Citrus Sinensis ID: 043378

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MGASLMQSLSPGLKGILCSFIALCLLAEPAFGITRHCKFDIKLQNATRLCHTKSIVSVNGKFPGPRIVAREGDQLLIKVVKHVQNNISIHWHGIGQLRSGWADGPAYITQCPIQTGQGCVYNFTIVGQRGKLSPNPFAEPYKEVPLIFAIFNQALQTGGGPN
ccccHHHccHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEEccccccEEEEEEcccccccEEEEEEccEEEEEEEEcccccEEEEEcccccccccccccccccccccccccccEEEEEEEccccccEEEcccccccccEEEEEEEcHHHHHHccccc
ccccHHHccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEcccccccccEEEEEcccccccEEEEEcccEEEEEEEEcccccEccEEEcccccccHHHcccEcccEccEccccEEEEEEEcccccEEEEEcccccccccccEEEEcHHHHHHcccccc
mgaslmqslspglkGILCSFIALCLlaepafgitrhckfdiklqnatrlchtksivsvngkfpgprivareGDQLLIKVVKHVQNNISIHWHGigqlrsgwadgpayitqcpiqtgqgcvynftivgqrgklspnpfaepykevPLIFAIFNQAlqtgggpn
MGASLMQSLSPGLKGILCSFIALCLLAEPAFGITRHCKFDIKLQnatrlchtksivsvngkfpgpRIVAREGDQLLIKVVKHVQNNISIHWHGIGQLRSGWADGPAYITQCPIQTGQGCVYNFTIVGQRGKLSPNPFAEPYKEVPLIFAIFNQALQTGGGPN
MGASLMQSLSPGLKGILCSFIALCLLAEPAFGITRHCKFDIKLQNATRLCHTKSIVSVNGKFPGPRIVAREGDQLLIKVVKHVQNNISIHWHGIGQLRSGWADGPAYITQCPIQTGQGCVYNFTIVGQRGKLSPNPFAEPYKEVPLIFAIFNQALQTGGGPN
***********GLKGILCSFIALCLLAEPAFGITRHCKFDIKLQNATRLCHTKSIVSVNGKFPGPRIVAREGDQLLIKVVKHVQNNISIHWHGIGQLRSGWADGPAYITQCPIQTGQGCVYNFTIVGQRGKLSPNPFAEPYKEVPLIFAIFNQAL*******
*************KGILCSFIALCLLAEPAFGITRHCKFDIKLQNATRLCHTKSIVSVNGKFPGPRIVAREGDQLLIKVVKHVQNNISIHWHGIGQLRSGWADGPAYITQCPIQTGQGCVYNFTIVGQRGKLSPNPFAEPYKEVPLIFAIFNQALQTG****
*********SPGLKGILCSFIALCLLAEPAFGITRHCKFDIKLQNATRLCHTKSIVSVNGKFPGPRIVAREGDQLLIKVVKHVQNNISIHWHGIGQLRSGWADGPAYITQCPIQTGQGCVYNFTIVGQRGKLSPNPFAEPYKEVPLIFAIFNQALQTGGGPN
****LMQSLSPGLKGILCSFIALCLLAEPAFGITRHCKFDIKLQNATRLCHTKSIVSVNGKFPGPRIVAREGDQLLIKVVKHVQNNISIHWHGIGQLRSGWADGPAYITQCPIQTGQGCVYNFTIVGQRGKLSPNPFAEPYKEVPLIFAIFNQALQT*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGASLMQSLSPGLKGILCSFIALCLLAEPAFGITRHCKFDIKLQNATRLCHTKSIVSVNGKFPGPRIVAREGDQLLIKVVKHVQNNISIHWHGIGQLRSGWADGPAYITQCPIQTGQGCVYNFTIVGQRGKLSPNPFAEPYKEVPLIFAIFNQALQTGGGPN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query162 2.2.26 [Sep-21-2011]
Q9FJD5 577 Laccase-17 OS=Arabidopsis yes no 0.932 0.261 0.597 4e-56
O81081 573 Laccase-2 OS=Arabidopsis no no 0.808 0.228 0.585 2e-49
Q5N9X2 579 Laccase-4 OS=Oryza sativa yes no 0.820 0.229 0.536 3e-46
Q10ND7 578 Laccase-10 OS=Oryza sativ no no 0.796 0.223 0.543 4e-43
Q0IQU1 564 Laccase-22 OS=Oryza sativ no no 0.882 0.253 0.477 2e-41
Q5N9W4 547 Putative laccase-5 OS=Ory no no 0.808 0.239 0.503 3e-41
Q0DHL2 574 Laccase-12/13 OS=Oryza sa no no 0.969 0.273 0.468 2e-39
Q1PDH6 566 Laccase-16 OS=Arabidopsis no no 0.901 0.257 0.461 3e-39
O80434 558 Laccase-4 OS=Arabidopsis no no 0.888 0.258 0.446 6e-38
Q8VZA1 557 Laccase-11 OS=Arabidopsis no no 0.919 0.267 0.420 4e-36
>sp|Q9FJD5|LAC17_ARATH Laccase-17 OS=Arabidopsis thaliana GN=LAC17 PE=2 SV=1 Back     alignment and function desciption
 Score =  216 bits (551), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 110/184 (59%), Positives = 127/184 (69%), Gaps = 33/184 (17%)

Query: 12  GLKGILCSFIALCLLAEPAFGITRHCKFDIKLQNATRLCHTKSIVSVNGKFPGPRIVARE 71
            L+ +L  F  + LL +PAFGITRH   +IK+QN TRLCHTKS+VSVNG+FPGP+++ARE
Sbjct: 2   ALQLLLAVFSCVLLLPQPAFGITRHYTLEIKMQNVTRLCHTKSLVSVNGQFPGPKLIARE 61

Query: 72  GDQLLIKVVKHVQNNISIHWHGIGQLRSGWADGPAYITQCPIQTGQGCVYNFTIVGQRGK 131
           GDQ+LIKVV  V NNIS+HWHGI QLRSGWADGPAYITQCPIQTGQ  VYN+TIVGQRG 
Sbjct: 62  GDQVLIKVVNQVPNNISLHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGT 121

Query: 132 L------------------------SPNPFAEPYKEVPLIF---------AIFNQALQTG 158
           L                         P PFA+P+KEVP+IF         AI  QA QTG
Sbjct: 122 LWYHAHISWLRSTVYGPLIILPKRGVPYPFAKPHKEVPMIFGEWFNADTEAIIRQATQTG 181

Query: 159 GGPN 162
           GGPN
Sbjct: 182 GGPN 185
Lignin degradation and detoxification of lignin-derived products.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 0EC: .EC: 3EC: .EC: 2
>sp|O81081|LAC2_ARATH Laccase-2 OS=Arabidopsis thaliana GN=LAC2 PE=2 SV=1 Back     alignment and function description
>sp|Q5N9X2|LAC4_ORYSJ Laccase-4 OS=Oryza sativa subsp. japonica GN=LAC4 PE=2 SV=1 Back     alignment and function description
>sp|Q10ND7|LAC10_ORYSJ Laccase-10 OS=Oryza sativa subsp. japonica GN=LAC10 PE=2 SV=1 Back     alignment and function description
>sp|Q0IQU1|LAC22_ORYSJ Laccase-22 OS=Oryza sativa subsp. japonica GN=LAC22 PE=2 SV=2 Back     alignment and function description
>sp|Q5N9W4|LAC5_ORYSJ Putative laccase-5 OS=Oryza sativa subsp. japonica GN=LAC5 PE=3 SV=1 Back     alignment and function description
>sp|Q0DHL2|LAC12_ORYSJ Laccase-12/13 OS=Oryza sativa subsp. japonica GN=LAC12 PE=2 SV=1 Back     alignment and function description
>sp|Q1PDH6|LAC16_ARATH Laccase-16 OS=Arabidopsis thaliana GN=LAC16 PE=2 SV=2 Back     alignment and function description
>sp|O80434|LAC4_ARATH Laccase-4 OS=Arabidopsis thaliana GN=IRX12 PE=2 SV=2 Back     alignment and function description
>sp|Q8VZA1|LAC11_ARATH Laccase-11 OS=Arabidopsis thaliana GN=LAC11 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
224128342 581 predicted protein [Populus trichocarpa] 0.993 0.277 0.630 1e-59
224060169 580 predicted protein [Populus trichocarpa] 0.987 0.275 0.615 3e-59
224117198 581 predicted protein [Populus trichocarpa] 0.993 0.277 0.610 1e-58
224057692 581 predicted protein [Populus trichocarpa] 0.987 0.275 0.617 1e-58
224117196 570 predicted protein [Populus trichocarpa] 0.925 0.263 0.622 3e-58
255582055 576 laccase, putative [Ricinus communis] gi| 0.938 0.263 0.634 8e-58
147858029 611 hypothetical protein VITISV_003134 [Viti 0.987 0.261 0.615 2e-57
225435092 585 PREDICTED: laccase-17 [Vitis vinifera] 0.987 0.273 0.615 2e-57
297746143 566 unnamed protein product [Vitis vinifera] 0.876 0.250 0.648 2e-56
224128338 581 predicted protein [Populus trichocarpa] 0.993 0.277 0.6 5e-56
>gi|224128342|ref|XP_002329138.1| predicted protein [Populus trichocarpa] gi|222869807|gb|EEF06938.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 136/195 (69%), Gaps = 34/195 (17%)

Query: 1   MGASLMQSLSPGLKGILCSFIALCLLAEPAFGITRHCKFDIKLQNATRLCHTKSIVSVNG 60
           MGAS + S +  L   L SF+ L +  EPA  ITRH KFD+ LQN TRLCHTKSIV+VNG
Sbjct: 1   MGASFLPSPA-FLAVFLISFVTLSIHPEPALAITRHYKFDVMLQNVTRLCHTKSIVTVNG 59

Query: 61  KFPGPRIVAREGDQLLIKVVKHVQNNISIHWHGIGQLRSGWADGPAYITQCPIQTGQGCV 120
           KFPGPRIVAREGD+LLIKVV HVQNNISIHWHGI QLRSGWADGPAYITQCPIQTGQ  V
Sbjct: 60  KFPGPRIVAREGDRLLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYV 119

Query: 121 YNFTIVGQRGKL------------------------SPNPFAEPYKEVPLIF-------- 148
           YN+TIVGQRG L                        +  PFA+P+KEVP+IF        
Sbjct: 120 YNYTIVGQRGTLWWHAHISWLRSTLYGPLIILPKLGTTYPFAKPHKEVPIIFGEWFNADP 179

Query: 149 -AIFNQALQTGGGPN 162
            AI NQA+QTGGGPN
Sbjct: 180 EAIINQAMQTGGGPN 194

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224060169|ref|XP_002300066.1| predicted protein [Populus trichocarpa] gi|222847324|gb|EEE84871.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224117198|ref|XP_002317505.1| predicted protein [Populus trichocarpa] gi|222860570|gb|EEE98117.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224057692|ref|XP_002299296.1| predicted protein [Populus trichocarpa] gi|222846554|gb|EEE84101.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224117196|ref|XP_002317504.1| predicted protein [Populus trichocarpa] gi|222860569|gb|EEE98116.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255582055|ref|XP_002531824.1| laccase, putative [Ricinus communis] gi|223528520|gb|EEF30544.1| laccase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147858029|emb|CAN80346.1| hypothetical protein VITISV_003134 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225435092|ref|XP_002284473.1| PREDICTED: laccase-17 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297746143|emb|CBI16199.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224128338|ref|XP_002329137.1| predicted protein [Populus trichocarpa] gi|222869806|gb|EEF06937.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
TAIR|locus:2168128 577 LAC17 "laccase 17" [Arabidopsi 0.740 0.207 0.733 1.1e-54
TAIR|locus:2066117 573 LAC2 "laccase 2" [Arabidopsis 0.623 0.176 0.762 8.5e-43
TAIR|locus:2154518 566 LAC16 "laccase 16" [Arabidopsi 0.716 0.204 0.615 3.9e-39
TAIR|locus:2042842 558 IRX12 "IRREGULAR XYLEM 12" [Ar 0.703 0.204 0.586 3.2e-37
TAIR|locus:2143563 557 LAC11 "laccase 11" [Arabidopsi 0.740 0.215 0.528 1.1e-35
TAIR|locus:2150139 558 LAC10 "laccase 10" [Arabidopsi 0.691 0.200 0.587 3.5e-35
TAIR|locus:2063109 580 LAC5 "laccase 5" [Arabidopsis 0.734 0.205 0.467 7.3e-31
TAIR|locus:2194110 581 LAC1 "laccase 1" [Arabidopsis 0.722 0.201 0.470 3.9e-27
TAIR|locus:2083604 567 LAC7 "laccase 7" [Arabidopsis 0.716 0.204 0.461 1e-26
TAIR|locus:2184802 569 LAC14 "laccase 14" [Arabidopsi 0.697 0.198 0.415 6.2e-26
TAIR|locus:2168128 LAC17 "laccase 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 482 (174.7 bits), Expect = 1.1e-54, Sum P(2) = 1.1e-54
 Identities = 88/120 (73%), Positives = 102/120 (85%)

Query:    13 LKGILCSFIALCLLAEPAFGITRHCKFDIKLQNATRLCHTKSIVSVNGKFPGPRIVAREG 72
             L+ +L  F  + LL +PAFGITRH   +IK+QN TRLCHTKS+VSVNG+FPGP+++AREG
Sbjct:     3 LQLLLAVFSCVLLLPQPAFGITRHYTLEIKMQNVTRLCHTKSLVSVNGQFPGPKLIAREG 62

Query:    73 DQLLIKVVKHVQNNISIHWHGIGQLRSGWADGPAYITQCPIQTGQGCVYNFTIVGQRGKL 132
             DQ+LIKVV  V NNIS+HWHGI QLRSGWADGPAYITQCPIQTGQ  VYN+TIVGQRG L
Sbjct:    63 DQVLIKVVNQVPNNISLHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTL 122
GO:0005507 "copper ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA;IMP
GO:0046274 "lignin catabolic process" evidence=IEA
GO:0048046 "apoplast" evidence=IEA
GO:0052716 "hydroquinone:oxygen oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009698 "phenylpropanoid metabolic process" evidence=IMP
GO:0009809 "lignin biosynthetic process" evidence=IMP
GO:0009832 "plant-type cell wall biogenesis" evidence=RCA
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
TAIR|locus:2066117 LAC2 "laccase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154518 LAC16 "laccase 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042842 IRX12 "IRREGULAR XYLEM 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143563 LAC11 "laccase 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150139 LAC10 "laccase 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063109 LAC5 "laccase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2194110 LAC1 "laccase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083604 LAC7 "laccase 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184802 LAC14 "laccase 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
TIGR03389 539 TIGR03389, laccase, laccase, plant 4e-66
pfam07732119 pfam07732, Cu-oxidase_3, Multicopper oxidase 4e-38
TIGR03388 541 TIGR03388, ascorbase, L-ascorbate oxidase, plant t 6e-24
PLN02604 566 PLN02604, PLN02604, oxidoreductase 4e-22
PLN02191 574 PLN02191, PLN02191, L-ascorbate oxidase 1e-18
COG2132 451 COG2132, SufI, Putative multicopper oxidases [Seco 6e-12
PLN02991 543 PLN02991, PLN02991, oxidoreductase 4e-11
TIGR03390 538 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fu 7e-11
PLN02354 552 PLN02354, PLN02354, copper ion binding / oxidoredu 7e-10
PLN02792 536 PLN02792, PLN02792, oxidoreductase 2e-08
PLN02835 539 PLN02835, PLN02835, oxidoreductase 4e-08
PLN02168 545 PLN02168, PLN02168, copper ion binding / pectinest 2e-07
TIGR01480 587 TIGR01480, copper_res_A, copper-resistance protein 3e-07
PLN00044 596 PLN00044, PLN00044, multi-copper oxidase-related p 1e-06
>gnl|CDD|234194 TIGR03389, laccase, laccase, plant Back     alignment and domain information 
 Score =  209 bits (535), Expect = 4e-66
 Identities = 84/164 (51%), Positives = 102/164 (62%), Gaps = 33/164 (20%)

Query: 32  GITRHCKFDIKLQNATRLCHTKSIVSVNGKFPGPRIVAREGDQLLIKVVKHVQNNISIHW 91
              RH  FD++ +N TRLC TKSI++VNGKFPGP + AREGD +++ V  +VQ N++IHW
Sbjct: 1   AEVRHYTFDVQEKNVTRLCSTKSILTVNGKFPGPTLYAREGDTVIVNVTNNVQYNVTIHW 60

Query: 92  HGIGQLRSGWADGPAYITQCPIQTGQGCVYNFTIVGQRGKL------------------- 132
           HG+ QLR+GWADGPAYITQCPIQ GQ  VYNFTI GQRG L                   
Sbjct: 61  HGVRQLRNGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLWWHAHISWLRATVYGAIVI 120

Query: 133 -----SPNPFAEPYKEVPLIF---------AIFNQALQTGGGPN 162
                 P PF +P +EVP+I          A+ NQA QTGG PN
Sbjct: 121 LPKPGVPYPFPKPDREVPIILGEWWNADVEAVINQANQTGGAPN 164

Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate. Length = 539
>gnl|CDD|219542 pfam07732, Cu-oxidase_3, Multicopper oxidase Back     alignment and domain information
>gnl|CDD|234193 TIGR03388, ascorbase, L-ascorbate oxidase, plant type Back     alignment and domain information
>gnl|CDD|215324 PLN02604, PLN02604, oxidoreductase Back     alignment and domain information
>gnl|CDD|177843 PLN02191, PLN02191, L-ascorbate oxidase Back     alignment and domain information
>gnl|CDD|225043 COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215536 PLN02991, PLN02991, oxidoreductase Back     alignment and domain information
>gnl|CDD|132431 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fungal type Back     alignment and domain information
>gnl|CDD|177987 PLN02354, PLN02354, copper ion binding / oxidoreductase Back     alignment and domain information
>gnl|CDD|178389 PLN02792, PLN02792, oxidoreductase Back     alignment and domain information
>gnl|CDD|178429 PLN02835, PLN02835, oxidoreductase Back     alignment and domain information
>gnl|CDD|215113 PLN02168, PLN02168, copper ion binding / pectinesterase Back     alignment and domain information
>gnl|CDD|233432 TIGR01480, copper_res_A, copper-resistance protein, CopA family Back     alignment and domain information
>gnl|CDD|165622 PLN00044, PLN00044, multi-copper oxidase-related protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 162
PLN02991 543 oxidoreductase 100.0
PLN02835 539 oxidoreductase 100.0
PLN02354 552 copper ion binding / oxidoreductase 100.0
PLN00044 596 multi-copper oxidase-related protein; Provisional 100.0
KOG1263 563 consensus Multicopper oxidases [Secondary metaboli 100.0
PLN02168 545 copper ion binding / pectinesterase 100.0
PLN02792 536 oxidoreductase 100.0
TIGR03389 539 laccase laccase, plant. Members of this protein fa 100.0
PLN02191 574 L-ascorbate oxidase 99.97
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 99.97
PLN02604 566 oxidoreductase 99.97
TIGR03390 538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 99.97
TIGR01480 587 copper_res_A copper-resistance protein, CopA famil 99.96
TIGR03388 541 ascorbase L-ascorbate oxidase, plant type. Members 99.96
PRK10965 523 multicopper oxidase; Provisional 99.93
PRK10883 471 FtsI repressor; Provisional 99.9
TIGR02376 311 Cu_nitrite_red nitrite reductase, copper-containin 99.87
COG2132 451 SufI Putative multicopper oxidases [Secondary meta 99.68
TIGR01480587 copper_res_A copper-resistance protein, CopA famil 99.38
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 99.36
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 99.24
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 98.45
PF07731138 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR01 98.01
PRK02710119 plastocyanin; Provisional 98.0
TIGR02376311 Cu_nitrite_red nitrite reductase, copper-containin 97.53
PF00394159 Cu-oxidase: Multicopper oxidase; InterPro: IPR0011 97.52
TIGR0265783 amicyanin amicyanin. Members of this family are am 97.3
PLN02835 539 oxidoreductase 96.88
TIGR03389 539 laccase laccase, plant. Members of this protein fa 96.84
PLN02991 543 oxidoreductase 96.72
COG2132451 SufI Putative multicopper oxidases [Secondary meta 96.69
PLN02354 552 copper ion binding / oxidoreductase 96.5
PLN02792 536 oxidoreductase 96.49
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 96.41
PLN02168 545 copper ion binding / pectinesterase 95.99
PRK10965523 multicopper oxidase; Provisional 95.46
TIGR03390 538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 95.31
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 94.92
PRK02888635 nitrous-oxide reductase; Validated 94.89
COG3794128 PetE Plastocyanin [Energy production and conversio 94.89
TIGR03388 541 ascorbase L-ascorbate oxidase, plant type. Members 94.81
PLN02191 574 L-ascorbate oxidase 94.76
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 93.42
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 93.33
PLN02604 566 oxidoreductase 93.07
PLN00044 596 multi-copper oxidase-related protein; Provisional 92.81
PRK10883 471 FtsI repressor; Provisional 92.1
PF00116120 COX2: Cytochrome C oxidase subunit II, periplasmic 91.64
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 91.49
PRK10378 375 inactive ferrous ion transporter periplasmic prote 91.29
KOG1263 563 consensus Multicopper oxidases [Secondary metaboli 90.15
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 88.87
PF0550689 DUF756: Domain of unknown function (DUF756); Inter 87.14
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 86.29
PF1269082 BsuPI: Intracellular proteinase inhibitor; InterPr 85.15
>PLN02991 oxidoreductase Back     alignment and domain information 
Probab=100.00  E-value=8e-35  Score=259.98  Aligned_cols=121  Identities=30%  Similarity=0.580  Sum_probs=111.7

Q ss_pred             ccccccceEEEEEEEEEEEEecCCeeeEEEEECCCCCCceEEEecCCEEEEEEEecCCCCeeEEeeccccCCCCCCCCCc
Q 043378           27 AEPAFGITRHCKFDIKLQNATRLCHTKSIVSVNGKFPGPRIVAREGDQLLIKVVKHVQNNISIHWHGIGQLRSGWADGPA  106 (162)
Q Consensus        27 ~~~a~~~~~~~~l~i~~~~~~~~g~~~~~~~~Ng~~PGP~I~v~~Gd~v~v~v~N~l~~~~siH~HGl~~~~~~~~DG~~  106 (162)
                      +..|.+++++|+|+|++.+.++||.++++++|||++|||+|++++||+|+|+|+|+++++++|||||+++..++|+||++
T Consensus        21 ~~~~~~~~~~~~~~vt~~~~~pdG~~r~~~~vNG~~PGP~I~~~~GD~v~V~V~N~L~~~ttiHWHGi~q~~~~~~DGv~  100 (543)
T PLN02991         21 FVAAEDPYRFFEWHVTYGNISPLGVAQQGILINGKFPGPDIISVTNDNLIINVFNHLDEPFLISWSGIRNWRNSYQDGVY  100 (543)
T ss_pred             hhhccCceEEEEEEEEEEEeCCCCEEEEEEEEcCCCCCCcEEEECCCEEEEEecCCCCCCccEEECCcccCCCccccCCC
Confidence            34456789999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCccCCCCeEEEEEEeCCCcccC-------------------------CCCCCCCCCceEEEEh
Q 043378          107 YITQCPIQTGQGCVYNFTIVGQRGKL-------------------------SPNPFAEPYKEVPLIF  148 (162)
Q Consensus       107 ~vtq~~I~PG~~~tY~f~~~~~~Gt~-------------------------~~~p~p~~dre~~l~l  148 (162)
                      + +||||+||++|+|+|++++|+|||                         .+.|++.+|+|++++|
T Consensus       101 ~-tQcpI~PG~sftY~F~~~~q~GT~WYHsH~~~q~~~Gl~G~lIV~~~~~~~~p~~~~d~d~~i~l  166 (543)
T PLN02991        101 G-TTCPIPPGKNYTYALQVKDQIGSFYYFPSLGFHKAAGGFGAIRISSRPLIPVPFPAPADDYTVLI  166 (543)
T ss_pred             C-CCCccCCCCcEEEEEEeCCCCcceEEecCcchhhhCCCeeeEEEeCCcccCcccccccceeEEEe
Confidence            8 999999999999999996689999                         2235667899999999

>PLN02835 oxidoreductase Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>KOG1263 consensus Multicopper oxidases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>PF07731 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR011706 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PF00394 Cu-oxidase: Multicopper oxidase; InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>PLN02835 oxidoreductase Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>PLN02991 oxidoreductase Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>PRK10378 inactive ferrous ion transporter periplasmic protein EfeO; Provisional Back     alignment and domain information
>KOG1263 consensus Multicopper oxidases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>PF05506 DUF756: Domain of unknown function (DUF756); InterPro: IPR008475 This domain is found, normally as a tandem repeat, at the C terminus of bacterial phospholipase C proteins Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information
>PF12690 BsuPI: Intracellular proteinase inhibitor; InterPro: IPR020481 BsuPI is a intracellular proteinase inhibitor that directly regulates the major intracellular proteinase (ISP-1) activity in vivo Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
3kw7_A 502 Crystal Structure Of Lacb From Trametes Sp. Ah28-2 5e-17
2hzh_A 499 Crystal Structure Of Laccase From Coriolus Zonatus 1e-15
1aoz_A 552 Refined Crystal Structure Of Ascorbate Oxidase At 1 2e-15
1gyc_A 499 Crystal Structure Determination At Room Temperature 2e-15
1kya_A 499 Active Laccase From Trametes Versicolor Complexed W 4e-15
2qt6_A 498 Crystal Structure Determination Of A Blue Laccase F 6e-15
3v9e_A 580 Structure Of The L513m Mutant Of The Laccase From B 7e-15
3sqr_A 580 Crystal Structure Of Laccase From Botrytis Aclada A 7e-15
4a2f_A 497 Coriolopsis Gallica Laccase Collected At 12.65 Kev 9e-15
4a2d_A 496 Coriolopsis Gallica Laccase T2 Copper Depleted At P 9e-15
2hrg_A 496 Crystal Structure Of Blue Laccase From Trametes Tro 9e-15
3pxl_A 499 Type-2 Cu-Depleted Fungus Laccase From Trametes Hir 2e-14
3fpx_A 499 Native Fungus Laccase From Trametes Hirsuta Length 2e-14
3div_A 499 Crystal Structure Of Laccase From Cerrena Maxima At 3e-14
2h5u_A 499 Crystal Structure Of Laccase From Cerrena Maxima At 4e-14
2xyb_A 497 Crystal Structure Of A Fully Functional Laccase Fro 4e-14
3t6v_A 495 Crystal Structure Of Laccase From Steccherinum Ochr 4e-13
1zpu_A 534 Crystal Structure Of Fet3p, A Multicopper Oxidase T 1e-11
1hfu_A 503 Type-2 Cu-Depleted Laccase From Coprinus Cinereus A 4e-09
1a65_A 504 Type-2 Cu-depleted Laccase From Coprinus Cinereus L 4e-09
1v10_A 521 Structure Of Rigidoporus Lignosus Laccase From Hemi 7e-09
2q9o_A 559 Near-Atomic Resolution Structure Of A Melanocarpus 2e-08
1gw0_A 559 Crystal Structure Of Laccase From Melanocarpus Albo 2e-08
3dkh_A 559 L559a Mutant Of Melanocarpus Albomyces Laccase Leng 2e-08
3pps_A 604 Crystal Structure Of An Ascomycete Fungal Laccase F 3e-07
3g5w_A 318 Crystal Structure Of Blue Copper Oxidase From Nitro 5e-06
3zx1_A 481 Multicopper Oxidase From Campylobacter Jejuni: A Me 9e-05
3gdc_A 288 Crystal Structure Of Multicopper Oxidase Length = 2 2e-04
>pdb|3KW7|A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2 Length = 502 Back     alignment and structure 
Iteration: 1

 Score = 83.6 bits (205), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 40/98 (40%), Positives = 57/98 (58%), Gaps = 7/98 (7%)
Query: 40  DIKLQNA--TRLCHTKSIVSVNGKFPGPRIVAREGDQLLIKVVKHVQN-----NISIHWH 92
           D+ + NA  T    T++ V  NG FPGP I   +GD   I V+ ++ N       +IHWH
Sbjct: 7   DLTISNADVTPDGFTRAAVVANGVFPGPLITGNKGDNFQINVIDNLTNATMLKTTTIHWH 66
Query: 93  GIGQLRSGWADGPAYITQCPIQTGQGCVYNFTIVGQRG 130
           G+ Q  + WADGPA++ QCPI +G   +Y+FT+  Q G
Sbjct: 67  GLFQHGTNWADGPAFVNQCPIASGNSFLYDFTVPDQAG 104
>pdb|2HZH|A Chain A, Crystal Structure Of Laccase From Coriolus Zonatus At 2.6 A Resolution Length = 499 Back     alignment and structure
>pdb|1AOZ|A Chain A, Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution Length = 552 Back     alignment and structure
>pdb|1GYC|A Chain A, Crystal Structure Determination At Room Temperature Of A Laccase From Trametes Versicolor In Its Oxidised Form Containing A Full Complement Of Copper Ions Length = 499 Back     alignment and structure
>pdb|1KYA|A Chain A, Active Laccase From Trametes Versicolor Complexed With 2,5-Xylidine Length = 499 Back     alignment and structure
>pdb|2QT6|A Chain A, Crystal Structure Determination Of A Blue Laccase From Lentinus Tigrinus Length = 498 Back     alignment and structure
>pdb|3V9E|A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada Length = 580 Back     alignment and structure
>pdb|3SQR|A Chain A, Crystal Structure Of Laccase From Botrytis Aclada At 1.67 A Resolution Length = 580 Back     alignment and structure
>pdb|4A2F|A Chain A, Coriolopsis Gallica Laccase Collected At 12.65 Kev Length = 497 Back     alignment and structure
>pdb|4A2D|A Chain A, Coriolopsis Gallica Laccase T2 Copper Depleted At Ph 4.5 Length = 496 Back     alignment and structure
>pdb|2HRG|A Chain A, Crystal Structure Of Blue Laccase From Trametes Trogii Complexed With P-Methylbenzoate Length = 496 Back     alignment and structure
>pdb|3PXL|A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta Length = 499 Back     alignment and structure
>pdb|3FPX|A Chain A, Native Fungus Laccase From Trametes Hirsuta Length = 499 Back     alignment and structure
>pdb|3DIV|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.76a Resolution Length = 499 Back     alignment and structure
>pdb|2H5U|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.9a Resolution Length = 499 Back     alignment and structure
>pdb|2XYB|A Chain A, Crystal Structure Of A Fully Functional Laccase From The Ligninolytic Fungus Pycnoporus Cinnabarinus Length = 497 Back     alignment and structure
>pdb|3T6V|A Chain A, Crystal Structure Of Laccase From Steccherinum Ochraceum Length = 495 Back     alignment and structure
>pdb|1ZPU|A Chain A, Crystal Structure Of Fet3p, A Multicopper Oxidase That Functions In Iron Import Length = 534 Back     alignment and structure
>pdb|1HFU|A Chain A, Type-2 Cu-Depleted Laccase From Coprinus Cinereus At 1.68 A Resolution Length = 503 Back     alignment and structure
>pdb|1A65|A Chain A, Type-2 Cu-depleted Laccase From Coprinus Cinereus Length = 504 Back     alignment and structure
>pdb|1V10|A Chain A, Structure Of Rigidoporus Lignosus Laccase From Hemihedrally Twinned Crystals Length = 521 Back     alignment and structure
>pdb|2Q9O|A Chain A, Near-Atomic Resolution Structure Of A Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|1GW0|A Chain A, Crystal Structure Of Laccase From Melanocarpus Albomyces In Four Copper Form Length = 559 Back     alignment and structure
>pdb|3DKH|A Chain A, L559a Mutant Of Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|3PPS|A Chain A, Crystal Structure Of An Ascomycete Fungal Laccase From Thielavia Arenaria Length = 604 Back     alignment and structure
>pdb|3G5W|A Chain A, Crystal Structure Of Blue Copper Oxidase From Nitrosomonas Europaea Length = 318 Back     alignment and structure
>pdb|3ZX1|A Chain A, Multicopper Oxidase From Campylobacter Jejuni: A Metallo-Oxidase Length = 481 Back     alignment and structure
>pdb|3GDC|A Chain A, Crystal Structure Of Multicopper Oxidase Length = 288 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
1v10_A 521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 6e-45
3pxl_A 499 Laccase; 4-copper protein, metal-binding, oxidored 4e-44
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 2e-43
3t6v_A 495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 2e-42
1hfu_A 503 Laccase 1; oxidoreductase, blue multi-copper oxida 4e-42
3sqr_A 580 Laccase; multicopper oxidase, glycosylation, oxido 1e-41
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 4e-39
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 5e-39
2zwn_A 339 Two-domain type laccase; muticopper oxidase, oxido 6e-39
3g5w_A 318 Multicopper oxidase type 1; two domain, laccase, n 1e-37
3gdc_A 288 Multicopper oxidase; beta sandwich, plasmid, oxido 1e-20
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 1e-17
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 4e-13
2xu9_A 439 Laccase; oxidoreductase, multicopper oxidases; 1.5 2e-17
3abg_A 534 Bilirubin oxidase; cleavage on PAIR of basic resid 1e-13
3kw8_A 276 Laccase, putative copper oxidase; two-domain lacca 1e-13
3aw5_A 448 Multicopper oxidase; beta barrel, oxidoreductase; 4e-13
1sdd_A 306 Coagulation factor V; copper-binding protein, cofa 7e-13
3cg8_A 343 Laccase; oxidoreductase, multicopper blue protein; 7e-13
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 3e-12
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 9e-12
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 2e-09
3zx1_A 481 Oxidoreductase, putative; laccase, metallo-oxidase 3e-12
3od3_A 488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 9e-11
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 3e-09
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 1e-04
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 7e-09
2uxt_A 451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 2e-08
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 3e-08
1kbv_A 327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 3e-08
2bw4_A 340 Copper-containing nitrite reductase; oxidoreductas 2e-07
1oe1_A 336 Dissimilatory copper-containing nitrite reductase; 4e-07
2wsd_A 513 Spore coat protein A; oxidoreductase, multi-copper 4e-07
1mzy_A 333 Copper-containing nitrite reductase; mutant M182T, 8e-07
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 5e-05
2g23_A 612 PHS, phenoxazinone synthase; copper, metalloprotei 6e-04
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Length = 521 Back     alignment and structure
 Score =  153 bits (388), Expect = 6e-45
 Identities = 38/131 (29%), Positives = 54/131 (41%), Gaps = 12/131 (9%)

Query: 6   MQSLSPGLKGILCSFIALCLLAEPAFGITRHCKFDIKLQNAT-RLCHTKSIVSVNGKFPG 64
           M S +      L S + L L +  +   T      I   N        +S V+  G    
Sbjct: 1   MPSFA-----SLKSLVVLSLTS-LSLAATVALDLHILNANLDPDGTGARSAVTAEGTTIA 54

Query: 65  PRIVAREGDQLLIKVVKHVQN-----NISIHWHGIGQLRSGWADGPAYITQCPIQTGQGC 119
           P I     D+  I V+  + +       SIHWHG  Q  +   DGPA++ QCPI   +  
Sbjct: 55  PLITGNIDDRFQINVIDQLTDANMRRATSIHWHGFFQAGTTEMDGPAFVNQCPIIPNESF 114

Query: 120 VYNFTIVGQRG 130
           VY+F + GQ G
Sbjct: 115 VYDFVVPGQAG 125
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Length = 499 Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Length = 552 Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Length = 495 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Length = 503 Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Length = 580 Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Length = 559 Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Length = 534 Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Length = 339 Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Length = 318 Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Length = 288 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Length = 439 Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Length = 534 Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} Length = 276 Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Length = 448 Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Length = 306 Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Length = 343 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Length = 481 Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Length = 488 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Length = 442 Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Length = 451 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Length = 647 Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Length = 327 Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Length = 340 Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Length = 336 Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Length = 513 Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Length = 333 Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Length = 770 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
1v10_A 521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 99.98
3sqr_A 580 Laccase; multicopper oxidase, glycosylation, oxido 99.97
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 99.97
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 99.97
3t6v_A 495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 99.97
3pxl_A 499 Laccase; 4-copper protein, metal-binding, oxidored 99.97
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 99.96
3g5w_A 318 Multicopper oxidase type 1; two domain, laccase, n 99.96
1hfu_A 503 Laccase 1; oxidoreductase, blue multi-copper oxida 99.96
2zwn_A 339 Two-domain type laccase; muticopper oxidase, oxido 99.95
3gdc_A 288 Multicopper oxidase; beta sandwich, plasmid, oxido 99.95
2uxt_A 451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 99.95
3zx1_A 481 Oxidoreductase, putative; laccase, metallo-oxidase 99.94
3gyr_A 612 PHS, phenoxazinone synthase; metalloprotein, lacca 99.94
3od3_A 488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 99.94
2xu9_A 439 Laccase; oxidoreductase, multicopper oxidases; 1.5 99.94
2wsd_A 513 Spore coat protein A; oxidoreductase, multi-copper 99.93
3kw8_A 276 Laccase, putative copper oxidase; two-domain lacca 99.93
3t9w_A 299 Small laccase, multi-copper oxidase; two-domain co 99.93
3abg_A 534 Bilirubin oxidase; cleavage on PAIR of basic resid 99.93
2g23_A 612 PHS, phenoxazinone synthase; copper, metalloprotei 99.92
3tas_A 313 Small laccase, multi-copper oxidase; two-domain la 99.91
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 99.91
1kbv_A 327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 99.89
3aw5_A 448 Multicopper oxidase; beta barrel, oxidoreductase; 99.89
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 99.88
1mzy_A 333 Copper-containing nitrite reductase; mutant M182T, 99.86
1oe1_A 336 Dissimilatory copper-containing nitrite reductase; 99.86
2bw4_A 340 Copper-containing nitrite reductase; oxidoreductas 99.84
3cg8_A 343 Laccase; oxidoreductase, multicopper blue protein; 99.83
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.83
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 99.82
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.78
1sdd_A 306 Coagulation factor V; copper-binding protein, cofa 99.78
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 99.73
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.73
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 99.41
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 99.35
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 99.19
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 99.07
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 98.95
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 98.74
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.66
2cal_A154 Rusticyanin; iron respiratory electron transport c 98.47
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 98.37
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 98.37
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 98.33
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 98.3
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 98.21
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 98.11
3t9w_A299 Small laccase, multi-copper oxidase; two-domain co 98.09
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 98.06
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 98.03
3tas_A313 Small laccase, multi-copper oxidase; two-domain la 97.99
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 97.95
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 97.84
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 97.83
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 97.75
3c75_A132 Amicyanin; copper proteins, electron transfer comp 97.75
2g23_A612 PHS, phenoxazinone synthase; copper, metalloprotei 97.72
2uxt_A 451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 97.7
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 97.67
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 97.48
1hfu_A 503 Laccase 1; oxidoreductase, blue multi-copper oxida 97.47
1v10_A 521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 97.46
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 97.45
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 97.44
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 97.4
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 97.38
3pxl_A 499 Laccase; 4-copper protein, metal-binding, oxidored 97.3
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 97.26
3t6v_A 495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 97.21
1zpu_A534 Iron transport multicopper oxidase FET3; ferroxida 97.17
3od3_A488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 97.15
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 97.13
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 97.09
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 97.06
1byp_A99 Protein (plastocyanin); electron transfer, photosy 97.03
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 96.99
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 96.98
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 96.93
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 96.89
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 96.87
3sqr_A 580 Laccase; multicopper oxidase, glycosylation, oxido 96.82
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 96.73
3abg_A534 Bilirubin oxidase; cleavage on PAIR of basic resid 96.68
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 96.51
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 96.48
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 96.26
3gyr_A612 PHS, phenoxazinone synthase; metalloprotein, lacca 96.25
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 96.11
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 95.83
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 95.79
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 95.74
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 95.67
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 95.57
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 95.57
3aw5_A 448 Multicopper oxidase; beta barrel, oxidoreductase; 95.36
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 95.25
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 95.04
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 94.74
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 93.17
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 92.9
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 91.59
1xwv_A129 DER F II; beta sheets, allergen; HET: PE3 XPE; 1.8 82.88
1nep_A130 EPV20, BNPC2, epididymal secretory protein E1; nie 80.73
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
Probab=99.98  E-value=2.3e-32  Score=241.58  Aligned_cols=104  Identities=31%  Similarity=0.516  Sum_probs=96.5

Q ss_pred             ccccceEEEEEEEEEEEEecCCe-eeEEEEECCCCCCceEEEecCCEEEEEEEecCC-----CCeeEEeeccccCCCCCC
Q 043378           29 PAFGITRHCKFDIKLQNATRLCH-TKSIVSVNGKFPGPRIVAREGDQLLIKVVKHVQ-----NNISIHWHGIGQLRSGWA  102 (162)
Q Consensus        29 ~a~~~~~~~~l~i~~~~~~~~g~-~~~~~~~Ng~~PGP~I~v~~Gd~v~v~v~N~l~-----~~~siH~HGl~~~~~~~~  102 (162)
                      .+++..++|+|++++.++.+||. ++++|+|||++|||+|++++||+|+|+|+|+++     ++++|||||+++.+.+|+
T Consensus        18 ~~~~~~~~~~l~i~~~~~~~dg~~~~~~~~~NG~~PGP~i~~~~Gd~v~v~v~N~l~~~~~~~~tsiHwHGl~~~~~~~~   97 (521)
T 1v10_A           18 LSLAATVALDLHILNANLDPDGTGARSAVTAEGTTIAPLITGNIDDRFQINVIDQLTDANMRRATSIHWHGFFQAGTTEM   97 (521)
T ss_dssp             ----CCSEEEEEEEEEEECTTSSCCEEEEEESSSSSCCCEEEETTCEEEEEEEECCCCTTSCCCBCEEEETCCCTTCGGG
T ss_pred             hhcccCceEEEEEEEEEEcCCCcceEEEEEECCccCCCcEEEeCCCEEEEEEEECCCCccCCCCceEecCCeeccCCCcc
Confidence            34567789999999999999999 999999999999999999999999999999999     999999999999888899


Q ss_pred             CCCccccCCccCCCCeEEEEEEeCCCcccC
Q 043378          103 DGPAYITQCPIQTGQGCVYNFTIVGQRGKL  132 (162)
Q Consensus       103 DG~~~vtq~~I~PG~~~tY~f~~~~~~Gt~  132 (162)
                      ||+|+++||+|+||++|+|+|++.+++|||
T Consensus        98 DGv~~vtq~~I~PG~s~~Y~f~~~~~~GT~  127 (521)
T 1v10_A           98 DGPAFVNQCPIIPNESFVYDFVVPGQAGTY  127 (521)
T ss_dssp             SCCBTTTBCCBCTTEEEEEEEECTTCCEEE
T ss_pred             CCCcceeeCCcCCCCeEEEEEecCCCCccE
Confidence            999999999999999999999976789999
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>1xwv_A DER F II; beta sheets, allergen; HET: PE3 XPE; 1.83A {Dermatophagoides farinae} SCOP: b.1.18.7 PDB: 1ahk_A 1ahm_A 1wrf_A 2f08_A* 1a9v_A 1ktj_A Back     alignment and structure
>1nep_A EPV20, BNPC2, epididymal secretory protein E1; niemann-PICK C2, LDL, cholesterol, lipid bindin; HET: NAG; 1.70A {Bos taurus} SCOP: b.1.18.7 PDB: 2hka_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 162
d1v10a1136 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [T 2e-23
d1gyca1130 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, la 4e-23
d1hfua1131 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprin 4e-23
d1aoza1129 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cuc 5e-23
d2q9oa1162 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces 7e-15
d2j5wa1192 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapie 1e-13
d1oe2a1159 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcalige 3e-13
d2j5wa3207 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sap 2e-12
d2bw4a1157 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcalige 5e-11
d1kbva1151 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisser 5e-11
d1kv7a1140 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Esch 2e-10
d1sdda1180 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos t 2e-10
d1gska1181 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Baci 2e-10
d2j5wa4179 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sap 2e-10
d1mzya1153 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodoba 5e-09
d1e30a_153 b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidan 1e-06
d1sddb2139 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (B 1e-05
d2j5wa5149 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sa 1e-04
d1sdda2116 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos 0.001
d1fwxa1132 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-ter 0.004
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 136 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Laccase
species: Rigidoporus lignosus [TaxId: 219653]

 Score = 87.4 bits (216), Expect = 2e-23
 Identities = 31/99 (31%), Positives = 45/99 (45%), Gaps = 8/99 (8%)

Query: 38  KFDIKLQNATRL---CHTKSIVSVNGKFPGPRIVAREGDQLLIKVVKHVQN-----NISI 89
             D+ + NA         +S V+  G    P I     D+  I V+  + +       SI
Sbjct: 4   ALDLHILNANLDPDGTGARSAVTAEGTTIAPLITGNIDDRFQINVIDQLTDANMRRATSI 63

Query: 90  HWHGIGQLRSGWADGPAYITQCPIQTGQGCVYNFTIVGQ 128
           HWHG  Q  +   DGPA++ QCPI   +  VY+F + GQ
Sbjct: 64  HWHGFFQAGTTEMDGPAFVNQCPIIPNESFVYDFVVPGQ 102
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 130 Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 131 Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 129 Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 162 Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 159 Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 157 Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Length = 151 Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 140 Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 180 Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Length = 181 Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 179 Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Length = 153 Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Length = 153 Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 139 Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 116 Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Length = 132 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 99.97
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 99.97
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 99.97
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 99.96
d1kv7a1140 multi-copper oxidase CueO {Escherichia coli [TaxId 99.96
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 99.93
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.91
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.91
d1gska1181 Spore coat protein A, CotA {Bacillus subtilis [Tax 99.89
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 99.88
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.88
d1sdda1180 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.79
d2j5wa3207 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.75
d2j5wa1192 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.68
d2j5wa4179 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 99.45
d2j5wa5149 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1sddb2139 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.3
d1kbva2151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.3
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 99.18
d1sdda2116 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.18
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 98.98
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 98.55
d2bw4a2173 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 98.46
d1oe1a2177 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 97.96
d1kv7a3181 multi-copper oxidase CueO {Escherichia coli [TaxId 97.66
d1v10a2168 Laccase {Rigidoporus lignosus [TaxId: 219653]} 97.62
d2q9oa2181 Laccase {Melanocarpus albomyces [TaxId: 204285]} 97.59
d1hfua2172 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 97.52
d1gska3154 Spore coat protein A, CotA {Bacillus subtilis [Tax 97.31
d1gyca2170 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 97.3
d1aoza2209 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 97.28
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 97.2
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 97.06
d1aoza3214 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 97.01
d1hfua3200 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 96.64
d1mzya2178 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 96.44
d1kv7a2165 multi-copper oxidase CueO {Escherichia coli [TaxId 96.35
d1v10a3190 Laccase {Rigidoporus lignosus [TaxId: 219653]} 96.27
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 96.26
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 96.21
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 96.19
d1gyca3199 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 96.13
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 96.11
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 96.02
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 95.8
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 95.51
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 95.5
d1gska2174 Spore coat protein A, CotA {Bacillus subtilis [Tax 95.5
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 95.42
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 95.41
d1sddb167 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 95.35
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 95.18
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 95.05
d2q9oa3216 Laccase {Melanocarpus albomyces [TaxId: 204285]} 94.25
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 93.76
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 93.47
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 92.46
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 92.15
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 92.09
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 91.6
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 90.04
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 89.86
d2nqda1108 Chagasin {Trypanosoma cruzi [TaxId: 5693]} 88.26
d1xq4a_123 ApaG {Bordetella pertussis [TaxId: 520]} 84.91
d1vjja399 Transglutaminase, two C-terminal domains {Human (H 84.76
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Laccase
species: Rigidoporus lignosus [TaxId: 219653]

Probab=99.97  E-value=2.7e-32  Score=202.30  Aligned_cols=99  Identities=32%  Similarity=0.540  Sum_probs=93.7

Q ss_pred             eEEEEEEEEEEEEecCCe-eeEEEEECCCCCCceEEEecCCEEEEEEEecCC-----CCeeEEeeccccCCCCCCCCCcc
Q 043378           34 TRHCKFDIKLQNATRLCH-TKSIVSVNGKFPGPRIVAREGDQLLIKVVKHVQ-----NNISIHWHGIGQLRSGWADGPAY  107 (162)
Q Consensus        34 ~~~~~l~i~~~~~~~~g~-~~~~~~~Ng~~PGP~I~v~~Gd~v~v~v~N~l~-----~~~siH~HGl~~~~~~~~DG~~~  107 (162)
                      +++|+|++.+..+.+||. ++++|+|||++|||+|++++||+|+|+|+|+++     +++||||||++++...|+||+++
T Consensus         2 ~v~~~l~~~~~~~~pdG~~~~~~~~~nG~~PGP~i~~~~GD~v~v~~~N~l~~~~~~~~tsiH~HGl~~~~~~~~dgv~~   81 (136)
T d1v10a1           2 TVALDLHILNANLDPDGTGARSAVTAEGTTIAPLITGNIDDRFQINVIDQLTDANMRRATSIHWHGFFQAGTTEMDGPAF   81 (136)
T ss_dssp             CSEEEEEEEEEEECTTSSCCEEEEEESSSSSCCCEEEETTCEEEEEEEECCCCTTSCCCBCEEEETCCCTTCGGGSCCBT
T ss_pred             EEEEEEEEEEEEECCCCcceeEEEEECCCccCCeEEEECCcEEEEEEEeCCCCcccCcceeEEecccccccccccCCCCc
Confidence            578999999999999985 678999999999999999999999999999975     78999999999999999999999


Q ss_pred             ccCCccCCCCeEEEEEEeCCCcccC
Q 043378          108 ITQCPIQTGQGCVYNFTIVGQRGKL  132 (162)
Q Consensus       108 vtq~~I~PG~~~tY~f~~~~~~Gt~  132 (162)
                      ++||+|.||++|+|+|++++++|||
T Consensus        82 ~t~~~I~PG~~~~Y~~~~~~~~Gt~  106 (136)
T d1v10a1          82 VNQCPIIPNESFVYDFVVPGQAGTY  106 (136)
T ss_dssp             TTBCCBCTTEEEEEEEECTTCCEEE
T ss_pred             cccceECCCCeEEEEEECCCCccce
Confidence            9999999999999999997789998
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d2nqda1 b.1.26.1 (A:3-110) Chagasin {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xq4a_ b.1.23.1 (A:) ApaG {Bordetella pertussis [TaxId: 520]} Back     information, alignment and structure
>d1vjja3 b.1.5.1 (A:594-692) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]} Back     information, alignment and structure