chain dehydrogenase; Provisional 88.3
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.29
PRK15076431 alpha-galactosidase; Provisional 88.26
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 88.19
PRK07060245 short chain dehydrogenase; Provisional 88.12
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 88.07
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 88.06
PRK08339263 short chain dehydrogenase; Provisional 88.03
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 88.01
PRK07102243 short chain dehydrogenase; Provisional 88.0
PRK07453322 protochlorophyllide oxidoreductase; Validated 87.95
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 87.87
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.87
PF0098496 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenas 87.7
PRK06172253 short chain dehydrogenase; Provisional 87.7
PRK06184502 hypothetical protein; Provisional 87.68
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.61
PRK14982340 acyl-ACP reductase; Provisional 87.55
PRK11445351 putative oxidoreductase; Provisional 87.53
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 87.53
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 87.5
PRK06180277 short chain dehydrogenase; Provisional 87.48
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.46
PRK10015429 oxidoreductase; Provisional 87.45
PLN00016378 RNA-binding protein; Provisional 87.45
PRK13339497 malate:quinone oxidoreductase; Reviewed 87.44
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.31
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 87.31
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 87.3
PRK12814652 putative NADPH-dependent glutamate synthase small 87.28
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 87.24
PRK06719157 precorrin-2 dehydrogenase; Validated 87.21
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 87.2
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 87.14
PRK07067257 sorbitol dehydrogenase; Provisional 87.11
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 87.07
PRK08267260 short chain dehydrogenase; Provisional 87.03
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 86.81
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.81
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 86.8
PTZ00383497 malate:quinone oxidoreductase; Provisional 86.7
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 86.67
PRK05257494 malate:quinone oxidoreductase; Validated 86.67
PRK07062265 short chain dehydrogenase; Provisional 86.65
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.55
PRK08177225 short chain dehydrogenase; Provisional 86.52
PRK06101240 short chain dehydrogenase; Provisional 86.44
PRK12746254 short chain dehydrogenase; Provisional 86.43
PRK15116268 sulfur acceptor protein CsdL; Provisional 86.39
PRK07478254 short chain dehydrogenase; Provisional 86.37
PRK12828239 short chain dehydrogenase; Provisional 86.32
PRK05876275 short chain dehydrogenase; Provisional 86.28
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 86.25
PRK10538248 malonic semialdehyde reductase; Provisional 86.25
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 86.15
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 86.13
PLN02463447 lycopene beta cyclase 86.01
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 85.95
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 85.89
PRK08309177 short chain dehydrogenase; Provisional 85.88
PRK01368454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.88
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 85.85
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 85.82
KOG3124267 consensus Pyrroline-5-carboxylate reductase [Amino 85.79
PRK07806248 short chain dehydrogenase; Provisional 85.62
PRK08589272 short chain dehydrogenase; Validated 85.52
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 85.41
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 85.41
PRK07208479 hypothetical protein; Provisional 85.31
COG1233487 Phytoene dehydrogenase and related proteins [Secon 85.31
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.29
KOG2741351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 85.28
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 85.27
COG0300265 DltE Short-chain dehydrogenases of various substra 85.25
PRK05875276 short chain dehydrogenase; Provisional 85.18
PRK06057255 short chain dehydrogenase; Provisional 85.16
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 85.04
PTZ00325321 malate dehydrogenase; Provisional 85.02
PRK06139330 short chain dehydrogenase; Provisional 85.01
PRK07109334 short chain dehydrogenase; Provisional 85.01
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 84.99
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 84.96
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 84.92
PRK12831464 putative oxidoreductase; Provisional 84.92
PRK06949258 short chain dehydrogenase; Provisional 84.91
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 84.85
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 84.82
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 84.82
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 84.82
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 84.81
PRK07576264 short chain dehydrogenase; Provisional 84.79
PRK07190487 hypothetical protein; Provisional 84.74
PRK12829264 short chain dehydrogenase; Provisional 84.71
PRK05867253 short chain dehydrogenase; Provisional 84.64
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 84.64
PRK06834488 hypothetical protein; Provisional 84.64
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 84.53
PRK06953222 short chain dehydrogenase; Provisional 84.52
PRK08223287 hypothetical protein; Validated 84.47
TIGR01082448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 84.3
PRK06567 1028 putative bifunctional glutamate synthase subunit b 84.25
PRK07890258 short chain dehydrogenase; Provisional 84.21
PRK08264238 short chain dehydrogenase; Validated 84.14
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 84.14
PLN03209576 translocon at the inner envelope of chloroplast su 84.06
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 84.04
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 84.0
PRK11908347 NAD-dependent epimerase/dehydratase family protein 83.96
KOG1298509 consensus Squalene monooxygenase [Lipid transport 83.92
PRK09291257 short chain dehydrogenase; Provisional 83.91
PRK06182273 short chain dehydrogenase; Validated 83.91
PRK03815401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.89
PRK06124256 gluconate 5-dehydrogenase; Provisional 83.85
PLN02253280 xanthoxin dehydrogenase 83.79
PRK05854313 short chain dehydrogenase; Provisional 83.76
PRK06198260 short chain dehydrogenase; Provisional 83.74
PRK08251248 short chain dehydrogenase; Provisional 83.73
PRK06482276 short chain dehydrogenase; Provisional 83.62
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 83.59
PRK06720169 hypothetical protein; Provisional 83.53
PRK06940275 short chain dehydrogenase; Provisional 83.47
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 83.3
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 83.28
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 83.19
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 83.16
PRK06924251 short chain dehydrogenase; Provisional 83.16
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 83.09
TIGR00036266 dapB dihydrodipicolinate reductase. 83.07
PRK08862227 short chain dehydrogenase; Provisional 83.06
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 83.05
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 83.04
PRK08340259 glucose-1-dehydrogenase; Provisional 83.04
PRK07814263 short chain dehydrogenase; Provisional 83.02
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 82.98
PRK08277278 D-mannonate oxidoreductase; Provisional 82.97
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 82.89
PRK12779 944 putative bifunctional glutamate synthase subunit b 82.85
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 82.84
PRK08263275 short chain dehydrogenase; Provisional 82.82
PRK05600370 thiamine biosynthesis protein ThiF; Validated 82.7
PRK11579346 putative oxidoreductase; Provisional 82.68
PLN02686367 cinnamoyl-CoA reductase 82.59
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 82.5
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 82.41
PLN02780320 ketoreductase/ oxidoreductase 82.37
PRK09072263 short chain dehydrogenase; Provisional 82.37
PRK12827249 short chain dehydrogenase; Provisional 82.32
PRK08643256 acetoin reductase; Validated 82.31
PRK05866293 short chain dehydrogenase; Provisional 82.29
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 82.26
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 82.23
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 82.22
PRK09186256 flagellin modification protein A; Provisional 82.21
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 82.18
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 82.11
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 82.11
PLN02650351 dihydroflavonol-4-reductase 82.1
PRK08219227 short chain dehydrogenase; Provisional 82.07
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 82.0
PLN02214342 cinnamoyl-CoA reductase 81.97
PRK08294 634 phenol 2-monooxygenase; Provisional 81.91
PRK05872296 short chain dehydrogenase; Provisional 81.79
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-123  Score=912.08  Aligned_cols=391  Identities=50%  Similarity=0.809  Sum_probs=374.3

Q ss_pred             CCCcEEEEchhHHHHHHHHHHHhCCCeEEEEeCCccchHHHHHhccccCCCCcccccCCCC--------CCcE---ecCC
Q 043238            5 ALSRIGLAGLAVMGQKLALNVPEKGFQISVYNRTTSKVDETLDRAHREDRPLHSQGLRPLH--------PTPQ---IHHH   73 (426)
Q Consensus         5 ~~~~IG~IGlG~MG~~lA~nL~~~G~~V~vynr~~~~~~~l~~~~~~~~~~~~~~~~~~~~--------~~vI---v~~g   73 (426)
                      |.++||+||||+||+|||+|++++||+|+|||||++|+++|.++.+..   .++.++.+++        ||+|   |++|
T Consensus         2 ~~~~iGviGLaVMG~NLaLNi~~~G~~VavyNRt~~ktd~f~~~~~~~---k~i~~~~sieefV~~Le~PRkI~lMVkAG   78 (473)
T COG0362           2 MKADIGVIGLAVMGSNLALNIADHGYTVAVYNRTTEKTDEFLAERAKG---KNIVPAYSIEEFVASLEKPRKILLMVKAG   78 (473)
T ss_pred             CccceeeEehhhhhHHHHHHHHhcCceEEEEeCCHHHHHHHHHhCccC---CCccccCcHHHHHHHhcCCceEEEEEecC
Confidence            567899999999999999999999999999999999999999887644   3788888876        8877   9999


Q ss_pred             chHHHHHhhcCCC------------ccccchhhh--------hhccccCCCCChhhhhcCCeEeecCCHHHHHHHHHHHH
Q 043238           74 RPLGETSGTSTPS------------AVSMKPVRR--------VCFISAWGSPGARKARHGPSLMPGGSFEAYNNIRDILQ  133 (426)
Q Consensus        74 ~~vd~vl~~l~p~------------s~~~~t~rr--------~~~v~~pVsGg~~gA~~G~slm~GG~~~a~~~v~~iL~  133 (426)
                      .+||.+|++|+|+            |+|+||.||        ++||++|||||++||++||||||||++++|+.|+|||+
T Consensus        79 ~~VD~~I~~L~p~Le~gDIiIDGGNs~y~DT~RR~~eL~~~Gi~FvG~GVSGGEeGA~~GPSiMpGG~~eay~~v~pil~  158 (473)
T COG0362          79 TPVDAVIEQLLPLLEKGDIIIDGGNSHYKDTIRRNKELSEKGILFVGMGVSGGEEGARHGPSIMPGGQKEAYELVAPILT  158 (473)
T ss_pred             CcHHHHHHHHHhhcCCCCEEEeCCCcCCchHHHHHHHHHhcCCeEEeccccccccccccCCCcCCCCCHHHHHHHHHHHH
Confidence            9999999999987            999999999        89999999999999999999999999999999999999


Q ss_pred             HhhcccCCCCcEEEeCCCchhhHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCHHHHHHHHHHhcccchhhHHHHHhHHh
Q 043238          134 RVAAHVDDGPCITYIGEGGSGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLVQITADI  213 (426)
Q Consensus       134 ~iaa~~~~~~~v~~vG~~Gag~~vKmv~N~i~~~~m~~iAEa~~Ll~~~g~ld~~~ia~if~~W~~G~i~S~L~ei~~~i  213 (426)
                      +|+||++|+|||.|+||.|+|||||||||+|||++||+|+|+|.+||..+||+.++|+++|++||+|.+.|||+||+.++
T Consensus       159 ~IaAk~~g~pCc~~iG~~GAGHfVKmVHNGIEYgDMQlIaE~Y~ilk~~lgls~~ei~~vF~~WN~geL~SYLIeIT~~I  238 (473)
T COG0362         159 KIAAKVDGEPCCTWIGPDGAGHFVKMVHNGIEYGDMQLIAEAYDILKDGLGLSAEEIAEVFEEWNKGELDSYLIEITADI  238 (473)
T ss_pred             HHHhhcCCCCceeeECCCCCCceeeeeecCchHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHhccCcchHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999988899999999999999999999999999999


Q ss_pred             hhccCCCCCCcchhhHHHhhcccchHHHHHHHHHHcCCChhHHHHHHHHHHHhhhhhhhhHHHHhhhhcccccccccccc
Q 043238          214 FKVKDEYGEGELVDKILDKTGMKGTRKWTIQQAAELLVAALTIAASLDCRYLSGLKEERQEAAKVLKEAGLKDEVQNVGV  293 (426)
Q Consensus       214 l~~~~~~~~~~lld~i~kd~~qkgtg~w~v~~A~~~gvp~P~isaAl~~r~~s~~k~~r~~a~~~~~~~~~~~~~~~~~~  293 (426)
                      |+.+|+.+..+++|.|+|.++|||||+|+++.|+++|+|+|+|.+||++||+|++|++|..|+++|++|..       ..
T Consensus       239 L~~kD~~~~kplvd~ILD~AgQKGTGkWt~~~AldlGvP~t~I~eaVfAR~lSs~K~eR~~Ask~l~~~~~-------~~  311 (473)
T COG0362         239 LRKKDEEGGKPLVDKILDKAGQKGTGKWTVISALDLGVPLTLITEAVFARYLSSLKDERVAASKVLAGPKL-------GE  311 (473)
T ss_pred             HhhcCcccCCchHHHHHHHhcCCCcchhhHHHHHHcCCCcHHHHHHHHHHHHHHhHHHHHHHHhhcCCCCC-------CC
Confidence            99887656669999999999999999999999999999999999999999999999999999999988854       23


Q ss_pred             ccchhHHHHHHHHHH------------------------------------------------HHHHHhcCCCCCCCCCc
Q 043238          294 HVDKKRLIDDVRQAL------------------------------------------------IKNAYQRNPNLASLVVD  325 (426)
Q Consensus       294 ~~~~~~~i~~~rda~------------------------------------------------i~~~y~~~~~~~nll~~  325 (426)
                      ..|+++||+++|+||                                                |+.+|+++|++.||+++
T Consensus       312 ~~dk~~fi~~vr~ALy~sKI~sYAQGF~~l~~AS~e~gW~l~~~~iA~iWR~GCIIRs~FL~~I~~af~~~p~l~nLl~~  391 (473)
T COG0362         312 PGDKEEFIEDVRQALYASKIVSYAQGFALLRAASKEYGWDLNLGEIALIWRGGCIIRSKFLDKITDAFDENPELANLLLA  391 (473)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCHHHHHHHHhccceehHHHHHHHHHHHhcCcchhhhhcC
Confidence            679999999999999                                                99999999999999999


Q ss_pred             hhHHHHHHHhhHhHHHHHHHHHHcCCchhhhHhhhhhHhhhccCCCchHHHHHhhhhccccccccccCCCccccccCCCC
Q 043238          326 PEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHAYERIDRPGSFHTEWTKLA  405 (426)
Q Consensus       326 ~~f~~~~~~~~~~wr~vv~~~~~~~~~~p~~saal~y~~~~~~~~l~~nliqaqrD~fgah~~~r~d~~g~~h~~w~~~~  405 (426)
                      |+|.+.+++++++||+||++|++.|||+|+|||||+|||+||+++||+|||||||||||||||||+|++|.||++|++++
T Consensus       392 pyF~~~~~~~~~~~R~vV~~a~~~giP~P~~ssalsy~Dsyr~~~lpaNLiQAQRDyFGAHtyeR~D~~~~fHt~W~~~~  471 (473)
T COG0362         392 PYFKSILEEYQQSLRRVVAYAVEAGIPVPAFSSALSYYDSYRTARLPANLIQAQRDYFGAHTYERTDKEGFFHTNWTGGG  471 (473)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcCCCchHHHHHHHHHHHhhhccccHHHHHHHHHhhcccceeecCCCCccccCccCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999998754

>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PF00393 6PGD: 6-phosphogluconate dehydrogenase, C-terminal domain; InterPro: IPR006114 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00393 6PGD: 6-phosphogluconate dehydrogenase, C-terminal domain; InterPro: IPR006114 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PF14833 NAD_binding_11: NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase; PDB: 3OBB_A 3Q3C_A 2UYY_D 3G0O_A 1WP4_A 2CVZ_B 1YB4_A 3PDU_G 2I9P_D 2GF2_D Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG2305 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00984 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenase family, central domain; InterPro: IPR014026 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>KOG3124 consensus Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query426
2w8z_A470 Geobacillus Stearothermophilus 6-Phosphogluconate D 3e-85
2w90_A471 Geobacillus Stearothermophilus 6-Phosphogluconate D 3e-85
2iyo_A472 Structural Characterization Of A Bacterial 6pdh Rev 3e-84
2iz0_A474 Pex Inhibitor-Home Data Length = 474 4e-84
2iyp_A473 Product Rup Length = 473 4e-84
3fwn_A480 Dimeric 6-Phosphogluconate Dehydrogenase Complexed 8e-80
1pgn_A482 Crystallographic Study Of Coenzyme, Coenzyme Analog 1e-79
2zya_A480 Dimeric 6-Phosphogluconate Dehydrogenase Complexed 1e-78
2zyg_A480 Apo-Form Of Dimeric 6-Phosphogluconate Dehydrogenas 2e-78
2jkv_A505 Structure Of Human Phosphogluconate Dehydrogenase I 5e-77
4gwg_A484 Crystal Structure Analysis Of 6-Phosphogluconate De 6e-77
2p4q_A497 Crystal Structure Analysis Of Gnd1 In Saccharomyces 1e-73
1pgj_A478 X-Ray Structure Of 6-Phosphogluconate Dehydrogenase 4e-38
3doj_A310 Structure Of Glyoxylate Reductase 1 From Arabidopsi 5e-05
4e21_A358 The Crystal Structure Of 6-Phosphogluconate Dehydro 9e-05
>pdb|2W8Z|A Chain A, Geobacillus Stearothermophilus 6-Phosphogluconate Dehydrogenase With Bound 6-Phosphogluconate Length = 470 Back     alignment and structure 
Iteration: 1

 Score =  311 bits (798), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 194/475 (40%), Positives = 258/475 (54%), Gaps = 83/475 (17%)
Query: 5   ALSRIGLAGLAVMGQKLALNVPEKGFQISVYNRTTSKVDETLDRAHRE------------ 52
           A  +IG+ GLAVMG+ LALN+  KG+ ++VYNR   K DE L  A  +            
Sbjct: 3   AKHQIGVIGLAVMGKNLALNIESKGYSVAVYNRLREKTDEFLQEAKGKNIVGTYSIEEFV 62
Query: 53  ---DRP----LHSQGLRPLHPT-PQIHHHRPLGET--SGTSTPSAVSMKPVRRVC----- 97
              ++P    L  +   P   T  Q+  H   G+    G +T    + +  + +      
Sbjct: 63  NALEKPRKILLMVKAGAPTDATIEQLKPHLEKGDIVIDGGNTYFKDTQRRNKELAELGIH 122
Query: 98  FISAWGSPGARKARHGPSLMPGGSFEAYNNIRDILQRVAAHVDDGPCITYIGEGGSGNFV 157
           FI    S G   A  GPS+MPGG  EA+  +R I + +AA VD  PC TYIG  G+G++V
Sbjct: 123 FIGTGVSGGEEGALKGPSIMPGGQKEAHELVRPIFEAIAAKVDGEPCTTYIGPDGAGHYV 182
Query: 158 KMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLVQITADIFKVK 217
           KMVHNGIEYGDMQLI++AY +LKHV G+  AEL E+F +WNKGEL S+L++ITADIF   
Sbjct: 183 KMVHNGIEYGDMQLIAEAYFLLKHVLGMDAAELHEVFADWNKGELNSYLIEITADIFTKI 242
Query: 218 DEYGEGELVDKILDKTGMKGTRKWTIQQAAELLVAALTIAASLDCRYLSGLKEERQEAAK 277
           DE     LVD ILDK G KGT KWT Q A +L V    I  S+  R+LS +K+ER +A+K
Sbjct: 243 DEETGKPLVDVILDKAGQKGTGKWTSQNALDLGVPLPIITESVFARFLSAMKDERVKASK 302
Query: 278 VLKEAGLKDEVQNVGVHVDKKRLIDDVRQAL----------------------------- 308
           VL    +K          D+   I+ VR+AL                             
Sbjct: 303 VLAGPAVKP------FEGDRAHFIEAVRRALYMSKICSYAQGFAQMKAASEEYNWNLRYG 356
Query: 309 -------------------IKNAYQRNPNLASLVVDPEFAREMVQR-QAAWRRVVGLAIS 348
                              IK AY R+P L++L++D  F +++V+R Q A R +V  A  
Sbjct: 357 DIAMIFRGGCIIRAQFLQKIKEAYDRDPALSNLLLDSYF-KDIVERYQDALREIVATAAM 415
Query: 349 AGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHAYERIDRPGSFHTEWTK 403
            GI  PG  ++L+Y+D+YR A LPANL+QAQRD FGAH YER+D+ G FHTEW K
Sbjct: 416 RGIPVPGSASALAYYDSYRTAVLPANLIQAQRDYFGAHTYERVDKEGIFHTEWLK 470
>pdb|2W90|A Chain A, Geobacillus Stearothermophilus 6-Phosphogluconate Dehydrogenase With Bound 6-Phosphogluconate Length = 471 Back     alignment and structure
>pdb|2IYO|A Chain A, Structural Characterization Of A Bacterial 6pdh Reveals Aspects Of Specificity, Mechanism And Mode Of Inhibition Length = 472 Back     alignment and structure
>pdb|2IZ0|A Chain A, Pex Inhibitor-Home Data Length = 474 Back     alignment and structure
>pdb|2IYP|A Chain A, Product Rup Length = 473 Back     alignment and structure
>pdb|3FWN|A Chain A, Dimeric 6-Phosphogluconate Dehydrogenase Complexed With 6- Phosphogluconate And 2'-Monophosphoadenosine-5'-Diphosphate Length = 480 Back     alignment and structure
>pdb|1PGN|A Chain A, Crystallographic Study Of Coenzyme, Coenzyme Analogue And Substrate Binding In 6-Phosphogluconate Dehydrogenase: Implications For Nadp Specificity And The Enzyme Mechanism Length = 482 Back     alignment and structure
>pdb|2ZYA|A Chain A, Dimeric 6-Phosphogluconate Dehydrogenase Complexed With 6- Phosphogluconate Length = 480 Back     alignment and structure
>pdb|2ZYG|A Chain A, Apo-Form Of Dimeric 6-Phosphogluconate Dehydrogenase Length = 480 Back     alignment and structure
>pdb|2JKV|A Chain A, Structure Of Human Phosphogluconate Dehydrogenase In Complex With Nadph At 2.53a Length = 505 Back     alignment and structure
>pdb|4GWG|A Chain A, Crystal Structure Analysis Of 6-Phosphogluconate Dehydrogenase Apo- Form Length = 484 Back     alignment and structure
>pdb|2P4Q|A Chain A, Crystal Structure Analysis Of Gnd1 In Saccharomyces Cerevisiae Length = 497 Back     alignment and structure
>pdb|1PGJ|A Chain A, X-Ray Structure Of 6-Phosphogluconate Dehydrogenase From The Protozoan Parasite T. Brucei Length = 478 Back     alignment and structure
>pdb|3DOJ|A Chain A, Structure Of Glyoxylate Reductase 1 From Arabidopsis (Atglyr1) Length = 310 Back     alignment and structure
>pdb|4E21|A Chain A, The Crystal Structure Of 6-Phosphogluconate Dehydrogenase From Geobacter Metallireducens Length = 358 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query426
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 1e-162
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 1e-159
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 4e-15
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 1e-158
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 7e-15
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 1e-158
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 5e-15
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 1e-155
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 7e-15
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 1e-61
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 8e-09
1yb4_A295 Tartronic semialdehyde reductase; structural genom 4e-07
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 4e-06
3l6d_A306 Putative oxidoreductase; structural genomics, prot 2e-05
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 4e-05
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 3e-04
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 5e-05
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 2e-04
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 6e-05
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 4e-04
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 8e-05
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 1e-04
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 4e-04
1vpd_A299 Tartronate semialdehyde reductase; structural geno 1e-04
1vpd_A299 Tartronate semialdehyde reductase; structural geno 2e-04
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 1e-04
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Length = 478 Back     alignment and structure
 Score =  465 bits (1199), Expect = e-162
 Identities = 125/483 (25%), Positives = 206/483 (42%), Gaps = 96/483 (19%)

Query: 9   IGLAGLAVMGQKLALNVPEKGFQISVYNRTTSKVDETLDRAHREDRPLHSQGLRPLH--- 65
           +G+ GL VMG  LALN+ EKGF+++V+NRT SK +E +          + +    +    
Sbjct: 4   VGVVGLGVMGANLALNIAEKGFKVAVFNRTYSKSEEFMKANASAPFAGNLKAFETMEAFA 63

Query: 66  ---PTP---------------QIHHHRPLGET------SGTSTPSAVSMKPVRR------ 95
                P                I   + + E       +G +          RR      
Sbjct: 64  ASLKKPRKALILVQAGAATDSTIEQLKKVFEKGDILVDTGNAHFK----DQGRRAQQLEA 119

Query: 96  --VCFISAWGSPGARKARHGPSLMPGGSFEAYNNIRDILQRVAAHVDDG-PCITYIGEGG 152
             + F+    S G   AR GP+  PGG+   +  IR I++  AA  DDG PC+T  G GG
Sbjct: 120 AGLRFLGMGISGGEEGARKGPAFFPGGTLSVWEEIRPIVEAAAAKADDGRPCVTMNGSGG 179

Query: 153 SGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEW-NKGELESFLVQITA 211
           +G+ VKM HN  EY  +Q+  + +D+L+ + G++N E+A + ++W +K  L+S+++ I+ 
Sbjct: 180 AGSCVKMYHNSGEYAILQIWGEVFDILRAM-GLNNDEVAAVLEDWKSKNFLKSYMLDISI 238

Query: 212 DIFKVKDEYGEGELVDKILDKTGMKGTRKWTIQQAAELLVAALTIAASLDCRYLSGLKEE 271
              + KD+ G   L + ++D+ G KGT  W+ Q+A E+ V A ++  ++  R  +  K E
Sbjct: 239 AAARAKDKDGS-YLTEHVMDRIGSKGTGLWSAQEALEIGVPAPSLNMAVVSRQFTMYKTE 297

Query: 272 RQEAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQAL----------------------- 308
           RQ  A                        I  +  ++                       
Sbjct: 298 RQANASNAPGITQSPGYTLKNKS-PSGPEIKQLYDSVCIAIISCYAQMFQCLREMDKVHN 356

Query: 309 -------------------------IKNAYQRNPNLASLVVDPEFAREMVQRQAAWRRVV 343
                                    +  A+++NPN+++L+    F  E+      +R +V
Sbjct: 357 FGLNLPATIATFRAGCILQGYLLKPMTEAFEKNPNISNLMCA--FQTEIRAGLQNYRDMV 414

Query: 344 GLA-ISAGISTPGMCASLSYFDTYRRARLP-ANLVQAQRDLFGAHAYERIDRPGSFHTEW 401
            L      +S P + ASL+Y        L    LV  QRD+FG H YER+D+ G    +W
Sbjct: 415 ALITSKLEVSIPVLSASLNYVTAMFTPTLKYGQLVSLQRDVFGRHGYERVDKDGRESFQW 474

Query: 402 TKL 404
            +L
Sbjct: 475 PEL 477
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Length = 474 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Length = 474 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Length = 480 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Length = 480 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Length = 482 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Length = 482 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Length = 358 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Length = 358 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Length = 295 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Length = 306 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Length = 310 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Length = 310 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Length = 316 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Length = 316 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Length = 287 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Length = 287 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Length = 320 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Length = 287 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Length = 287 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Length = 299 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Length = 299 Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Length = 289 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query426
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 100.0
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 100.0
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 100.0
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 100.0
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 100.0
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 99.98
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 99.97
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 99.97
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 99.97
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 99.97
3qha_A296 Putative oxidoreductase; seattle structural genomi 99.97
3l6d_A306 Putative oxidoreductase; structural genomics, prot 99.96
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 99.96
1vpd_A299 Tartronate semialdehyde reductase; structural geno 99.94
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 99.93
4ezb_A317 Uncharacterized conserved protein; structural geno 99.93
1yb4_A295 Tartronic semialdehyde reductase; structural genom 99.92
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 99.92
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 99.92
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 99.92
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 99.92
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 99.91
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.91
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 99.91
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 99.91
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 99.89
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.84
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 99.83
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 99.83
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 99.81
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 99.8
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 99.75
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 99.73
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 99.73
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 99.72
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 99.71
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.7
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.69
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.68
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.66
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 99.64
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 99.63
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 99.63
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 99.62
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 99.62
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 99.61
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 99.57
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 99.56
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.54
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.52
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 99.52
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.5
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.49
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 99.44
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 99.41
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.41
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 99.41
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.37
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 99.33
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.33
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.32
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.32
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.3
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 98.95
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 99.27
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.25
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.24
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 99.23
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 99.22
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 99.21
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.18
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.16
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.16
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.13
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 99.13
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 99.06
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.05
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 99.05
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 99.0
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 98.99
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 98.97
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 98.92
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 98.87
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 98.86
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 98.85
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 98.65
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 98.61
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 98.53
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 98.53
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 98.48
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 98.37
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 98.08
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.86
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.85
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 97.76
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.75
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.7
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 97.67
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 97.66
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 97.62
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 97.62
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 97.62
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 97.6
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.6
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 97.56
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 97.56
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.55
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 97.53
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 97.53
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 97.51
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.51
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 97.49
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 97.48
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.48
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 97.44
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.41
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 97.41
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 97.4
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 97.38
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 97.31
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 97.31
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 97.3
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 97.29
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 97.28
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 97.26
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.25
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 97.25
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 97.24
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 97.23
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 97.23
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 97.22
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.21
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 97.2
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 97.19
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 97.13
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 97.11
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 97.1
3fr7_A525 Putative ketol-acid reductoisomerase (OS05G057370 97.1
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.1
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 97.09
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 97.08
3euw_A344 MYO-inositol dehydrogenase; protein structure init 97.06
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 97.05
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 97.03
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.02
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.01
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 97.01
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 96.99
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 96.99
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 96.97
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 96.97
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 96.93
2duw_A145 Putative COA-binding protein; ligand binding prote 96.93
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 96.92
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 96.91
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 96.86
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 96.86
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 96.82
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 96.8
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 96.78
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 96.76
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 96.76
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 96.74
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 96.74
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 96.74
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.71
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 96.71
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 96.69
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 96.69
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 96.69
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 96.62
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 96.59
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 96.56
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 96.56
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 96.52
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 96.47
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 96.47
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 96.42
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 96.42
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 96.4
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 96.39
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 96.35
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.33
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 96.32
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 96.31
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.28
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 96.27
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 96.25
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 96.25
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 96.25
3ius_A286 Uncharacterized conserved protein; APC63810, silic 96.24
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 96.19
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 96.13
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.12
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 96.12
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 96.09
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 96.09
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 96.05
3tl2_A315 Malate dehydrogenase; center for structural genomi 96.02
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 96.01
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 95.99
4had_A350 Probable oxidoreductase protein; structural genomi 95.99
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 95.96
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 95.91
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 95.86
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 95.83
1ydw_A362 AX110P-like protein; structural genomics, protein 95.82
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 95.8
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.77
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 95.76
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 95.75
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.74
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 95.6
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 95.56
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 95.55
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 95.52
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 95.52
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 95.51
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 95.5
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 95.42
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 95.4
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 95.35
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 95.33
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 95.25
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 95.2
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 95.16
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 95.12
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 95.05
4hb9_A412 Similarities with probable monooxygenase; flavin, 95.04
1obb_A480 Maltase, alpha-glucosidase; glycosidase, sulfinic 95.04
4h3v_A390 Oxidoreductase domain protein; structural genomics 95.04
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 95.03
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.03
3btv_A438 Galactose/lactose metabolism regulatory protein GA 94.99
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 94.99
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 94.98
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 94.98
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 94.93
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 94.88
4g65_A461 TRK system potassium uptake protein TRKA; structur 94.81
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 94.75
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 94.7
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 94.69
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 94.64
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 94.63
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 94.61
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 94.57
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 94.57
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 94.54
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 94.53
3ulk_A491 Ketol-acid reductoisomerase; branched-chain amino 94.51
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 94.44
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 94.43
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 94.37
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 94.36
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 94.36
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 94.35
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 94.32
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 94.3
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 94.28
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 94.19
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 94.16
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 94.12
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 94.12
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 94.03
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 93.97
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 93.95
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 93.94
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 93.94
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 93.92
1iuk_A140 Hypothetical protein TT1466; structural genomics, 93.89
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 93.87
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 93.73
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 93.71
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 93.7
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 93.64
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 93.63
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 93.6
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 93.45
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 93.4
1nff_A260 Putative oxidoreductase RV2002; directed evolution 93.33
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 93.33
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 93.32
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 93.28
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 93.26
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 93.21
3slg_A372 PBGP3 protein; structural genomics, seattle struct 93.2
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 93.18
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 93.18
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 93.16
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 93.13
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 93.1
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 93.1
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 93.06
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 93.05
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 92.94
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 92.93
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 92.93
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 92.87
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 92.85
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 92.76
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 92.75
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 92.73
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 92.7
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 92.69
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 92.66
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 92.66
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 92.57
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 92.5
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 92.43
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 92.42
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 92.36
2d59_A144 Hypothetical protein PH1109; COA binding, structur 92.3
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 92.19
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 92.14
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 92.13
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 92.1
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 92.04
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 92.04
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 92.01
3dme_A369 Conserved exported protein; structural genomics, P 91.98
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 91.94
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 91.93
3imf_A257 Short chain dehydrogenase; structural genomics, in 91.87
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 91.85
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 91.8
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 91.79
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 91.78
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 91.77
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 91.72
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 91.71
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 91.7
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 91.7
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 91.7
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 91.6
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 91.57
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 91.57
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 91.55
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 91.52
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 91.49
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 91.49
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 91.48
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 91.41
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 91.36
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 91.33
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 91.31
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 91.26
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 91.18
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 91.11
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 91.09
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 91.09
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 91.08
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 91.07
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 91.07
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 91.05
3oqb_A383 Oxidoreductase; structural genomics, protein struc 91.04
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 90.98
2ywl_A180 Thioredoxin reductase related protein; uncharacter 90.93
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 90.92
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 90.88
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 90.86
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 90.85
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 90.84
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 90.78
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 90.77
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 90.74
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 90.64
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 90.61
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 90.57
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 90.57
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 90.56
1xq6_A253 Unknown protein; structural genomics, protein stru 90.46
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 90.44
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 90.32
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 90.29
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 90.27
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 90.25
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 90.24
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 90.23
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 90.22
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 90.21
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 90.21
1spx_A278 Short-chain reductase family member (5L265); paral 90.18
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 90.17
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 90.15
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 90.15
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 90.14
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 90.12
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 90.11
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 90.03
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 89.99
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 89.97
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 89.96
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 89.95
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 89.94
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 89.91
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 89.87
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 89.83
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 89.82
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 89.77
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 89.74
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 89.72
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 89.71
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 89.69
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 89.62
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 89.6
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 89.59
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 89.58
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 89.58
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 89.58
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 89.56
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 89.53
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 89.53
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 89.51
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 89.49
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 89.46
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 89.44
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 89.43
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 89.43
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 89.43
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 89.42
3tsc_A277 Putative oxidoreductase; structural genomics, seat 89.37
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 89.34
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 89.31
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 89.26
1xkq_A280 Short-chain reductase family member (5D234); parra 89.25
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 89.15
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 89.15
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 89.13
3atr_A453 Conserved archaeal protein; saturating double bond 89.03
1lnq_A336 MTHK channels, potassium channel related protein; 88.95
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 88.94
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 88.9
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 88.89
3rih_A293 Short chain dehydrogenase or reductase; structural 88.87
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 88.85
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 88.84
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 88.82
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 88.81
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 88.8
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 88.8
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 88.8
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 88.79
4gx0_A565 TRKA domain protein; membrane protein, ION channel 88.79
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 88.79
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 88.78
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 88.77
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 88.77
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 88.72
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 88.65
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 88.63
2wm3_A299 NMRA-like family domain containing protein 1; unkn 88.63
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 88.55
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 88.53
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 88.53
3tjr_A301 Short chain dehydrogenase; structural genomics, se 88.51
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 88.46
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 88.45
4dqx_A277 Probable oxidoreductase protein; structural genomi 88.35
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 88.25
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 88.25
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 88.24
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 88.24
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 88.22
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 88.14
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 88.07
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 88.06
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 88.05
4eso_A255 Putative oxidoreductase; NADP, structural genomics 88.02
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 87.99
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 87.99
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 87.95
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 87.94
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 87.84
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 87.8
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 87.78
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 87.78
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 87.76
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 87.75
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 87.71
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 87.7
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 87.68
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 87.66
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 87.63
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 87.62
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 87.57
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 87.55
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 87.54
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 87.53
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 87.51
2bry_A497 NEDD9 interacting protein with calponin homology a 87.5
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 87.49
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 87.44
2cul_A232 Glucose-inhibited division protein A-related PROT 87.43
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 87.4
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 87.39
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
Probab=100.00  E-value=1.6e-95  Score=760.35  Aligned_cols=401  Identities=43%  Similarity=0.726  Sum_probs=348.5

Q ss_pred             CCCcEEEEchhHHHHHHHHHHHhCCCeEEEEeCCccchHHHHHhccccCCCCcccccCCCC--------CCcE---ecCC
Q 043238            5 ALSRIGLAGLAVMGQKLALNVPEKGFQISVYNRTTSKVDETLDRAHREDRPLHSQGLRPLH--------PTPQ---IHHH   73 (426)
Q Consensus         5 ~~~~IG~IGlG~MG~~lA~nL~~~G~~V~vynr~~~~~~~l~~~~~~~~~~~~~~~~~~~~--------~~vI---v~~g   73 (426)
                      .+++|||||+|.||.+||++|+++||+|++|||++++++++.+.+...   .++..+.+++        +++|   ||++
T Consensus         3 ~~~kIgiIGlG~MG~~lA~~L~~~G~~V~v~dr~~~~~~~l~~~g~~g---~~i~~~~s~~e~v~~l~~aDvVil~Vp~~   79 (484)
T 4gwg_A            3 AQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKG---TKVVGAQSLKEMVSKLKKPRRIILLVKAG   79 (484)
T ss_dssp             CCBSEEEECCSHHHHHHHHHHHHTTCCEEEECSSTHHHHHHHHTTTTT---SSCEECSSHHHHHHTBCSSCEEEECSCSS
T ss_pred             CCCEEEEEChhHHHHHHHHHHHHCCCEEEEEeCCHHHHHHHHhcccCC---CceeccCCHHHHHhhccCCCEEEEecCCh
Confidence            346899999999999999999999999999999999999998764321   1222233322        4544   8999


Q ss_pred             chHHHHHhhcCC----C-------cccc-chhhh--------hhccccCCCCChhhhhcCCeEeecCCHHHHHHHHHHHH
Q 043238           74 RPLGETSGTSTP----S-------AVSM-KPVRR--------VCFISAWGSPGARKARHGPSLMPGGSFEAYNNIRDILQ  133 (426)
Q Consensus        74 ~~vd~vl~~l~p----~-------s~~~-~t~rr--------~~~v~~pVsGg~~gA~~G~slm~GG~~~a~~~v~~iL~  133 (426)
                      ++++++++++.|    +       +..+ ++.++        ++|+|+|||||+.+|++|+++|+||+++++++++|+|+
T Consensus        80 ~~v~~vl~~l~~~L~~g~iIId~st~~~~~t~~~~~~l~~~Gi~fvd~pVsGg~~gA~~G~~im~GG~~ea~~~v~pll~  159 (484)
T 4gwg_A           80 QAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQ  159 (484)
T ss_dssp             HHHHHHHHHHGGGCCTTCEEEECSCCCHHHHHHHHHHHHHTTCEEEEEEEESHHHHHHHCCEEEEEECGGGHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhcCCCCEEEEcCCCCchHHHHHHHHHHhhccccccCCccCCHHHHhcCCeeecCCCHHHHHHHHHHHH
Confidence            889888876544    3       3333 44443        78999999999999999999999999999999999999


Q ss_pred             Hhhccc-CCCCcEEEeCCCchhhHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCHHHHHHHHHHhcccchhhHHHHHhHH
Q 043238          134 RVAAHV-DDGPCITYIGEGGSGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLVQITAD  212 (426)
Q Consensus       134 ~iaa~~-~~~~~v~~vG~~Gag~~vKmv~N~i~~~~m~~iAEa~~Ll~~~g~ld~~~ia~if~~W~~G~i~S~L~ei~~~  212 (426)
                      .+++++ ++++|+.|+|+.|+||++||+||++++++|++++|++.|+++..|+|++++.++|+.|+.|.+.|||++++.+
T Consensus       160 ~ig~~v~~~~~~~~~~G~~Gag~~vKmv~N~i~~~~m~~iaEa~~l~~~~~Gld~~~l~~v~~~w~~G~~~S~l~e~~~~  239 (484)
T 4gwg_A          160 GIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITAN  239 (484)
T ss_dssp             HHSCBCTTSCBSBCCCEETTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHTTTTTCBHHHHHHHH
T ss_pred             HhcCcccCCCceEEEECCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHcCCCccchHHHHHHH
Confidence            999998 7899999999999999999999999999999999999999993449999999999999999999999999999


Q ss_pred             hhhccCCCCCCcchhhHHHhhcccchHHHHHHHHHHcCCChhHHHHHHHHHHHhhhhhhhhHHHHhhhhccccccccccc
Q 043238          213 IFKVKDEYGEGELVDKILDKTGMKGTRKWTIQQAAELLVAALTIAASLDCRYLSGLKEERQEAAKVLKEAGLKDEVQNVG  292 (426)
Q Consensus       213 il~~~~~~~~~~lld~i~kd~~qkgtg~w~v~~A~~~gvp~P~isaAl~~r~~s~~k~~r~~a~~~~~~~~~~~~~~~~~  292 (426)
                      ++.++|. .+.+++|.|+|.+.|||||+|++++|+++|||+|+|++||++||+|++|++|..++++|++|...      .
T Consensus       240 ~l~~~D~-~g~~~ld~i~d~~~~kgtG~wt~~~A~~~gvp~p~i~~av~~R~~S~~k~~r~~a~~~l~~~~~~------~  312 (484)
T 4gwg_A          240 ILKFQDT-DGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKF------Q  312 (484)
T ss_dssp             HHHCBCT-TSSBSGGGSCCCCCSSCTTHHHHHHHHHHTCCCHHHHHHHHHHHHHHCHHHHHHHHTTCCCC--C------C
T ss_pred             HHhcCCc-cCCccHHHHhccccCcchHHHHHHHHHHcCCCchHHHHHHHHHHHhhchHHHHHHHhhcCCCCcc------c
Confidence            9986653 56799999999999999999999999999999999999999999999999999999999877421      3


Q ss_pred             cccchhHHHHHHHHHH------------------------------------------------HHHHHhcCCCCCCCCC
Q 043238          293 VHVDKKRLIDDVRQAL------------------------------------------------IKNAYQRNPNLASLVV  324 (426)
Q Consensus       293 ~~~~~~~~i~~~rda~------------------------------------------------i~~~y~~~~~~~nll~  324 (426)
                      ...|+++|++++|+++                                                |+.+|+++|+++|||+
T Consensus       313 ~~~~~~~~~~~~~~al~~~~i~~yaqGf~ll~~as~~~~w~l~~~~ia~iwr~GciIrs~~l~~i~~a~~~~~~l~~ll~  392 (484)
T 4gwg_A          313 FDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLL  392 (484)
T ss_dssp             CCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCCCHHHHHHHTSTTCTTCBHHHHHHHHHHHHCTTCSCGGG
T ss_pred             ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHccCceeHHHHHHHHHHHHHhCCCchhhhc
Confidence            4468899999999999                                                9999999999999999


Q ss_pred             chhHHHHHHHhhHhHHHHHHHHHHcCCchhhhHhhhhhHhhhccCCCchHHHHHhhhhccccccccccCCC-ccccccCC
Q 043238          325 DPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHAYERIDRPG-SFHTEWTK  403 (426)
Q Consensus       325 ~~~f~~~~~~~~~~wr~vv~~~~~~~~~~p~~saal~y~~~~~~~~l~~nliqaqrD~fgah~~~r~d~~g-~~h~~w~~  403 (426)
                      +|+|.++|++++++||+||..|+++|||+|+||+||+|||+||+++||+|||||||||||+|||||+|++| +|||+|++
T Consensus       393 ~~~f~~~~~~~~~~~r~vv~~a~~~gip~P~~s~al~y~~~~r~~~lpanliqaqRd~FGaH~~~r~d~~g~~~h~~w~~  472 (484)
T 4gwg_A          393 DDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTG  472 (484)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHHHHTCCCHHHHHHHHHHHHHTCSCCTHHHHHHHHHHHHCCCEEETTEEEEEECCCCC-
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHhccCCCHHHHHHHHHHhhCCcceEecCCCCCccccCcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999 58999998


Q ss_pred             CCCcccCcccchhh
Q 043238          404 LARQTGAGVGAFNS  417 (426)
Q Consensus       404 ~~~~~~~~~~~~~~  417 (426)
                      +++++.+  ++|++
T Consensus       473 ~~~~~~~--~~~~~  484 (484)
T 4gwg_A          473 HGGTVSS--SSYNA  484 (484)
T ss_dssp             --------------
T ss_pred             CCCCccc--ccccC
Confidence            8888777  77864
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 426
d2pgda1297 a.100.1.1 (A:177-473) 6-phosphogluconate dehydroge 3e-96
d2pgda1297 a.100.1.1 (A:177-473) 6-phosphogluconate dehydroge 3e-06
d1pgja1300 a.100.1.1 (A:179-478) 6-phosphogluconate dehydroge 2e-85
d2pgda2176 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase 6e-17
d1pgja2178 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase 5e-15
d2cvza2156 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase 9e-08
d3cuma2162 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase 1e-07
d1vpda2161 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase 4e-06
d2pv7a2152 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA { 1e-05
d1i36a2152 c.2.1.6 (A:1-152) Conserved hypothetical protein M 2e-04
d2f1ka2165 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {S 9e-04
d2i76a2153 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {The 0.003
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Length = 297 Back     information, alignment and structure

class: All alpha proteins
fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
family: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain
domain: 6-phosphogluconate dehydrogenase (6PGD)
species: Sheep (Ovis orientalis aries) [TaxId: 9940]

 Score =  288 bits (738), Expect = 3e-96
 Identities = 123/300 (41%), Positives = 164/300 (54%), Gaps = 56/300 (18%)

Query: 152 GSGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLVQITA 211
           G+G+FVKMVHNGIEYGDMQLI +AY ++K V G+ + E+A+ F+EWNK EL+SFL++ITA
Sbjct: 1   GAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGLGHKEMAKAFEEWNKTELDSFLIEITA 60

Query: 212 DIFKVKDEYGEGELVDKILDKTGMKGTRKWTIQQAAELLVAALTIAASLDCRYLSGLKEE 271
            I K +D  G+  L+ KI D  G KGT KWT   A E  V    I  ++  R LS LK+E
Sbjct: 61  SILKFQDADGK-HLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDE 119

Query: 272 RQEAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQAL----------------------- 308
           R +A+K           QN+    DKK  ++D+R+AL                       
Sbjct: 120 RIQASK------KLKGPQNIPFEGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFG 173

Query: 309 -------------------------IKNAYQRNPNLASLVVDPEFAREMVQRQAAWRRVV 343
                                    IK+A+ RNP L +L++D  F   +   Q +WRR +
Sbjct: 174 WTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPGLQNLLLDDFFKSAVENCQDSWRRAI 233

Query: 344 GLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHAYERIDRPGSF-HTEWT 402
              + AGI  P    +LS++D YR A LPANL+QAQRD FGAH YE + +PG F HT WT
Sbjct: 234 STGVQAGIPMPCFTTALSFYDGYRHAMLPANLIQAQRDYFGAHTYELLAKPGQFIHTNWT 293
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Length = 297 Back     information, alignment and structure
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Length = 300 Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Length = 176 Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Length = 178 Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 156 Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 162 Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Length = 161 Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Length = 152 Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 152 Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 165 Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query426
d2pgda1297 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ov 100.0
d1pgja1300 6-phosphogluconate dehydrogenase (6PGD) {Trypanoso 100.0
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.94
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 99.92
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.92
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.91
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.88
d2pgda1297 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ov 99.85
d1pgja1300 6-phosphogluconate dehydrogenase (6PGD) {Trypanoso 99.83
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.65
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.56
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 99.55
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.55
d1vpda1133 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.39
d3cuma1134 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.35
d2cvza1132 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.33
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.27
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.25
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.24
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 98.79
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 98.58
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.5
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.43
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 98.39
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.18
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 98.17
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 98.16
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 98.06
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 97.99
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 97.63
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.33
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.27
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.2
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.86
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 96.65
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 96.63
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 96.47
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 96.45
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.41
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.26
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.22
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 96.21
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 96.18
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.12
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.11
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.05
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 95.92
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 95.9
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 95.85
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 95.79
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 95.75
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.67
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 95.66
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 95.65
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 95.65
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 95.63
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 95.62
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 95.51
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 95.49
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 95.44
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 95.38
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 95.36
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 95.32
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 95.32
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 95.27
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 95.26
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.2
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 95.12
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 95.09
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 94.89
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 94.83
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 94.79
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 94.77
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 94.76
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 94.65
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 94.63
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 94.61
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 94.45
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 94.32
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 94.27
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 94.21
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 94.18
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 94.12
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 94.11
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 93.97
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 93.95
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 93.93
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 93.87
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 93.69
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 93.65
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 93.64
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 93.55
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 93.52
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 93.46
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 93.45
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 93.45
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 93.41
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.35
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 93.23
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 93.11
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 93.07
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 92.99
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 92.95
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 92.91
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 92.86
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 92.85
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 92.77
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 92.76
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 92.75
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 92.46
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 92.38
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 92.34
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.33
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 92.27
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.26
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 92.23
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 92.2
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 92.19
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 92.16
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 92.08
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 91.95
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 91.93
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 91.92
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 91.88
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 91.82
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 91.81
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 91.75
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 91.7
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 91.69
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 91.59
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 91.54
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 91.53
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 91.5
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 91.49
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 91.45
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 91.37
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 91.33
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 91.31
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 91.31
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 91.09
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 91.06
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 91.03
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 91.0
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 90.91
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 90.91
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 90.88
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 90.87
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 90.86
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 90.83
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 90.77
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 90.77
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 90.64
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 90.64
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 90.56
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 90.54
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 90.48
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 90.47
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 90.17
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 90.17
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 90.11
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 90.1
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 90.02
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 89.88
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 89.86
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 89.77
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 89.66
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 89.66
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 89.6
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 89.49
d1id1a_153 Rck domain from putative potassium channel Kch {Es 89.47
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.38
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 89.37
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 89.18
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 89.18
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 88.86
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 88.65
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 88.63
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 88.36
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 88.11
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 87.89
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 87.87
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 87.6
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 87.32
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 87.31
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 87.17
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 87.16
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 87.15
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 87.05
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 86.95
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 86.94
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 86.9
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 86.84
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 86.52
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 86.48
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 86.34
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 86.27
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 86.26
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 86.25
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 86.14
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 85.95
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 85.39
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 85.3
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 85.04
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 85.03
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 84.79
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 84.72
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 84.37
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 84.17
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 84.09
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 83.94
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 83.83
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 83.76
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 83.65
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 83.29
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 83.12
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 82.9
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 82.75
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 82.3
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 82.26
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 82.06
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 81.48
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 81.32
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 81.26
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 81.24
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 80.96
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 80.84
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 80.69
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 80.62
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 80.36
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 80.33
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 80.3
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
class: All alpha proteins
fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
family: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain
domain: 6-phosphogluconate dehydrogenase (6PGD)
species: Sheep (Ovis orientalis aries) [TaxId: 9940]

Probab=100.00  E-value=1.2e-68  Score=520.92  Aligned_cols=248  Identities=49%  Similarity=0.813  Sum_probs=233.1

Q ss_pred             chhhHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCHHHHHHHHHHhcccchhhHHHHHhHHhhhccCCCCCCcchhhHHH
Q 043238          152 GSGNFVKMVHNGIEYGDMQLISQAYDVLKHVGGVSNAELAEIFDEWNKGELESFLVQITADIFKVKDEYGEGELVDKILD  231 (426)
Q Consensus       152 Gag~~vKmv~N~i~~~~m~~iAEa~~Ll~~~g~ld~~~ia~if~~W~~G~i~S~L~ei~~~il~~~~~~~~~~lld~i~k  231 (426)
                      |+|||||||||||||++||+|+|+|.+|++..++++++++++|++|+.|.+.|||++|+.++++++++ ...+++|.+.|
T Consensus         1 GsGH~vKMVHNgIEY~~mq~iaE~y~~l~~~~~~~~~~i~~vf~~w~~~~l~syLleit~~il~~kd~-~~~~~ld~I~d   79 (297)
T d2pgda1           1 GAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGLGHKEMAKAFEEWNKTELDSFLIEITASILKFQDA-DGKHLLPKIRD   79 (297)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHTTTTTCBHHHHHHHHHHHCBCT-TSSBSGGGSCC
T ss_pred             CCchhhhhhccHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHhCCCccHHHHHHHHHHHhccCC-CcCcchhhhhc
Confidence            89999999999999999999999999999977799999999999999999999999999999987664 45689999999


Q ss_pred             hhcccchHHHHHHHHHHcCCChhHHHHHHHHHHHhhhhhhhhHHHHhhhhccccccccccccccchhHHHHHHHHHH---
Q 043238          232 KTGMKGTRKWTIQQAAELLVAALTIAASLDCRYLSGLKEERQEAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQAL---  308 (426)
Q Consensus       232 d~~qkgtg~w~v~~A~~~gvp~P~isaAl~~r~~s~~k~~r~~a~~~~~~~~~~~~~~~~~~~~~~~~~i~~~rda~---  308 (426)
                      .+.|||||+|++++|+++|||+|+|++||++|++|+.|++|..+++.++++...      ....|++.|++++|+++   
T Consensus        80 ~a~~kGTG~Wt~~~Al~lgvp~p~I~~Av~aR~~S~~k~~R~~~~~~~~~~~~~------~~~~~~~~~i~~l~~al~~~  153 (297)
T d2pgda1          80 SAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQNI------PFEGDKKSFLEDIRKALYAS  153 (297)
T ss_dssp             CCCCCSHHHHHHHHHHHHTCCCHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCCC------CCCSCHHHHHHHHHHHHHHH
T ss_pred             cccCCCchHHHHHHHHHcCCCchHHHHHHhhHhhcccHHHHHHhhhcccCcccC------CCCCcHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999988766432      33457889999999999   


Q ss_pred             ---------------------------------------------HHHHHhcCCCCCCCCCchhHHHHHHHhhHhHHHHH
Q 043238          309 ---------------------------------------------IKNAYQRNPNLASLVVDPEFAREMVQRQAAWRRVV  343 (426)
Q Consensus       309 ---------------------------------------------i~~~y~~~~~~~nll~~~~f~~~~~~~~~~wr~vv  343 (426)
                                                                   +..+|++++++.||++++.|.+.+++.+++||++|
T Consensus       154 ~i~syaQGf~ll~~as~~~~w~ldl~~ia~iW~~GcIIrS~LL~~i~~a~~~~~~l~nl~~~~~~~~~l~~~~~~~r~~v  233 (297)
T d2pgda1         154 KIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPGLQNLLLDDFFKSAVENCQDSWRRAI  233 (297)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTCCCCHHHHHHHTTSSSTTCBTHHHHHHHHHHHCTTCSCGGGSHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHhccccCcCccHHHHHHHHcCCCeeeHHHHHHHHHHHHhCCCccchhhcHHHHHHHhhccHHHHHHH
Confidence                                                         88999999999999999999999999999999999


Q ss_pred             HHHHHcCCchhhhHhhhhhHhhhccCCCchHHHHHhhhhccccccccccCCCcc-ccccCCCCC
Q 043238          344 GLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHAYERIDRPGSF-HTEWTKLAR  406 (426)
Q Consensus       344 ~~~~~~~~~~p~~saal~y~~~~~~~~l~~nliqaqrD~fgah~~~r~d~~g~~-h~~w~~~~~  406 (426)
                      ..|+++|||+|++|+||+|||+++++++|+|||||||||||+|||+|+|+||.| |++|+++++
T Consensus       234 ~~ai~~gip~P~lssaL~y~~~~~~~~lp~~lIQAqRD~FG~H~~~r~d~~G~f~H~~W~~~~~  297 (297)
T d2pgda1         234 STGVQAGIPMPCFTTALSFYDGYRHAMLPANLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGG  297 (297)
T ss_dssp             HHHHHHTCCCHHHHHHHHHHHHHHCSSCTHHHHHHHHHHHHCCCBCCSSSTTCCBCCCCSCSCC
T ss_pred             HHHHHcCCChHHHHHHHHHHHHhccCCchhHHHHHHHHHhcCCCeeecCCCCCcccCCCCCCCC
Confidence            999999999999999999999999999999999999999999999999999975 999998653
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure