Citrus Sinensis ID: 043245

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
TLMKSFQILTTCNFRYASCPSLYAVELINEPLSPGVSLERLNKYYKAGYDAVRNHSPTAYVVMSSRIEPIDPSGLGPMDPRDPRELFPLTSDLNGSVIDVHYYNSNKSMTVQQNIDFVCTNRSAQLNQITTPDGPLIFVGEWVAELPVPEASKEDLQRFAKAQQEVYGNATFGWGYWTLKTLNNERKHWSLEWMIENGYIKL
cHHHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccccccccccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccccccccccccHHHHHHHHHHHHHHHHcccccEEEccccccccccccccHHHHHHcccEEc
cHHHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccHHHHHccccccccEEEEEEEEEccccccHHHHHHHHHHcHHHHHHHHccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccccHHHHHHcccccc
TLMKSFQILTtcnfryascpSLYAVELineplspgvsleRLNKYYKAGYdavrnhspTAYVVMSsriepidpsglgpmdprdprelfpltsdlngsvidvhyynsnksmtvQQNIDFVCTNrsaqlnqittpdgplifvgewvaelpvpeaskEDLQRFAKAQQEVYGNATFGWGYWTLKTLNNERKHWSLEWMIENGYIKL
TLMKSFQILTTCNFRYASCPSLYAVELINEPLSPGVSLERLNKYYKAGYDAVRNHSPTAYVVMSSRIEPIDPSGLGPMDPRDPRELFPLTSDLNGSVIDVHYYNSNKSMTVQQNIDFVCTNRSAQLNQITTPDGPLIFVGEWVAELPVPEASKEDLQRFAKAQQEVYGNATFGWGYWTLKTLNNerkhwslewmiengyikl
TLMKSFQILTTCNFRYASCPSLYAVELINEPLSPGVSLERLNKYYKAGYDAVRNHSPTAYVVMSSRIEPIDPSGLGPMDPRDPRELFPLTSDLNGSVIDVHYYNSNKSMTVQQNIDFVCTNRSAQLNQITTPDGPLIFVGEWVAELPVPEASKEDLQRFAKAQQEVYGNATFGWGYWTLKTLNNERKHWSLEWMIENGYIKL
*****FQILTTCNFRYASCPSLYAVELINEPLSPGVSLERLNKYYKAGYDAVRNHSPTAYVVM***********************FPLTSDLNGSVIDVHYYNSNKSMTVQQNIDFVCTNRSAQLNQITTPDGPLIFVGEWVAELPVPE****DLQRFAKAQQEVYGNATFGWGYWTLKTLNNERKHWSLEWMIENGYI**
TLMKSFQILTTCNFRYASCPSLYAVELINEPLSPGVSLERLNKYYKAGYDAVRNHSPTAYVVMSSRIEPIDPSGLGPMDPRDPRELFPLTSDLNGSVIDVHYYNSNKSMTVQQNIDFVCTNRSAQLNQITTPDGPLIFVGEWVAELPVPEASKEDLQRFAKAQQEVYGNATFGWGYWTLKTLNNERKHWSLEWMIENGYIKL
TLMKSFQILTTCNFRYASCPSLYAVELINEPLSPGVSLERLNKYYKAGYDAVRNHSPTAYVVMSSRIEPIDPSGLGPMDPRDPRELFPLTSDLNGSVIDVHYYNSNKSMTVQQNIDFVCTNRSAQLNQITTPDGPLIFVGEWVAELPVPEASKEDLQRFAKAQQEVYGNATFGWGYWTLKTLNNERKHWSLEWMIENGYIKL
TLMKSFQILTTCNFRYASCPSLYAVELINEPLSPGVSLERLNKYYKAGYDAVRNHSPTAYVVMSSRIEPIDPSGLGPMDPRDPRELFPLTSDLNGSVIDVHYYNSNKSMTVQQNIDFVCTNRSAQLNQITTPDGPLIFVGEWVAELPVPEASKEDLQRFAKAQQEVYGNATFGWGYWTLKTLNNERKHWSLEWMIENGYIKL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TLMKSFQILTTCNFRYASCPSLYAVELINEPLSPGVSLERLNKYYKAGYDAVRNHSPTAYVVMSSRIEPIDPSGLGPMDPRDPRELFPLTSDLNGSVIDVHYYNSNKSMTVQQNIDFVCTNRSAQLNQITTPDGPLIFVGEWVAELPVPEASKEDLQRFAKAQQEVYGNATFGWGYWTLKTLNNERKHWSLEWMIENGYIKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query202 2.2.26 [Sep-21-2011]
Q0CR35416 Probable glucan 1,3-beta- N/A no 0.886 0.430 0.253 3e-06
Q12725421 Glucan 1,3-beta-glucosida yes no 0.801 0.384 0.222 3e-05
Q7Z9L3405 Glucan 1,3-beta-glucosida yes no 0.856 0.427 0.213 4e-05
B8N151405 Probable glucan 1,3-beta- N/A no 0.856 0.427 0.213 4e-05
Q96V64426 Glucan 1,3-beta-glucosida N/A no 0.792 0.375 0.228 0.0003
A2RAR6416 Probable glucan 1,3-beta- yes no 0.599 0.290 0.251 0.0004
Q12700425 Glucan 1,3-beta-glucosida N/A no 0.405 0.192 0.268 0.0008
>sp|Q0CR35|EXGA_ASPTN Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=exgA PE=3 SV=1 Back     alignment and function desciption
 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 92/241 (38%), Gaps = 62/241 (25%)

Query: 1   TLMKSFQILTTCNFRYA-SCPSLYAVELINEPLSPG-VSLERLNKYYKAGYDAVRNHSPT 58
           TL ++         RY  S   + A+E +NEP  PG V+ ++L +YY+  YD V   SP 
Sbjct: 179 TLGQTVNAFRKLAERYVPSSDVVTAIEAVNEPFIPGGVNEDQLKEYYQQAYDIVTQMSPD 238

Query: 59  AYVVMSSRIEPIDPSGLGPMDPRDPRELFPLTSDLNGSVIDVHYYNSNK----SMTVQQN 114
             +V S     I+P+         P   F   SD    V+D H+Y         M+V  +
Sbjct: 239 VDLVFSDGF--INPT---------PWNGF--ISDSGNIVMDNHHYEVFDINLLRMSVDDH 285

Query: 115 IDFVCTNRSAQLNQITTPDGPLIFVGEWVAEL---------------------------- 146
           +  VC     QL   T P    + VGEW   +                            
Sbjct: 286 VRSVCDFGRTQLAPATKP----VVVGEWTGAMTDCARYLNGRGVGARYDGAMGGESVGDC 341

Query: 147 -PVPEASKEDL--------QRFAKAQQEVYGNATFGWGYWTLKTLNNERKHWSLEWMIEN 197
            P  + S  DL        +RF +AQ + +     GW +W  KT       W ++ +++N
Sbjct: 342 GPFIQGSVSDLSPDDQKNMRRFIEAQLDAW-EMKSGWLFWNWKT-EQGAPGWDMKDLLDN 399

Query: 198 G 198
           G
Sbjct: 400 G 400
Beta-glucanases participate in the metabolism of beta-glucan, the main structural component of the cell wall. It could also function biosynthetically as a transglycosylase.
Aspergillus terreus (strain NIH 2624 / FGSC A1156) (taxid: 341663)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 5EC: 8
>sp|Q12725|EXG_YARLI Glucan 1,3-beta-glucosidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EXG1 PE=3 SV=2 Back     alignment and function description
>sp|Q7Z9L3|EXGA_ASPOR Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=exgA PE=1 SV=1 Back     alignment and function description
>sp|B8N151|EXGA_ASPFN Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=exgA PE=3 SV=1 Back     alignment and function description
>sp|Q96V64|EXG_BLUGR Glucan 1,3-beta-glucosidase OS=Blumeria graminis PE=3 SV=1 Back     alignment and function description
>sp|A2RAR6|EXGA_ASPNC Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=exgA PE=3 SV=1 Back     alignment and function description
>sp|Q12700|EXG_SCHOC Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
255545648 506 conserved hypothetical protein [Ricinus 0.925 0.369 0.648 1e-66
356548252 506 PREDICTED: glucan 1,3-beta-glucosidase A 0.930 0.371 0.621 2e-65
225459360 508 PREDICTED: probable glucan 1,3-beta-gluc 0.925 0.368 0.619 1e-63
356548266 508 PREDICTED: probable glucan 1,3-beta-gluc 0.925 0.368 0.594 3e-62
357489413 483 Glucan 1,3-beta-glucosidase [Medicago tr 0.925 0.387 0.585 1e-61
388494108235 unknown [Lotus japonicus] 0.940 0.808 0.563 1e-59
388508714 505 unknown [Medicago truncatula] 0.930 0.372 0.543 7e-56
357489425 505 Glucan 1,3-beta-glucosidase [Medicago tr 0.930 0.372 0.543 7e-56
242090031 539 hypothetical protein SORBIDRAFT_09g00817 0.925 0.346 0.541 3e-55
356552862 498 PREDICTED: probable glucan 1,3-beta-gluc 0.945 0.383 0.536 5e-53
>gi|255545648|ref|XP_002513884.1| conserved hypothetical protein [Ricinus communis] gi|223546970|gb|EEF48467.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 133/205 (64%), Positives = 150/205 (73%), Gaps = 18/205 (8%)

Query: 2   LMKSFQILTTCNFRYASCPSLYAVELINEPLSPGVSLERLNKYYKAGYDAVRNHSPTAYV 61
           + ++  I+     RYA   SLYAVELINEPLSPG SLER+ KYY+AGY+AVR HS TAYV
Sbjct: 316 IQQTVDIIDFLTARYAKSSSLYAVELINEPLSPGASLERVTKYYQAGYNAVRKHSSTAYV 375

Query: 62  VMSSRIEPIDPSGLGPMDPRDPRELFPLTSDLNGSVIDVHYYNSNKS----MTVQQNIDF 117
           VMS+R           +   + RELFPL S L+G+VIDVHYYN   S    MTVQQNIDF
Sbjct: 376 VMSNR-----------LGSDEARELFPLASGLSGTVIDVHYYNLFSSIFDDMTVQQNIDF 424

Query: 118 VCTNRSAQLNQITTPDGPLIFVGEWVAELPVPEASKEDLQRFAKAQQEVYGNATFGWGYW 177
           V TNRSAQLN +TT +GPL FVGEWVAE  V  A+KED QRFAKAQ EVYG ATFGW YW
Sbjct: 425 VNTNRSAQLNFVTTSNGPLTFVGEWVAEWQVSGATKEDYQRFAKAQLEVYGRATFGWAYW 484

Query: 178 TLKTLNNERKHWSLEWMIENGYIKL 202
           TLK +NN   HWSLEWMI+NGYIKL
Sbjct: 485 TLKNVNN---HWSLEWMIKNGYIKL 506

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356548252|ref|XP_003542517.1| PREDICTED: glucan 1,3-beta-glucosidase A-like [Glycine max] Back     alignment and taxonomy information
>gi|225459360|ref|XP_002285806.1| PREDICTED: probable glucan 1,3-beta-glucosidase A [Vitis vinifera] gi|302141928|emb|CBI19131.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356548266|ref|XP_003542524.1| PREDICTED: probable glucan 1,3-beta-glucosidase A-like [Glycine max] Back     alignment and taxonomy information
>gi|357489413|ref|XP_003614994.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] gi|355516329|gb|AES97952.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] Back     alignment and taxonomy information
>gi|388494108|gb|AFK35120.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388508714|gb|AFK42423.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357489425|ref|XP_003615000.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] gi|355516335|gb|AES97958.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] Back     alignment and taxonomy information
>gi|242090031|ref|XP_002440848.1| hypothetical protein SORBIDRAFT_09g008170 [Sorghum bicolor] gi|241946133|gb|EES19278.1| hypothetical protein SORBIDRAFT_09g008170 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|356552862|ref|XP_003544781.1| PREDICTED: probable glucan 1,3-beta-glucosidase A-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
CGD|CAL0006153438 XOG1 [Candida albicans (taxid: 0.272 0.125 0.312 0.00011
UNIPROTKB|P29717438 XOG1 "Glucan 1,3-beta-glucosid 0.272 0.125 0.312 0.00011
SGD|S000005716445 SPR1 "Sporulation-specific exo 0.242 0.110 0.352 0.00021
CGD|CAL0006153 XOG1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
 Score = 81 (33.6 bits), Expect = 0.00011, Sum P(2) = 0.00011
 Identities = 20/64 (31%), Positives = 32/64 (50%)

Query:   135 PLIFVGEWVAELPVPEASKEDLQRFAKAQQEVYGNATFGWGYWTLKTLNNERKHWSLEWM 194
             PL+ + +W  E       K D +R+ +AQ + +   T GW +W+ KT N     WS + +
Sbjct:   366 PLLDISQWSDE------HKTDTRRYIEAQLDAF-EYTGGWVFWSWKTEN--APEWSFQTL 416

Query:   195 IENG 198
               NG
Sbjct:   417 TYNG 420
GO:0009986 "cell surface" evidence=IDA
GO:0005576 "extracellular region" evidence=IDA
GO:0004338 "glucan exo-1,3-beta-glucosidase activity" evidence=IGI;IDA;IMP
GO:0031505 "fungal-type cell wall organization" evidence=IMP
GO:0031589 "cell-substrate adhesion" evidence=IDA
GO:0050839 "cell adhesion molecule binding" evidence=IDA
GO:0006073 "cellular glucan metabolic process" evidence=IMP
GO:0009277 "fungal-type cell wall" evidence=IEA
GO:0046557 "glucan endo-1,6-beta-glucosidase activity" evidence=IEA
GO:0044407 "single-species biofilm formation in or on host organism" evidence=IMP
GO:0044011 "single-species biofilm formation on inanimate substrate" evidence=IMP
UNIPROTKB|P29717 XOG1 "Glucan 1,3-beta-glucosidase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
SGD|S000005716 SPR1 "Sporulation-specific exo-1,3-beta-glucanase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00015266001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (508 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 202
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 99.87
COG2730407 BglC Endoglucanase [Carbohydrate transport and met 99.5
PRK10150604 beta-D-glucuronidase; Provisional 98.6
smart00633254 Glyco_10 Glycosyl hydrolase family 10. 98.26
PF1287688 Cellulase-like: Sugar-binding cellulase-like; Inte 98.01
PF02836298 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM 97.78
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 97.46
COG3934 587 Endo-beta-mannanase [Carbohydrate transport and me 97.37
PF11790239 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; 97.24
PF00331320 Glyco_hydro_10: Glycosyl hydrolase family 10; Inte 96.95
COG3693345 XynA Beta-1,4-xylanase [Carbohydrate transport and 96.25
COG3867403 Arabinogalactan endo-1,4-beta-galactosidase [Carbo 95.77
PF14488166 DUF4434: Domain of unknown function (DUF4434) 94.79
PF13204289 DUF4038: Protein of unknown function (DUF4038); PD 94.24
PF14587384 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; P 94.01
PF02449374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 93.94
PRK09525 1027 lacZ beta-D-galactosidase; Reviewed 93.9
PF01229 486 Glyco_hydro_39: Glycosyl hydrolases family 39; Int 91.19
KOG2233 666 consensus Alpha-N-acetylglucosaminidase [Intracell 89.56
PRK10340 1021 ebgA cryptic beta-D-galactosidase subunit alpha; R 86.8
PF02055496 Glyco_hydro_30: O-Glycosyl hydrolase family 30; In 84.37
PF03662319 Glyco_hydro_79n: Glycosyl hydrolase family 79, N-t 82.72
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information 
Probab=99.87  E-value=7.6e-22  Score=162.97  Aligned_cols=163  Identities=20%  Similarity=0.284  Sum_probs=108.6

Q ss_pred             HHHHHHHHHHHHhCCCCceeEEEeecCCCCCCCC-------hHHHHHHHHHHHHHHHhcCCCcEEEEcCC-CCCCCCCCC
Q 043245            4 KSFQILTTCNFRYASCPSLYAVELINEPLSPGVS-------LERLNKYYKAGYDAVRNHSPTAYVVMSSR-IEPIDPSGL   75 (202)
Q Consensus         4 ~t~~~~~~ia~~y~~~~~v~g~ellNEP~~~~~~-------~~~l~~~y~~a~~~IR~~~~~~~iii~d~-~~~~~~~~~   75 (202)
                      ...++|+.||+||++++.|+||||+|||.....+       ...+.+||++++++||+++|+++|++++. |..      
T Consensus       104 ~~~~~~~~la~~y~~~~~v~~~el~NEP~~~~~~~~w~~~~~~~~~~~~~~~~~~Ir~~~~~~~i~~~~~~~~~------  177 (281)
T PF00150_consen  104 WFKSFWRALAKRYKDNPPVVGWELWNEPNGGNDDANWNAQNPADWQDWYQRAIDAIRAADPNHLIIVGGGGWGA------  177 (281)
T ss_dssp             HHHHHHHHHHHHHTTTTTTEEEESSSSGCSTTSTTTTSHHHTHHHHHHHHHHHHHHHHTTSSSEEEEEEHHHHT------
T ss_pred             HHHhhhhhhccccCCCCcEEEEEecCCccccCCccccccccchhhhhHHHHHHHHHHhcCCcceeecCCCcccc------
Confidence            4467899999999999999999999999973221       27889999999999999999999988763 321      


Q ss_pred             CCCCCCCCCC-cCCC-CCCCCceeeeecceeeec---CCC--ccchHHHHHHhhHHHhhhhcCCCCCceEEeeeeccCCC
Q 043245           76 GPMDPRDPRE-LFPL-TSDLNGSVIDVHYYNSNK---SMT--VQQNIDFVCTNRSAQLNQITTPDGPLIFVGEWVAELPV  148 (202)
Q Consensus        76 ~~~~~~~~~~-~~~~-~~~~~nvv~d~H~Y~~~~---~~~--~~~~i~~~~~~~~~~l~~~~~~~~~p~~vGEws~~~~~  148 (202)
                            +... .... .....++++++|.|.++.   ...  .......+...-...+ ....+.+.|++|||||+....
T Consensus       178 ------~~~~~~~~~P~~~~~~~~~~~H~Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~g~pv~~gE~G~~~~~  250 (281)
T PF00150_consen  178 ------DPDGAAADNPNDADNNDVYSFHFYDPYDFSDQWNPGNWGDASALESSFRAAL-NWAKKNGKPVVVGEFGWSNND  250 (281)
T ss_dssp             ------BHHHHHHHSTTTTTTSEEEEEEEETTTCHHTTTSTCSHHHHHHHHHHHHHHH-HHHHHTTSEEEEEEEESSTTT
T ss_pred             ------ccchhhhcCcccccCceeEEeeEeCCCCcCCccccccchhhhHHHHHHHHHH-HHHHHcCCeEEEeCcCCcCCC
Confidence                  1111 1111 124689999999999862   111  0111111111111111 122346789999999997432


Q ss_pred             CccCHHHHHHHHHHHHHHHhhCCccEEEEecccCC
Q 043245          149 PEASKEDLQRFAKAQQEVYGNATFGWGYWTLKTLN  183 (202)
Q Consensus       149 ~~~~~~~~~~~~~~Q~~~~~~~~~Gw~fWt~K~e~  183 (202)
                       +.   ...++..+.++.+++.++||+||+||.++
T Consensus       251 -~~---~~~~~~~~~~~~~~~~~~g~~~W~~~~~~  281 (281)
T PF00150_consen  251 -GN---GSTDYADAWLDYLEQNGIGWIYWSWKPNS  281 (281)
T ss_dssp             -SC---HHHHHHHHHHHHHHHTTCEEEECEESSSS
T ss_pred             -CC---cCHHHHHHHHHHHHHCCCeEEEEecCCCC
Confidence             11   22344555578888889999999999763

2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 5 GH5 from CAZY comprises enzymes with several known activities; endoglucanase (3.2.1.4 from EC); beta-mannanase (3.2.1.78 from EC); exo-1,3-glucanase (3.2.1.58 from EC); endo-1,6-glucanase (3.2.1.75 from EC); xylanase (3.2.1.8 from EC); endoglycoceramidase (3.2.1.123 from EC). The microbial degradation of cellulose and xylans requires several types of enzymes. Fungi and bacteria produces a spectrum of cellulolytic enzymes (cellulases) and xylanases which, on the basis of sequence similarities, can be classified into families. One of these families is known as the cellulase family A [] or as the glycosyl hydrolases family 5 []. One of the conserved regions in this family contains a conserved glutamic acid residue which is potentially involved [] in the catalytic mechanism.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3NDY_A 3NDZ_B 1LF1_A 1TVP_B 1TVN_A 3AYR_A 3AYS_A 1QI0_A 1W3K_A 1OCQ_A ....
>COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10150 beta-D-glucuronidase; Provisional Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information
>PF12876 Cellulase-like: Sugar-binding cellulase-like; InterPro: IPR024778 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02836 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM barrel domain; InterPro: IPR006103 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG3934 Endo-beta-mannanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11790 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; InterPro: IPR024655 This entry represents the glycosyl hydrolase catalytic core of a group of uncharacterised proteins Back     alignment and domain information
>PF00331 Glyco_hydro_10: Glycosyl hydrolase family 10; InterPro: IPR001000 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG3693 XynA Beta-1,4-xylanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14488 DUF4434: Domain of unknown function (DUF4434) Back     alignment and domain information
>PF13204 DUF4038: Protein of unknown function (DUF4038); PDB: 3KZS_D Back     alignment and domain information
>PF14587 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; PDB: 3CLW_B Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK09525 lacZ beta-D-galactosidase; Reviewed Back     alignment and domain information
>PF01229 Glyco_hydro_39: Glycosyl hydrolases family 39; InterPro: IPR000514 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG2233 consensus Alpha-N-acetylglucosaminidase [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10340 ebgA cryptic beta-D-galactosidase subunit alpha; Reviewed Back     alignment and domain information
>PF02055 Glyco_hydro_30: O-Glycosyl hydrolase family 30; InterPro: IPR001139 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF03662 Glyco_hydro_79n: Glycosyl hydrolase family 79, N-terminal domain ; InterPro: IPR005199 O-Glycosyl hydrolases 3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 2e-22
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 7e-20
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 7e-16
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 3e-15
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 4e-14
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 5e-12
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 1e-09
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 1e-07
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 2e-07
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 4e-07
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 1e-06
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 4e-06
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 4e-06
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 5e-06
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 2e-05
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 2e-05
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 3e-04
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 3e-04
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 3e-04
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 6e-04
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 6e-04
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Length = 399 Back     alignment and structure
 Score = 92.2 bits (228), Expect = 2e-22
 Identities = 40/224 (17%), Positives = 76/224 (33%), Gaps = 51/224 (22%)

Query: 15  RYASCPSLYAV---ELINEPLSPGVSLERLNKYYKAGYDAVRNHSPTAYVVMSSRIEPID 71
           +Y        V   EL+NEPL P +++++L +++  GY+++R       V++        
Sbjct: 173 KYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHD------ 226

Query: 72  PSGLGPMDPRDPRELFPLTSDLNGSVIDVHYY----NSNKSMTVQQNIDFVC-----TNR 122
                            +       V+D H+Y        S  +  +I   C       +
Sbjct: 227 ----AAQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKK 282

Query: 123 SAQLNQITTPDGPLIFVGEWVAELPV--------------------------PEASKEDL 156
            +  N   +    L    +W+  +                             +  K D 
Sbjct: 283 ESHWNVAGSWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDT 342

Query: 157 QRFAKAQQEVYGNATFGWGYWTLKTLNNERKHWSLEWMIENGYI 200
           +R+ +AQ + +   T GW +W+ KT N     WS + +  NG  
Sbjct: 343 RRYIEAQLDAF-EYTGGWVFWSWKTENAP--EWSFQTLTYNGLF 383
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Length = 408 Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Length = 343 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Length = 317 Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Length = 341 Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Length = 320 Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Length = 358 Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Length = 345 Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Length = 327 Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Length = 305 Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Length = 302 Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Length = 306 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Length = 395 Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Length = 303 Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Length = 376 Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Length = 345 Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Length = 293 Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Length = 481 Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Length = 291 Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Length = 458 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 100.0
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 100.0
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 99.92
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 99.91
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 99.9
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 99.9
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 99.89
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 99.89
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 99.88
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 99.88
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 99.88
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 99.87
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 99.87
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 99.86
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 99.86
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 99.86
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 99.86
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 99.86
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 99.86
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 99.86
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 99.85
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 99.85
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 99.85
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 99.85
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 99.83
1wky_A 464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 99.83
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 99.83
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 99.82
2y8k_A 491 Arabinoxylanase, carbohydrate binding family 6; hy 99.78
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 99.64
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 99.6
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 99.57
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 99.56
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 99.54
4awe_A387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 99.36
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 99.3
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 99.14
3lpf_A605 Beta-glucuronidase; alpha/beta barrel, sugar-bindi 98.92
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 98.69
3fn9_A 692 Putative beta-galactosidase; structural genomics, 98.51
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 98.49
3cmg_A 667 Putative beta-galactosidase; structural genomics, 98.38
4ekj_A 500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 98.24
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 98.18
3cui_A315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 98.15
1nq6_A302 XYS1; glycoside hydrolase family 10, xylanase, xyl 97.99
1xyz_A347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 97.86
3civ_A343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 97.84
1w91_A 503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 97.72
1v0l_A313 Endo-1,4-beta-xylanase A; glycoside hydrolase fami 97.67
1ta3_B303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 97.65
2dep_A356 Xylanase B, thermostable celloxylanase; glycosidas 97.65
1us2_A530 Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca 97.65
1uhv_A 500 Beta-xylosidase; family 39 glycoside hydrolase, xy 97.59
2d1z_A 436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 97.5
1w32_A348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 97.34
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 97.33
2w61_A 555 GAS2P, glycolipid-anchored surface protein 2; glyc 97.31
1ur1_A378 Endoxylanase; hydrolase, family 10, glycoside hydr 97.3
2uwf_A356 Endoxylanase, alkaline active endoxylanase; hydrol 97.27
1r85_A379 Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A 97.1
3niy_A341 Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 97.08
2je8_A 848 Beta-mannosidase; glycoside hydrolase, hydrolase; 97.08
3oba_A 1032 Beta-galactosidase; TIM barrel, tetramer, GH2, gly 96.99
2c7f_A 513 Alpha-L-arabinofuranosidase; glycosidase, xylan, a 96.98
1qw9_A 502 Arabinosidase, alpha-L-arabinofuranosidase; hydrol 96.96
1i1w_A303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 96.93
2w5f_A540 Endo-1,4-beta-xylanase Y; cellulosome, glycosidase 96.86
1n82_A331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 96.74
3vny_A 488 Beta-glucuronidase; TIM barrel, greek-KEY, glycosi 96.65
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 96.61
3ug3_A 504 Alpha-L-arabinofuranosidase; TIM barrel, hydrolase 96.28
2y2w_A 574 Arabinofuranosidase; hydrolase, arabinoxylan, glyc 96.26
3emz_A331 Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba 96.07
3clw_A 507 Conserved exported protein; structural genomics, u 96.02
3u7b_A327 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 95.87
2vrq_A 496 Alpha-L-arabinofuranosidase; hydrolase, glycosidas 95.15
1jz7_A 1023 Lactase, beta-galactosidase, LACZ; TIM barrel (alp 95.09
1yq2_A 1024 Beta-galactosidase; glycosyl hydrolase family 2, T 95.02
3gm8_A 801 Glycoside hydrolase family 2, candidate beta-GLYC; 94.96
3bga_A 1010 Beta-galactosidase; NYSGXRC, protein structure ini 94.94
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 94.9
4aw7_A 591 GH86A beta-porphyranase; hydrolase, porphyran-hexa 94.74
4h41_A340 Putative alpha-L-fucosidase; hydrolase, carbohydra 94.21
4f8x_A335 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 93.93
2vzs_A 1032 CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, 92.81
2y24_A383 Xylanase; hydrolase, GH5 family, aldotetraouronic 91.45
2ddx_A333 Beta-1,3-xylanase; glycoside hydrolase, TIM barrel 91.05
3ik2_A 517 Endoglucanase A; TIM-like barrel, hydrolase; 2.20A 91.05
2nt0_A497 Glucosylceramidase; cerezyme, glucocerebrosidase, 90.89
2v3g_A283 Endoglucanase H; beta-1 4 beta-1 3 glucanase, lich 90.26
3ro8_A341 Endo-1,4-beta-xylanase; glycosyl hydrolase family 88.25
3kzs_A 463 Glycosyl hydrolase family 5; structural genomics, 88.2
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 88.03
3d3a_A 612 Beta-galactosidase; protein structure initiative I 87.07
2xhy_A 479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 86.74
1tg7_A 971 Beta-galactosidase; TIM barrel domain, glycoside h 85.73
3ii1_A 535 Cellulase; CELM2, glucanase-xyanase, glucanase, xy 80.7
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
Probab=100.00  E-value=1.1e-43  Score=307.15  Aligned_cols=183  Identities=23%  Similarity=0.459  Sum_probs=155.4

Q ss_pred             CHHHHHHHHHHHHHHhCCC---CceeEEEeecCCCCCCCChHHHHHHHHHHHHHHHhcCCCcEEEEcCCCCCCCCCCCCC
Q 043245            1 TLMKSFQILTTCNFRYASC---PSLYAVELINEPLSPGVSLERLNKYYKAGYDAVRNHSPTAYVVMSSRIEPIDPSGLGP   77 (202)
Q Consensus         1 n~~~t~~~~~~ia~~y~~~---~~v~g~ellNEP~~~~~~~~~l~~~y~~a~~~IR~~~~~~~iii~d~~~~~~~~~~~~   77 (202)
                      ++++++++|+.||+||+++   |+|+||||+|||..+..+...|++||++++++||+++|+++|+|||+|.+        
T Consensus       159 ~~~~~~~~w~~iA~ry~~~~y~~~V~~~el~NEP~~~~~~~~~~~~~~~~a~~~IR~~~p~~~Iii~dg~~~--------  230 (399)
T 3n9k_A          159 NTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAAQV--------  230 (399)
T ss_dssp             HHHHHHHHHHHHHHHHSSGGGTTTEEEEESCSCCCGGGSCHHHHHHHHHHHHHHHHHTTCCCCEEEECTTCC--------
T ss_pred             HHHHHHHHHHHHHHHhhcccCCCceEEEEeccCCCCCCCCHHHHHHHHHHHHHHHHhcCCCCeEEEeCCCCC--------
Confidence            3678999999999999998   99999999999997546688999999999999999999999999999974        


Q ss_pred             CCCCCCCCcCCCCCCCCceeeeecceeee----cCCCccchHHHHHHhhHHHhhhhcCCCCCceEEeeeeccCCC-----
Q 043245           78 MDPRDPRELFPLTSDLNGSVIDVHYYNSN----KSMTVQQNIDFVCTNRSAQLNQITTPDGPLIFVGEWVAELPV-----  148 (202)
Q Consensus        78 ~~~~~~~~~~~~~~~~~nvv~d~H~Y~~~----~~~~~~~~i~~~~~~~~~~l~~~~~~~~~p~~vGEws~~~~~-----  148 (202)
                      .+  .|..++....+++|||||+|+|.+|    ..++.+++|+.+|+.... +   . +.+.|+||||||++++.     
T Consensus       231 ~~--~W~~~l~~~~~~~nvv~d~H~Y~~f~~~~~~~~~~~~i~~~c~~~~~-~---~-~~~~~~ivGEwS~a~~dc~~~l  303 (399)
T 3n9k_A          231 FG--YWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWD-A---K-KESHWNVAGSWSAALTDCAKWL  303 (399)
T ss_dssp             TT--TTTTSSCGGGTCCSEEEEEECCSCSSHHHHTSCHHHHHHHHHHHHHH-H---H-TCSSEEEEEECCSCSSSCSTTT
T ss_pred             hH--HHHhhcccccCCCCEEEEeccccCCCcccccCCHHHHHHHHHHHHHH-H---h-cCCCCEEEEecccccccchhhc
Confidence            22  3356665433679999999999999    468899999999986543 2   2 34579999999999741     


Q ss_pred             -------------------------------CccCHHHHHHHHHHHHHHHhhCCccEEEEecccCCCCCCCCChHHHHhC
Q 043245          149 -------------------------------PEASKEDLQRFAKAQQEVYGNATFGWGYWTLKTLNNERKHWSLEWMIEN  197 (202)
Q Consensus       149 -------------------------------~~~~~~~~~~~~~~Q~~~~~~~~~Gw~fWt~K~e~~~~~~Ws~~~~~~~  197 (202)
                                                     ++++++.+|+|+++|+++|++ +.||+|||||+|++  ++|||++++++
T Consensus       304 ng~~~g~r~~gt~~~~~~~g~c~~~~~~~~~~~~~k~~~~~f~~aQ~~~~e~-~~Gw~fWtwK~e~~--~~W~~~~~~~~  380 (399)
T 3n9k_A          304 NGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEY-TGGWVFWSWKTENA--PEWSFQTLTYN  380 (399)
T ss_dssp             TCTTCCCTTBTCSTTCCBCCCSGGGSSGGGCCHHHHHHHHHHHHHHHHHHHT-TTEEEESCSCCSSC--GGGCHHHHHHT
T ss_pred             cCCCccccccccCCCCCcCCcCcCcCccccccHHHHHHHHHHHHHHHHHHHc-CCcEEEeeeecCCC--CCCCHHHHHhC
Confidence                                           112467899999999999997 67999999999975  99999999999


Q ss_pred             CCcc
Q 043245          198 GYIK  201 (202)
Q Consensus       198 G~i~  201 (202)
                      |+||
T Consensus       381 g~~p  384 (399)
T 3n9k_A          381 GLFP  384 (399)
T ss_dssp             TCSC
T ss_pred             CCcC
Confidence            9997
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Back     alignment and structure
>3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* Back     alignment and structure
>1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A Back     alignment and structure
>3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A Back     alignment and structure
>2je8_A Beta-mannosidase; glycoside hydrolase, hydrolase; HET: B3P; 1.7A {Bacteroides thetaiotaomicron} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2vr4_A* 2vl4_A* 2vmf_A* 2vo5_A* 2vot_A* 2vqt_A* 2vjx_A* 2vqu_A* 2wbk_A* Back     alignment and structure
>3oba_A Beta-galactosidase; TIM barrel, tetramer, GH2, glycosidase, hydrolase; 2.75A {Kluyveromyces lactis} PDB: 3ob8_A Back     alignment and structure
>2c7f_A Alpha-L-arabinofuranosidase; glycosidase, xylan, arabinan, hydrolase; HET: AHR; 2.7A {Clostridium thermocellum} SCOP: b.71.1.2 c.1.8.3 PDB: 2c8n_A Back     alignment and structure
>1qw9_A Arabinosidase, alpha-L-arabinofuranosidase; hydrolase; HET: KHP; 1.20A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 1pz2_A* 1qw8_A* 1pz3_A Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>2w5f_A Endo-1,4-beta-xylanase Y; cellulosome, glycosidase, xylan degradation, hydrolase; HET: XYP; 1.90A {Clostridium thermocellum} PDB: 2wze_A* 2wys_A* Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>3vny_A Beta-glucuronidase; TIM barrel, greek-KEY, glycoside hydrolase family 79, hydrol; 1.50A {Acidobacterium capsulatum} PDB: 3vnz_A* 3vo0_A* Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>3ug3_A Alpha-L-arabinofuranosidase; TIM barrel, hydrolase; 1.80A {Thermotoga maritima} PDB: 3ug4_A* 3ug5_A* 3s2c_A 4atw_A Back     alignment and structure
>2y2w_A Arabinofuranosidase; hydrolase, arabinoxylan, glycoside hydrolase family 51; 2.50A {Bifidobacterium longum} Back     alignment and structure
>3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* Back     alignment and structure
>3clw_A Conserved exported protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} Back     alignment and structure
>2vrq_A Alpha-L-arabinofuranosidase; hydrolase, glycosidase; HET: XYP; 2.00A {Thermobacillus xylanilyticus} PDB: 2vrk_A Back     alignment and structure
>1jz7_A Lactase, beta-galactosidase, LACZ; TIM barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase; HET: GAL; 1.50A {Escherichia coli} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 PDB: 1hn1_A 1jyx_A* 1jz3_A* 1jz4_A* 1jz5_A* 1jz6_A* 1dp0_A* 3iap_A* 1jz8_A* 1jyn_A* 1jyv_A* 1jyw_A* 3iaq_A* 1px3_A 1px4_A* 3czj_A* 3i3e_A 3i3d_A* 3i3b_A 3dym_A ... Back     alignment and structure
>1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 Back     alignment and structure
>3gm8_A Glycoside hydrolase family 2, candidate beta-GLYC; structural genomics, glycosidase, PSI-2, protein initiative; 2.40A {Bacteroides vulgatus} Back     alignment and structure
>3bga_A Beta-galactosidase; NYSGXRC, protein structure initiative II (PSI-II), glycosyl hydrolase family 2, jelly-roll fold; 2.10A {Bacteroides thetaiotaomicron vpi-5482} PDB: 3dec_A Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>4aw7_A GH86A beta-porphyranase; hydrolase, porphyran-hexa-oligosaccharide, complex; HET: GLA GAL L6S AAL; 1.33A {Bacteroides plebeius} Back     alignment and structure
>4h41_A Putative alpha-L-fucosidase; hydrolase, carbohydrate metabolism, HOST glycans, structural genomics; HET: MSE 1PE PE4 PG4 PG6; 1.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} Back     alignment and structure
>2vzs_A CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, glucosamine, glycoside hydrolase; HET: GCS; 1.85A {Amycolatopsis orientalis} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2x05_A* 2x09_A* 2vzo_A 2vzt_A* 2vzv_A* 2vzu_A* Back     alignment and structure
>2y24_A Xylanase; hydrolase, GH5 family, aldotetraouronic acid; HET: XYP GCV PG4 PGE; 1.39A {Erwinia chrysanthemi} PDB: 1nof_A* Back     alignment and structure
>2ddx_A Beta-1,3-xylanase; glycoside hydrolase, TIM barrel, hydrola; 0.86A {Vibrio SP} Back     alignment and structure
>3ik2_A Endoglucanase A; TIM-like barrel, hydrolase; 2.20A {Clostridium acetobutylicum} Back     alignment and structure
>2nt0_A Glucosylceramidase; cerezyme, glucocerebrosidase, glucosylceramide, hydrolysis, disease, hydrolase; HET: NAG; 1.79A {Homo sapiens} SCOP: b.71.1.2 c.1.8.3 PDB: 1y7v_A* 2f61_A* 2j25_A* 2nsx_A* 1ogs_A* 2nt1_A* 3gxd_A* 3gxf_A* 3gxi_A* 3gxm_A* 3rik_A* 3ril_A* 2v3f_A* 2v3e_A* 2v3d_A* 2vt0_A* 2wcg_A* 2xwd_A* 2xwe_A* 2wkl_A* ... Back     alignment and structure
>2v3g_A Endoglucanase H; beta-1 4 beta-1 3 glucanase, lichenase, hydrolase, glycosidase, glycoside hydrolase family 26; HET: BGC NOY; 1.20A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 2bv9_A 2bvd_A* 2cip_A* 2cit_A* 2vi0_A* Back     alignment and structure
>3ro8_A Endo-1,4-beta-xylanase; glycosyl hydrolase family 10, GH10, (beta/alpha)8 fold, XYLA hydrolase; 1.34A {Paenibacillus SP} PDB: 3rdk_A 4e4p_A Back     alignment and structure
>3kzs_A Glycosyl hydrolase family 5; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Back     alignment and structure
>3ii1_A Cellulase; CELM2, glucanase-xyanase, glucanase, xylanase, bifunctional enzyme, hydrolase; HET: BGC; 2.25A {Uncultured bacterium} PDB: 3fw6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 202
d2pb1a1394 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast 7e-23
d1h4pa_408 c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yea 1e-20
d1ecea_358 c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellul 8e-11
d1ceoa_340 c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm 1e-07
d1h1na_305 c.1.8.3 (A:) Endocellulase EngI {Thermoascus auran 5e-06
d1edga_380 c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellu 8e-04
d1vjza_325 c.1.8.3 (A:) Endoglucanase homologue TM1752 {Therm 0.002
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Length = 394 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Exo-beta-(1,3)-glucanase
species: Yeast (Candida albicans) [TaxId: 5476]

 Score = 92.3 bits (228), Expect = 7e-23
 Identities = 41/216 (18%), Positives = 78/216 (36%), Gaps = 48/216 (22%)

Query: 20  PSLYAVELINEPLSPGVSLERLNKYYKAGYDAVRNHSPTAYVVMSSRIEPIDPSGLGPMD 79
             +  +EL+NEPL P +++++L +++  GY+++R       V++                
Sbjct: 176 DVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHD----------AFQV 225

Query: 80  PRDPRELFPLTSDLNGSVIDVHYYN----SNKSMTVQQNIDFVC---------------- 119
                    +       V+D H+Y        S  +  +I   C                
Sbjct: 226 FGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAG 285

Query: 120 ------TNRSAQLNQITTPD------GPLIFVGEWVAELPVPEAS---KEDLQRFAKAQQ 164
                 T+ +  LN +              ++G     L + + S   K D +R+ +AQ 
Sbjct: 286 EWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQL 345

Query: 165 EVYGNATFGWGYWTLKTLNNERKHWSLEWMIENGYI 200
           + +   T GW +W+ KT N     WS + +  NG  
Sbjct: 346 DAF-EYTGGWVFWSWKTENAP--EWSFQTLTYNGLF 378
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 408 Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Length = 358 Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Length = 305 Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Length = 380 Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 100.0
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 100.0
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 99.94
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 99.93
d7a3ha_300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 99.91
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 99.9
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 99.89
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 99.88
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 99.87
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 99.87
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 99.87
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 99.86
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 99.82
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 99.61
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 99.59
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 99.33
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 99.19
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 99.01
d1bhga3304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 98.73
d1uhva2346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 98.59
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 98.16
d1fh9a_312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 98.15
d1vbua1324 Xylanase {Thermotoga maritima [TaxId: 2336]} 97.92
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 97.92
d1nq6a_302 Xylanase A, catalytic core {Streptomyces halstedii 97.91
d1xyza_320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 97.82
d1n82a_330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 97.65
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 97.63
d1v0la_302 Xylanase A, catalytic core {Streptomyces lividans 97.57
d1ta3b_301 Xylanase A, catalytic core {Emericella nidulans (A 97.36
d2v3ga1273 Endoglucanase H N-terminal domain {Clostridium the 97.24
d1ur1a_350 Xylanase {Cellvibrio mixtus [TaxId: 39650]} 96.71
d1r85a_371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 96.69
d1i1wa_303 Xylanase A, catalytic core {Thermoascus aurantiacu 96.4
d1qw9a2367 Alpha-L-arabinofuranosidase, catalytic domain {Bac 96.36
d2vzsa5339 Exochitosanase CsxA {Amycolatopsis orientalis [Tax 96.09
d1jz8a5292 beta-Galactosidase, domain 3 {Escherichia coli [Ta 95.56
d1yq2a5297 beta-Galactosidase, domain 3 {Arthrobacter sp. c2- 95.41
d1w32a_346 Xylanase A, catalytic core {Pseudomonas fluorescen 94.9
d2nt0a2354 Glucosylceramidase, catalytic domain {Human (Homo 91.39
d1tg7a5354 Beta-galactosidase LacA, N-terminal domain {Penici 91.23
d1nofa2277 Glycosyl hydrolase family 5 xylanase, catalytic do 89.77
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Exo-beta-(1,3)-glucanase
species: Yeast (Candida albicans) [TaxId: 5476]

Probab=100.00  E-value=7.7e-38  Score=268.47  Aligned_cols=183  Identities=23%  Similarity=0.475  Sum_probs=149.3

Q ss_pred             CHHHHHHHHHHHHHHhCCCC---ceeEEEeecCCCCCCCChHHHHHHHHHHHHHHHhcCCCcEEEEcCCCCCCCCCCCCC
Q 043245            1 TLMKSFQILTTCNFRYASCP---SLYAVELINEPLSPGVSLERLNKYYKAGYDAVRNHSPTAYVVMSSRIEPIDPSGLGP   77 (202)
Q Consensus         1 n~~~t~~~~~~ia~~y~~~~---~v~g~ellNEP~~~~~~~~~l~~~y~~a~~~IR~~~~~~~iii~d~~~~~~~~~~~~   77 (202)
                      |+++++++|+.||+||++++   +|+||||+|||..+..+.+.|++||++++++||+++|+++|+|+++|..        
T Consensus       154 ~~~~~~~~~~~ia~~~~~~~~~~~v~g~el~NEP~~~~~~~~~~~~~~~~~~~~IR~~~~~~~I~i~~~~~~--------  225 (394)
T d2pb1a1         154 NTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQV--------  225 (394)
T ss_dssp             HHHHHHHHHHHHHHHHSSGGGTTTEEEEESCSCCCGGGSCHHHHHHHHHHHHHHHHHTTCCCCEEEECTTCC--------
T ss_pred             HHHHHHHHHHHHHHHHccCCCCCceEEEeecccCCcccccHHHHHHHHHHHHHHHHHhCCCCeEEEcCCCcc--------
Confidence            46789999999999999875   7999999999986545678999999999999999999999999999864        


Q ss_pred             CCCCCCCCcCCCCCCCCceeeeecceeee----cCCCccchHHHHHHhhHHHhhhhcCCCCCceEEeeeeccCCC-----
Q 043245           78 MDPRDPRELFPLTSDLNGSVIDVHYYNSN----KSMTVQQNIDFVCTNRSAQLNQITTPDGPLIFVGEWVAELPV-----  148 (202)
Q Consensus        78 ~~~~~~~~~~~~~~~~~nvv~d~H~Y~~~----~~~~~~~~i~~~~~~~~~~l~~~~~~~~~p~~vGEws~~~~~-----  148 (202)
                      ...|  ..++.....+.|+|||+|.|.+|    ...+..+++..+|+.....    . ....|+++|||+.+.+.     
T Consensus       226 ~~~~--~~~~~~~~~~~~vv~d~H~Y~~f~~~~~~~~~~~~i~~~~~~~~~~----~-~~~~~~~~ge~s~~~~d~~~~~  298 (394)
T d2pb1a1         226 FGYW--NNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDA----K-KESHWNVAGEWSAALTDCAKWL  298 (394)
T ss_dssp             TTTT--TTSSCGGGTCCSEEEEEECCSCSSHHHHTCCHHHHHHHHHHHHHHH----H-TCSSEEEEEECCSCSSCCSTTT
T ss_pred             hhhh--hhhccCCCCCceEEEeeecccccCCccccCCHHHHHHhhhhhhhhh----h-cccCcceeceecccchhhhhhh
Confidence            2222  44444334678999999999999    4778889999999865432    2 34468888888876531     


Q ss_pred             -------------------------------CccCHHHHHHHHHHHHHHHhhCCccEEEEecccCCCCCCCCChHHHHhC
Q 043245          149 -------------------------------PEASKEDLQRFAKAQQEVYGNATFGWGYWTLKTLNNERKHWSLEWMIEN  197 (202)
Q Consensus       149 -------------------------------~~~~~~~~~~~~~~Q~~~~~~~~~Gw~fWt~K~e~~~~~~Ws~~~~~~~  197 (202)
                                                     +.+.++.+++|+++|+++|+ .++||+|||||++.+  ++|||+.++++
T Consensus       299 ~~~~~~~~~~g~~~~~~~~Ge~~~~~d~~~~~~~~~~~~r~~~~aQ~~~~e-~~~GW~fWt~K~~~~--~~W~~~~~~~~  375 (394)
T d2pb1a1         299 NGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFE-YTGGWVFWSWKTENA--PEWSFQTLTYN  375 (394)
T ss_dssp             TCTTCCCTTBTCSTTCCBCCCSGGGSSGGGCCHHHHHHHHHHHHHHHHHHH-TTTEEEESCSCCSSC--GGGCHHHHHHT
T ss_pred             cccccccccccccCCCccccccccccChhhcCHHHHHHHHHHHHHHHHHHh-cCCcEEEeccccCCC--CCCCHHHHHHC
Confidence                                           11235678999999999998 478999999999975  89999999999


Q ss_pred             CCcc
Q 043245          198 GYIK  201 (202)
Q Consensus       198 G~i~  201 (202)
                      |+||
T Consensus       376 G~iP  379 (394)
T d2pb1a1         376 GLFP  379 (394)
T ss_dssp             TCSC
T ss_pred             CCcC
Confidence            9997
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d2v3ga1 c.1.8.3 (A:8-280) Endoglucanase H N-terminal domain {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} Back     information, alignment and structure
>d1w32a_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2nt0a2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Back     information, alignment and structure
>d1nofa2 c.1.8.3 (A:44-320) Glycosyl hydrolase family 5 xylanase, catalytic domain {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure