Citrus Sinensis ID: 043382

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33

MLVASVKWKVGYHYLISNAPHLLLVSLLGIVLIYDGFSTLSTLDDLLQFWNELSFKLNYVTVLLKLLERSRIGNMTYGPKSLMDNPAENRHMKEAKKETDDVIIGAIDERLAKTGFKHKDIGILVVNSSLFNPTPSLSAFIVNHYKLRSNILSYNLGALQSAQVQPNSYTLVVSTENITLGLYTGNDRSILRTTAYFVVAGEALKTHITALGPLVLPVSEQLLFIATSVGRKIFKMKIKQYPSRVTLYRFRNTSSSLVWYELAYAEAKRRIPKGDRICQIGFGAGFNCNTVVWPVLKTINLNPALDKNPWIDEIDDFPVQLPQFAPIAF

ccEEEEEEEcEEEEEcccccEEEEHHHHHHHcccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccccccHHHHHHHHHccccccEEEEcccccccccccccEEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccHHHHcccccccccHHHHHHHHHHHHcccccccEEEEEEcccccccccEEEcccccccccccccccccccccccccccccccccccc

cEEEEEEEEEEEEEEEccccHEEEEEHccHHHHHHHHHHHccccHHHHHHccccccHHHHHHHHHHHHHccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccHcHccEEEEEcccccccccHHHHHHHHccccccEEEEEcccccccccccccEEEEEEEcccccccccccccccHccHHHHHHHHHHHHHcHcccccccccHHHHHHHHHHHHHHHHHHHccccccccHEEEEccccccHHHHHHHHHHHHHcccccccEEEEEEEcccccccHHHHHHHccccccccccccccHHHHcccccccccEEEEcc

MLVASVKWKVGYHYLISNAPHLLLVSLLGIVLIYDGFSTLSTLDDLLQFWNELSFKLNYVTVLLKLLERsrignmtygpkslmdnpaenrhmkeakkETDDVIIGAIDERLaktgfkhkdIGILVVnsslfnptpslSAFIVNHYKLRSNILSYNLGalqsaqvqpnsytlVVSTEnitlglytgndrsilrTTAYFVVAGEALKTHITalgplvlpvSEQLLFIATSVGRKIFKMKIKQYPSRVTLYRFRNTSSSLVWYELAYAEAKrripkgdricqigfgagfncntvVWPVLktinlnpaldknpwideiddfpvqlpqfapiaf

MLVASVKWKVGYHYLISNAPHLLLVSLLGIVLIYDGFSTLSTLDDLLQFWNELSFKLNYVTVLLKLLErsrignmtygpkslmdnpaENRHMKeakketddvIIGAIDERLAKTGFKHKDIGILVVNSSLFNPTPSLSAFIVNHYKLRSNILSYNLGALQSAQVQPNSYTLVVSTENITLglytgndrsiLRTTAYFVVAGEALKTHITALGPLVLPVSEQLLFIATSVGRKIFKMkikqypsrvtlyrfrntsssLVWYELAYAEAKRRIPKGDRICQIGFGAGFNCNTVVWPVLKTINLNPALDKNPWIDEIDDFPVQLPQFAPIAF

MLVASVKWKVGYHYLISNAPHlllvsllgivliYDGFSTLSTLDDLLQFWNELSFKLNYVTVLLKLLERSRIGNMTYGPKSLMDNPAENRHMKEAKKETDDVIIGAIDERLAKTGFKHKDIGILVVNSSLFNPTPSLSAFIVNHYKLRSNILSYNLGALQSAQVQPNSYTLVVSTENITLGLYTGNDRSILRTTAYFVVAGEALKTHITALGPLVLPVSEQLLFIATSVGRKIFKMKIKQYPSRVTLYRFRNTSSSLVWYELAYAEAKRRIPKGDRICQIGFGAGFNCNTVVWPVLKTINLNPALDKNPWIDEIDDFPVQLPQFAPIAF

**VASVKWKVGYHYLISNAPHLLLVSLLGIVLIYDGFSTLSTLDDLLQFWNELSFKLNYVTVLLKLLERSRIGNMTY***********************DVIIGAIDERLAKTGFKHKDIGILVVNSSLFNPTPSLSAFIVNHYKLRSNILSYNLGALQSAQVQPNSYTLVVSTENITLGLYTGNDRSILRTTAYFVVAGEALKTHITALGPLVLPVSEQLLFIATSVGRKIFKMKIKQYPSRVTLYRFRNTSSSLVWYELAYAEAKRRIPKGDRICQIGFGAGFNCNTVVWPVLKTINLNPALDKNPWIDEIDDFPVQLPQF*****

iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		329	2.2.26 [Sep-21-2011]
O48780		509	3-ketoacyl-CoA synthase 1	yes	no	0.790	0.510	0.405	6e-65
Q38860		506	3-ketoacyl-CoA synthase 1	no	no	0.775	0.503	0.357	6e-53
Q9SYZ0		493	3-ketoacyl-CoA synthase 1	no	no	0.768	0.513	0.368	2e-51
O65677		487	Probable 3-ketoacyl-CoA s	no	no	0.817	0.552	0.350	6e-51
Q4V3C9		481	3-ketoacyl-CoA synthase 8	no	no	0.768	0.525	0.366	3e-50
Q9FG87		529	3-ketoacyl-CoA synthase 1	no	no	0.392	0.243	0.532	5e-40
Q5XEP9		528	3-ketoacyl-CoA synthase 1	no	no	0.592	0.369	0.424	1e-38
Q9ZUZ0		466	3-ketoacyl-CoA synthase 1	no	no	0.376	0.266	0.443	1e-32
Q9SS39		459	Probable 3-ketoacyl-CoA s	no	no	0.376	0.270	0.443	2e-32
Q9MAM3		528	3-ketoacyl-CoA synthase 1	no	no	0.376	0.234	0.434	6e-32

>sp\|O48780\|KCS11_ARATH 3-ketoacyl-CoA synthase 11 OS=Arabidopsis thaliana GN=KCS11 PE=1 SV=1	Back alignment and function desciption

 Score =  248 bits (632), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 151/372 (40%), Positives = 197/372 (52%), Gaps = 112/372 (30%)

Query: 65  KLLERSRIGNMTYGPKSLMDNPAENRHMKEAKKETDDVIIGAIDERLAKTGFKHKDIGIL 124
           K+L+RS +G  TY P+++++ P  N  MKEA+KE + V+ GAIDE LAKT    KDIGIL
Sbjct: 141 KILQRSGLGESTYLPEAVLNVPP-NPCMKEARKEAETVMFGAIDELLAKTNVNPKDIGIL 199

Query: 125 VVNSSLFNPTPSLSAFIVNHYKLRSNILSYNLGALQSA-------------QVQPNSYTL 171
           +VN SLFNPTPSLSA +VNHYKLR NILSYNLG +  +                PN+Y +
Sbjct: 200 IVNCSLFNPTPSLSAMVVNHYKLRGNILSYNLGGMGCSAGLISIDLAKHLLHSIPNTYAM 259

Query: 172 VVSTENITLGLYTGNDRSILRTTAYFVVAGEAL--------------------KTHITA- 210
           V+S ENITL  Y GNDRS L +   F + G A+                    +TH  A 
Sbjct: 260 VISMENITLNWYFGNDRSKLVSNCLFRMGGAAILLSNKRWDRRRSKYELVDTVRTHKGAD 319

Query: 211 -------------LGPLVLPVSEQLLFIA--------------------------TSVGR 231
                           + + +S++L+ +A                          T VGR
Sbjct: 320 DKCFGCITQEEDSASKIGVTLSKELMAVAGDALKTNITTLGPLVLPTSEQLLFFATLVGR 379

Query: 232 KIFKMKIKQY------------------------------------PSRVTLYRFRNTSS 255
           K+FKMKIK Y                                    PSR+TLYRF NTSS
Sbjct: 380 KLFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLKLTEWHMEPSRMTLYRFGNTSS 439

Query: 256 SLVWYELAYAEAKRRIPKGDRICQIGFGAGFNCNTVVWPVLKTINLNPALDKNPWIDEID 315
           S +WYELAY+EAK RI KGDRI QI FG+GF CN+ VW  ++++  NP  +KNPW+DEI 
Sbjct: 440 SSLWYELAYSEAKGRIKKGDRIWQIAFGSGFKCNSSVWRAVRSV--NPKKEKNPWMDEIH 497

Query: 316 DFPVQLPQFAPI 327
           +FPV++P+ + I
Sbjct: 498 EFPVEVPKVSTI 509

Active on both saturated and mono-unsaturated acyl chains C16 to C20.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 1EC: 1EC: 9

>sp\|Q38860\|KCS18_ARATH 3-ketoacyl-CoA synthase 18 OS=Arabidopsis thaliana GN=FAE1 PE=1 SV=1	Back alignment and function description

>sp\|Q9SYZ0\|KCS16_ARATH 3-ketoacyl-CoA synthase 16 OS=Arabidopsis thaliana GN=KCS16 PE=2 SV=1	Back alignment and function description

>sp\|O65677\|KCS2_ARATH Probable 3-ketoacyl-CoA synthase 2 OS=Arabidopsis thaliana GN=KCS2 PE=2 SV=1	Back alignment and function description

>sp\|Q4V3C9\|KCS8_ARATH 3-ketoacyl-CoA synthase 8 OS=Arabidopsis thaliana GN=KCS8 PE=2 SV=1	Back alignment and function description

>sp\|Q9FG87\|KCS19_ARATH 3-ketoacyl-CoA synthase 19 OS=Arabidopsis thaliana GN=KCS19 PE=2 SV=1	Back alignment and function description

>sp\|Q5XEP9\|KCS17_ARATH 3-ketoacyl-CoA synthase 17 OS=Arabidopsis thaliana GN=KCS17 PE=2 SV=2	Back alignment and function description

>sp\|Q9ZUZ0\|KCS13_ARATH 3-ketoacyl-CoA synthase 13 OS=Arabidopsis thaliana GN=HIC PE=2 SV=1	Back alignment and function description

>sp\|Q9SS39\|KCS14_ARATH Probable 3-ketoacyl-CoA synthase 14 OS=Arabidopsis thaliana GN=KCS14 PE=2 SV=1	Back alignment and function description

>sp\|Q9MAM3\|KCS1_ARATH 3-ketoacyl-CoA synthase 1 OS=Arabidopsis thaliana GN=KCS1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		329
356563067		510	PREDICTED: 3-ketoacyl-CoA synthase 11-li	0.951	0.613	0.378	7e-66
302754776		500	hypothetical protein SELMODRAFT_437285 [	0.772	0.508	0.428	4e-65
356511628		510	PREDICTED: 3-ketoacyl-CoA synthase 11-li	0.790	0.509	0.424	6e-65
125555951		519	hypothetical protein OsI_23590 [Oryza sa	0.793	0.502	0.412	7e-65
115468794		519	Os06g0598800 [Oryza sativa Japonica Grou	0.793	0.502	0.412	8e-65
267631202		511	fatty acid elongase [Pistacia chinensis]	0.784	0.504	0.416	1e-64
449527103		513	PREDICTED: 3-ketoacyl-CoA synthase 11-li	0.790	0.506	0.416	1e-64
225445394		511	PREDICTED: 3-ketoacyl-CoA synthase 11 [V	0.951	0.612	0.362	1e-64
449457111		513	PREDICTED: 3-ketoacyl-CoA synthase 11-li	0.790	0.506	0.416	1e-64
238011546		517	unknown [Zea mays] gi\|413936839\|gb\|AFW71	0.793	0.504	0.417	2e-64

>gi\|356563067\|ref\|XP_003549787.1\| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]	Back alignment and taxonomy information

 Score =  257 bits (656), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 184/486 (37%), Positives = 226/486 (46%), Gaps = 173/486 (35%)

Query: 9   KVGYHYLISNAPHLLLVSLLGIVLIYDGFSTLSTLDDLLQFWNELSFKLNYVTVLLKLL- 67
           K+GYHYLI++  +L L  L  +VLI    ST S L DL   W  L + L  V + L LL 
Sbjct: 31  KLGYHYLITHGMYLCLSPL--VVLIAAQLSTFS-LRDLYDLWEHLQYNLISVILCLTLLV 87

Query: 68  ------------------------------------ERSR-------------------- 71
                                               E+SR                    
Sbjct: 88  FLSTLYFLTRPRPVYLVNFSCYKPEESRKCTKKIFIEQSRLTSSFTEENLEFQRKILERS 147

Query: 72  -IGNMTYGPKSLMDNPAENRHMKEAKKETDDVIIGAIDERLAKTGFKHKDIGILVVNSSL 130
            +G  TY P+++++ P  N  MKEA+KE + V+ GAIDE LAKT  K K IGIL+VN SL
Sbjct: 148 GLGENTYLPEAVLNIPP-NPSMKEARKEAETVMFGAIDELLAKTAVKPKYIGILIVNCSL 206

Query: 131 FNPTPSLSAFIVNHYKLRSNILSYNLGALQSA-------------QVQPNSYTLVVSTEN 177
           FNPTPSLSA IVNHYKLR NI SYNLG +  +             Q  PNSY LV+S EN
Sbjct: 207 FNPTPSLSAMIVNHYKLRGNIKSYNLGGMGCSAGLISIDLAKDLLQANPNSYALVISMEN 266

Query: 178 ITLGLYTGNDRSILRTTAYFVVAGEA--------------------LKTHI--------- 208
           ITL  Y GNDRS L +   F + G A                    ++TH          
Sbjct: 267 ITLNWYFGNDRSKLVSNCLFRMGGAAVLLSNKSSDRRRSKYRLVTTVRTHKGADEKCFSC 326

Query: 209 -----TALGPLVLPVSEQLLFIA--------------------------TSVGRKIFKMK 237
                 A G + + +S+ L+ +A                          T VG+KIFKMK
Sbjct: 327 VTQEEDANGKVGVTLSKDLMAVAGDALKTNITTLGPLVLPTSEQLLFFATLVGKKIFKMK 386

Query: 238 IKQY------------------------------------PSRVTLYRFRNTSSSLVWYE 261
           IK Y                                    PSR+TLYRF NTSSS +WYE
Sbjct: 387 IKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSPWHMEPSRMTLYRFGNTSSSSLWYE 446

Query: 262 LAYAEAKRRIPKGDRICQIGFGAGFNCNTVVWPVLKTINLNPALDKNPWIDEIDDFPVQL 321
           LAY EAK RI KGDR  QI FG+GF CN+ VW  L+TI  NPA +K+PWIDEID FPV +
Sbjct: 447 LAYTEAKGRIKKGDRTWQIAFGSGFKCNSAVWKALRTI--NPAKEKSPWIDEIDQFPVDV 504

Query: 322 PQFAPI 327
           P+ + I
Sbjct: 505 PRVSTI 510

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|302754776\|ref\|XP_002960812.1\| hypothetical protein SELMODRAFT_437285 [Selaginella moellendorffii] gi\|302804210\|ref\|XP_002983857.1\| hypothetical protein SELMODRAFT_445704 [Selaginella moellendorffii] gi\|300148209\|gb\|EFJ14869.1\| hypothetical protein SELMODRAFT_445704 [Selaginella moellendorffii] gi\|300171751\|gb\|EFJ38351.1\| hypothetical protein SELMODRAFT_437285 [Selaginella moellendorffii]	Back alignment and taxonomy information

>gi\|356511628\|ref\|XP_003524525.1\| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]	Back alignment and taxonomy information

>gi\|125555951\|gb\|EAZ01557.1\| hypothetical protein OsI_23590 [Oryza sativa Indica Group]	Back alignment and taxonomy information

>gi\|115468794\|ref\|NP_001057996.1\| Os06g0598800 [Oryza sativa Japonica Group] gi\|50725468\|dbj\|BAD32939.1\| putative beta-ketoacyl-CoA synthase [Oryza sativa Japonica Group] gi\|113596036\|dbj\|BAF19910.1\| Os06g0598800 [Oryza sativa Japonica Group] gi\|125597765\|gb\|EAZ37545.1\| hypothetical protein OsJ_21873 [Oryza sativa Japonica Group]	Back alignment and taxonomy information

>gi\|267631202\|gb\|ACY78677.1\| fatty acid elongase [Pistacia chinensis]	Back alignment and taxonomy information

>gi\|449527103\|ref\|XP_004170552.1\| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|225445394\|ref\|XP_002284986.1\| PREDICTED: 3-ketoacyl-CoA synthase 11 [Vitis vinifera] gi\|147838768\|emb\|CAN67313.1\| hypothetical protein VITISV_014119 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449457111\|ref\|XP_004146292.1\| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|238011546\|gb\|ACR36808.1\| unknown [Zea mays] gi\|413936839\|gb\|AFW71390.1\| fatty acid elongase [Zea mays]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		329
TAIR\|locus:2170837		529	KCS20 "3-ketoacyl-CoA synthase	0.422	0.262	0.588	2.8e-87
TAIR\|locus:2043849		509	KCS11 "3-ketoacyl-CoA synthase	0.422	0.273	0.535	8.9e-85
TAIR\|locus:2020215		528	KCS2 "3-ketoacyl-CoA synthase	0.422	0.263	0.575	2e-83
TAIR\|locus:2076254		459	KCS14 "3-ketoacyl-CoA synthase	0.437	0.313	0.417	4.2e-66
TAIR\|locus:2016397		516	KCS4 "3-ketoacyl-CoA synthase	0.422	0.269	0.496	4.5e-66
TAIR\|locus:2200955		528	KCS1 "3-ketoacyl-CoA synthase	0.492	0.306	0.440	6.7e-66
TAIR\|locus:2042684		512	KCS9 "3-ketoacyl-CoA synthase	0.465	0.298	0.436	3.6e-65
TAIR\|locus:2062775		466	KCS13 "3-ketoacyl-CoA synthase	0.437	0.309	0.405	2.7e-64
TAIR\|locus:2057706		550	KCS10 "3-ketoacyl-CoA synthase	0.398	0.238	0.476	1.6e-63
TAIR\|locus:2139579		487	KCS17 "3-ketoacyl-CoA synthase	0.422	0.285	0.457	2.1e-62

TAIR\|locus:2170837 KCS20 "3-ketoacyl-CoA synthase 20" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 392 (143.0 bits), Expect = 2.8e-87, Sum P(4) = 2.8e-87
 Identities = 90/153 (58%), Positives = 104/153 (67%)

Query:    65 KLLERSRIGNMTYGPKSLMDNPAENRHMKEAKKETDDVIIGAIDERLAKTGFKHKDIGIL 124
             K+LERS +G  TY P++L+  P  N  M+EA+KE + V+ GAID  L KTG K KDIGIL
Sbjct:   152 KILERSGLGQKTYFPEALLRVPP-NPCMEEARKEAETVMFGAIDAVLEKTGVKPKDIGIL 210

Query:   125 VVNSSLFNPTPSLSAFIVNHYKLRSNILSYNLGAL-------------QSAQVQPNSYTL 171
             VVN SLFNPTPSLSA IVN YKLR NILSYNLG +             Q  QVQPNSY L
Sbjct:   211 VVNCSLFNPTPSLSAMIVNKYKLRGNILSYNLGGMGCSAGLISIDLAKQMLQVQPNSYAL 270

Query:   172 VVSTENITLGLYTGNDRSILRTTAYFVVAGEAL 204
             VVSTENITL  Y GNDRS+L +   F + G A+
Sbjct:   271 VVSTENITLNWYLGNDRSMLLSNCIFRMGGAAV 303

GO:0003824 "catalytic activity" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0006633 "fatty acid biosynthetic process" evidence=IEA

GO:0008152 "metabolic process" evidence=IEA

GO:0008610 "lipid biosynthetic process" evidence=IEA

GO:0016020 "membrane" evidence=IEA

GO:0016747 "transferase activity, transferring acyl groups other than amino-acyl groups" evidence=IEA

GO:0009922 "fatty acid elongase activity" evidence=IDA

GO:0009409 "response to cold" evidence=IEP;RCA

GO:0009416 "response to light stimulus" evidence=IEP

GO:0000038 "very long-chain fatty acid metabolic process" evidence=RCA

GO:0042335 "cuticle development" evidence=RCA

TAIR\|locus:2043849 KCS11 "3-ketoacyl-CoA synthase 11" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2020215 KCS2 "3-ketoacyl-CoA synthase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2076254 KCS14 "3-ketoacyl-CoA synthase 14" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2016397 KCS4 "3-ketoacyl-CoA synthase 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2200955 KCS1 "3-ketoacyl-CoA synthase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2042684 KCS9 "3-ketoacyl-CoA synthase 9" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2062775 KCS13 "3-ketoacyl-CoA synthase 13" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2057706 KCS10 "3-ketoacyl-CoA synthase 10" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2139579 KCS17 "3-ketoacyl-CoA synthase 17" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.3.1	0.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		329
PLN02192		511	PLN02192, PLN02192, 3-ketoacyl-CoA synthase	1e-101
pfam08392		290	pfam08392, FAE1_CUT1_RppA, FAE1/Type III polyketid	2e-70
PLN02932		478	PLN02932, PLN02932, 3-ketoacyl-CoA synthase	2e-68
cd00831		361	cd00831, CHS_like, Chalcone and stilbene synthases	2e-52
PLN02854		521	PLN02854, PLN02854, 3-ketoacyl-CoA synthase	7e-43
PLN02854		521	PLN02854, PLN02854, 3-ketoacyl-CoA synthase	9e-42
PLN02377		502	PLN02377, PLN02377, 3-ketoacyl-CoA synthase	8e-38
PLN00415		466	PLN00415, PLN00415, 3-ketoacyl-CoA synthase	1e-37
PLN02377		502	PLN02377, PLN02377, 3-ketoacyl-CoA synthase	3e-34
PLN00415		466	PLN00415, PLN00415, 3-ketoacyl-CoA synthase	1e-32
COG0332		323	COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein]	1e-04
cd00830		320	cd00830, KAS_III, Ketoacyl-acyl carrier protein sy	4e-04
pfam08541		90	pfam08541, ACP_syn_III_C, 3-Oxoacyl-[acyl-carrier-	0.001

>gnl\|CDD\|215123 PLN02192, PLN02192, 3-ketoacyl-CoA synthase	Back alignment and domain information

 Score =  306 bits (784), Expect = e-101
 Identities = 168/372 (45%), Positives = 205/372 (55%), Gaps = 112/372 (30%)

Query: 65  KLLERSRIGNMTYGPKSLMDNPAENRHMKEAKKETDDVIIGAIDERLAKTGFKHKDIGIL 124
           K+LERS +G  TY P+++++ P  N  M EA+KE + V+ GAID+ LAKT  K KDIGIL
Sbjct: 143 KILERSGLGESTYLPEAVLNVPP-NPCMAEARKEAETVMFGAIDQLLAKTSVKPKDIGIL 201

Query: 125 VVNSSLFNPTPSLSAFIVNHYKLRSNILSYNLGALQSA-------------QVQPNSYTL 171
           +VN SLFNPTPSLSA ++NHYKLR NILSYNLG +  +             QV PNSY L
Sbjct: 202 IVNCSLFNPTPSLSAMVINHYKLRGNILSYNLGGMGCSAGLISIDLAKHLLQVHPNSYAL 261

Query: 172 VVSTENITLGLYTG----------------------NDRSILRTTAY------------- 196
           V+S ENITL  Y G                      N RS  R + Y             
Sbjct: 262 VISMENITLNWYFGNDRSMLVSNCLFRMGGAAILLSNKRSDRRRSKYQLVHTVRTHKGAD 321

Query: 197 -------------------------FVVAGEALKTHITALGPLVLPVSEQLLFIATSVGR 231
                                      VAG+ALKT+IT LGPLVLP+SEQLLF AT VG+
Sbjct: 322 DKCFACVTQEEDSAGKIGVSLSKDLMAVAGDALKTNITTLGPLVLPMSEQLLFFATLVGK 381

Query: 232 KIFKMKIKQY------------------------------------PSRVTLYRFRNTSS 255
           K+FKMK+K Y                                    PSR+TLYRF NTSS
Sbjct: 382 KLFKMKLKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDWHMEPSRMTLYRFGNTSS 441

Query: 256 SLVWYELAYAEAKRRIPKGDRICQIGFGAGFNCNTVVWPVLKTINLNPALDKNPWIDEID 315
           S +WYELAY+EAK RI KGDR  QI FG+GF CN+ VW  L+T+  NPA +KNPW+DEI 
Sbjct: 442 SSLWYELAYSEAKGRIKKGDRTWQIAFGSGFKCNSAVWKALRTV--NPAKEKNPWMDEIH 499

Query: 316 DFPVQLPQFAPI 327
           +FPV +P+ + I
Sbjct: 500 EFPVDVPKVSTI 511

Length = 511

>gnl\|CDD\|116972 pfam08392, FAE1_CUT1_RppA, FAE1/Type III polyketide synthase-like protein	Back alignment and domain information

>gnl\|CDD\|178520 PLN02932, PLN02932, 3-ketoacyl-CoA synthase	Back alignment and domain information

>gnl\|CDD\|238427 cd00831, CHS_like, Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs	Back alignment and domain information

>gnl\|CDD\|215459 PLN02854, PLN02854, 3-ketoacyl-CoA synthase	Back alignment and domain information

>gnl\|CDD\|215459 PLN02854, PLN02854, 3-ketoacyl-CoA synthase	Back alignment and domain information

>gnl\|CDD\|166018 PLN02377, PLN02377, 3-ketoacyl-CoA synthase	Back alignment and domain information

>gnl\|CDD\|177808 PLN00415, PLN00415, 3-ketoacyl-CoA synthase	Back alignment and domain information

>gnl\|CDD\|166018 PLN02377, PLN02377, 3-ketoacyl-CoA synthase	Back alignment and domain information

>gnl\|CDD\|177808 PLN00415, PLN00415, 3-ketoacyl-CoA synthase	Back alignment and domain information

>gnl\|CDD\|223409 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein]	Back alignment and domain information

>gnl\|CDD\|238426 cd00830, KAS_III, Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems	Back alignment and domain information

>gnl\|CDD\|117118 pfam08541, ACP_syn_III_C, 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		329
PLN02192		511	3-ketoacyl-CoA synthase	100.0
PLN02854		521	3-ketoacyl-CoA synthase	100.0
PLN02377		502	3-ketoacyl-CoA synthase	100.0
PLN02932		478	3-ketoacyl-CoA synthase	100.0
PLN00415		466	3-ketoacyl-CoA synthase	100.0
COG0332		323	FabH 3-oxoacyl-[acyl-carrier-protein]	100.0
PF08392		290	FAE1_CUT1_RppA: FAE1/Type III polyketide synthase-	100.0
PLN03168		389	chalcone synthase; Provisional	100.0
PLN03172		393	chalcone synthase family protein; Provisional	100.0
cd00831		361	CHS_like Chalcone and stilbene synthases; plant-sp	100.0
PLN03170		401	chalcone synthase; Provisional	100.0
PLN03169		391	chalcone synthase family protein; Provisional	100.0
PLN03171		399	chalcone synthase-like protein; Provisional	100.0
PRK12880		353	3-oxoacyl-(acyl carrier protein) synthase III; Rev	100.0
PRK05963		326	3-oxoacyl-(acyl carrier protein) synthase II; Revi	100.0
PLN03173		391	chalcone synthase; Provisional	99.97
COG3424		356	BcsA Predicted naringenin-chalcone synthase [Secon	99.97
PRK07204		329	3-oxoacyl-(acyl carrier protein) synthase III; Rev	99.97
PLN02326		379	3-oxoacyl-[acyl-carrier-protein] synthase III	99.97
PRK09258		338	3-oxoacyl-(acyl carrier protein) synthase III; Rev	99.97
PRK12879		325	3-oxoacyl-(acyl carrier protein) synthase III; Rev	99.97
CHL00203		326	fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr	99.96
PRK06840		339	hypothetical protein; Validated	99.96
TIGR00747		318	fabH 3-oxoacyl-(acyl-carrier-protein) synthase III	99.95
cd00830		320	KAS_III Ketoacyl-acyl carrier protein synthase III	99.95
TIGR00748		345	HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase	99.95
PRK04262		347	hypothetical protein; Provisional	99.95
PRK06816		378	3-oxoacyl-(acyl carrier protein) synthase III; Rev	99.94
PRK09352		319	3-oxoacyl-(acyl carrier protein) synthase III; Rev	99.94
PRK07515		372	3-oxoacyl-(acyl carrier protein) synthase III; Rev	99.94
cd00827		324	init_cond_enzymes "initiating" condensing enzymes	99.91
TIGR01835		379	HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synt	99.89
PF00195		226	Chal_sti_synt_N: Chalcone and stilbene synthases,	99.8
PLN02577		459	hydroxymethylglutaryl-CoA synthase	99.79
COG3425		377	PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi	99.77
cd00327		254	cond_enzymes Condensing enzymes; Family of enzymes	99.75
TIGR01833		454	HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synth	99.69
cd00825		332	decarbox_cond_enzymes decarboxylating condensing e	99.57
PF08541		90	ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (AC	99.46
PF02797		151	Chal_sti_synt_C: Chalcone and stilbene synthases,	99.31
TIGR02845		327	spore_V_AD stage V sporulation protein AD. Bacillu	98.93
PF01154		174	HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A s	98.86
PRK06147		348	3-oxoacyl-(acyl carrier protein) synthase; Validat	98.81
PRK08304		337	stage V sporulation protein AD; Validated	98.78
cd00751		386	thiolase Thiolase are ubiquitous enzymes that cata	98.76
TIGR01930		386	AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi	98.63
PRK07108		392	acetyl-CoA acetyltransferase; Provisional	98.61
PRK05656		393	acetyl-CoA acetyltransferase; Provisional	98.55
PRK06205		404	acetyl-CoA acetyltransferase; Provisional	98.54
PRK08235		393	acetyl-CoA acetyltransferase; Provisional	98.5
PRK06059		399	lipid-transfer protein; Provisional	98.49
PRK09052		399	acetyl-CoA acetyltransferase; Provisional	98.47
PRK08313		386	acetyl-CoA acetyltransferase; Provisional	98.44
PRK09051		394	beta-ketothiolase; Provisional	98.43
PRK08170		426	acetyl-CoA acetyltransferase; Provisional	98.4
PRK12578		385	acetyl-CoA acetyltransferase; Provisional	98.4
PRK08242		402	acetyl-CoA acetyltransferase; Validated	98.38
cd00829		375	SCP-x_thiolase Thiolase domain associated with ste	98.37
cd00826		393	nondecarbox_cond_enzymes nondecarboxylating conden	98.32
PRK06065		392	acetyl-CoA acetyltransferase; Provisional	98.27
PRK05790		393	putative acyltransferase; Provisional	98.27
PRK06954		397	acetyl-CoA acetyltransferase; Provisional	98.25
PRK06064		389	acetyl-CoA acetyltransferase; Provisional	98.17
PRK12404		334	stage V sporulation protein AD; Provisional	98.13
PF00108		264	Thiolase_N: Thiolase, N-terminal domain; InterPro:	98.11
PRK07661		391	acetyl-CoA acetyltransferase; Provisional	98.08
PLN02287		452	3-ketoacyl-CoA thiolase	98.08
PRK07851		406	acetyl-CoA acetyltransferase; Provisional	98.02
PRK06158		384	thiolase; Provisional	98.0
PRK06289		403	acetyl-CoA acetyltransferase; Provisional	97.97
PRK08963		428	fadI 3-ketoacyl-CoA thiolase; Reviewed	97.93
PRK06633		392	acetyl-CoA acetyltransferase; Provisional	97.93
PRK06445		394	acetyl-CoA acetyltransferase; Provisional	97.92
PRK07516		389	acetyl-CoA acetyltransferase; Provisional	97.85
PRK13359		400	beta-ketoadipyl CoA thiolase; Provisional	97.84
PRK09050		401	beta-ketoadipyl CoA thiolase; Validated	97.84
PRK06366		388	acetyl-CoA acetyltransferase; Provisional	97.83
PRK07850		387	acetyl-CoA acetyltransferase; Provisional	97.83
PLN02644		394	acetyl-CoA C-acetyltransferase	97.81
PRK08131		401	acetyl-CoA acetyltransferase; Provisional	97.81
TIGR02430		400	pcaF beta-ketoadipyl CoA thiolase. Members of this	97.77
PRK06157		398	acetyl-CoA acetyltransferase; Validated	97.74
TIGR02446		430	FadI fatty oxidation complex, beta subunit FadI. T	97.72
cd00834		406	KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP)	97.69
PRK06365		430	acetyl-CoA acetyltransferase; Provisional	97.69
smart00825		424	PKS_KS Beta-ketoacyl synthase. The structure of be	97.67
PRK08256		391	lipid-transfer protein; Provisional	97.66
KOG1393		462	consensus Hydroxymethylglutaryl-CoA synthase [Lipi	97.64
PRK06504		390	acetyl-CoA acetyltransferase; Provisional	97.62
PRK08947		387	fadA 3-ketoacyl-CoA thiolase; Reviewed	97.59
PTZ00455		438	3-ketoacyl-CoA thiolase; Provisional	97.58
TIGR02445		385	fadA fatty oxidation complex, beta subunit FadA. T	97.44
PRK08257		498	acetyl-CoA acetyltransferase; Validated	97.42
PRK09268		427	acetyl-CoA acetyltransferase; Provisional	97.39
PRK07801		382	acetyl-CoA acetyltransferase; Provisional	97.34
PRK08142		388	acetyl-CoA acetyltransferase; Provisional	97.28
PRK06025		417	acetyl-CoA acetyltransferase; Provisional	97.22
PRK07937		352	lipid-transfer protein; Provisional	97.05
PRK06066		385	acetyl-CoA acetyltransferase; Provisional	97.05
cd00833		421	PKS polyketide synthases (PKSs) polymerize simple	97.04
PRK07855		386	lipid-transfer protein; Provisional	96.94
PRK06690		361	acetyl-CoA acetyltransferase; Provisional	96.39
PF08545		80	ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP)	96.28
PRK06501		425	3-oxoacyl-(acyl carrier protein) synthase II; Revi	96.15
cd00828		407	elong_cond_enzymes "elongating" condensing enzymes	96.08
TIGR03150		407	fabF beta-ketoacyl-acyl-carrier-protein synthase I	95.72
PRK07314		411	3-oxoacyl-(acyl carrier protein) synthase II; Revi	95.58
PRK08439		406	3-oxoacyl-(acyl carrier protein) synthase II; Revi	94.49
PF08540		282	HMG_CoA_synt_C: Hydroxymethylglutaryl-coenzyme A s	94.12
COG0183		392	PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis	93.83
PRK06333		424	3-oxoacyl-(acyl carrier protein) synthase II; Revi	93.47
PRK07103		410	polyketide beta-ketoacyl:acyl carrier protein synt	93.04
PF07451		329	SpoVAD: Stage V sporulation protein AD (SpoVAD); I	92.95
PF00109		254	ketoacyl-synt: Beta-ketoacyl synthase, N-terminal	91.65
KOG2708		336	consensus Predicted metalloprotease with chaperone	91.57
PF08541		90	ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (AC	91.57
PRK08722		414	3-oxoacyl-(acyl carrier protein) synthase II; Revi	90.8
PTZ00050		421	3-oxoacyl-acyl carrier protein synthase; Provision	90.59
PRK12879		325	3-oxoacyl-(acyl carrier protein) synthase III; Rev	89.25
PRK07967		406	3-oxoacyl-(acyl carrier protein) synthase I; Revie	88.79
PLN02836		437	3-oxoacyl-[acyl-carrier-protein] synthase	88.65
PRK09352		319	3-oxoacyl-(acyl carrier protein) synthase III; Rev	87.89
cd00830		320	KAS_III Ketoacyl-acyl carrier protein synthase III	87.51
PRK09116		405	3-oxoacyl-(acyl carrier protein) synthase II; Revi	87.48
PRK06816		378	3-oxoacyl-(acyl carrier protein) synthase III; Rev	86.93
cd00832		399	CLF Chain-length factor (CLF) is a factor required	86.51
KOG1406		408	consensus Peroxisomal 3-ketoacyl-CoA-thiolase P-44	86.5
PRK07204		329	3-oxoacyl-(acyl carrier protein) synthase III; Rev	86.38
PRK06519		398	3-oxoacyl-(acyl carrier protein) synthase II; Revi	86.36
PRK05963		326	3-oxoacyl-(acyl carrier protein) synthase II; Revi	85.79
PLN02787		540	3-oxoacyl-[acyl-carrier-protein] synthase II	85.45
TIGR00747		318	fabH 3-oxoacyl-(acyl-carrier-protein) synthase III	84.33
KOG1390		396	consensus Acetyl-CoA acetyltransferase [Lipid tran	83.84
KOG1391		396	consensus Acetyl-CoA acetyltransferase [Lipid tran	83.41
PRK09258		338	3-oxoacyl-(acyl carrier protein) synthase III; Rev	83.39
PRK09185		392	3-oxoacyl-(acyl carrier protein) synthase I; Revie	82.19
PRK14691		342	3-oxoacyl-(acyl carrier protein) synthase II; Prov	80.85
PLN02326		379	3-oxoacyl-[acyl-carrier-protein] synthase III	80.57
PRK06840		339	hypothetical protein; Validated	80.28

>PLN02192 3-ketoacyl-CoA synthase	Back alignment and domain information

Probab=100.00  E-value=7e-75  Score=583.36  Aligned_cols=319  Identities=58%  Similarity=0.968  Sum_probs=274.2

Q ss_pred             ccchhhhhhhhHHhhhHHHHHHHHHHHHHHhhhcccCCCChhHHHHHHHhhhh---------------------------
Q 043382            3 VASVKWKVGYHYLISNAPHLLLVSLLGIVLIYDGFSTLSTLDDLLQFWNELSF---------------------------   55 (329)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------------------------   55 (329)
                      |..||+|+||||+++|+++++++|++++++.  ++.+++ +++++++|..+++                           
T Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v  102 (511)
T PLN02192         26 VKLKYVKLGYHYLITHGMYLFLSPLVVVIAA--QLSTFS-IQDLHDLWEHLKFNLISVILCSTLLVFLSTLYFLTRPRPV  102 (511)
T ss_pred             hhhhhhhhhhHHHHhhhHHHHHHHHHHHHHH--HHhhcC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcE
Confidence            4468899999999999999999999988888  999999 8898888877653                           


Q ss_pred             -hhhH------------------------------HHHHHHHHHHcCCCceEeccCCCCCCCCCchhHHHHHhhchHHHH
Q 043382           56 -KLNY------------------------------VTVLLKLLERSRIGNMTYGPKSLMDNPAENRHMKEAKKETDDVII  104 (329)
Q Consensus        56 -~~~~------------------------------~~~~~~I~~~sGI~~R~~~~~~~~~~pe~~~~ma~~~~ea~~l~~  104 (329)
                       |||+                              .++++||++|||+++++|+|+.++++| +..+|+++|+|++++++
T Consensus       103 ylvd~~c~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~sglg~~t~~p~~~~~~~-~~~~~~~~~~Ea~~~~~  181 (511)
T PLN02192        103 YLVDFSCYKPDDSRKCTRKIFMDRSKLTGSFTEENLEFQRKILERSGLGESTYLPEAVLNVP-PNPCMAEARKEAETVMF  181 (511)
T ss_pred             EEEeeeeecCCccccccHHHHHHHHHHcCCCCHHHHHHHHHHHHhcCCCCcccCChhhccCC-CCccHHHHHHHHHHHHH
Confidence             2221                              111189999999999999999999998 77899999999999999


Q ss_pred             HHHHHHHHhcCCCCCCcCEEEEeccCCCCCCchHHHHHHHcCCCCCcceecccch-------------HHHhcCCCCeEE
Q 043382          105 GAIDERLAKTGFKHKDIGILVVNSSLFNPTPSLSAFIVNHYKLRSNILSYNLGAL-------------QSAQVQPNSYTL  171 (329)
Q Consensus       105 ~Aa~~aL~kagv~p~dId~LVv~ss~~~~~Ps~aa~I~~~Lglr~~v~~~dl~g~-------------~lL~a~~~~~aL  171 (329)
                      +|+++||+++|++|+|||+||++||+++++||++++|+|+|||++++.+||++||             ++|+++++++||
T Consensus       182 ~Aa~~aL~kaGi~p~DIDiLIv~~S~~~~~PSlaa~I~n~lGlr~~i~afdLsgmGCSggl~aLdlA~~lL~a~~~~~aL  261 (511)
T PLN02192        182 GAIDQLLAKTSVKPKDIGILIVNCSLFNPTPSLSAMVINHYKLRGNILSYNLGGMGCSAGLISIDLAKHLLQVHPNSYAL  261 (511)
T ss_pred             HHHHHHHHHcCCCHHHCCEEEEECCCCCCCchHHHHHHHHhCCCCCceEEEcccchhhhHHHHHHHHHHHHHcCCCCeEE
Confidence            9999999999999999999999999999999999999999999989999999986             899999999999


Q ss_pred             EEeecCCCCCccccCCCccccccccccc----------------------------------------------------
Q 043382          172 VVSTENITLGLYTGNDRSILRTTAYFVV----------------------------------------------------  199 (329)
Q Consensus       172 VVs~E~~S~~~~~Gd~~sall~~~~~~~----------------------------------------------------  199 (329)
                      |||+|++|.|||+|+++++++.||++|.                                                    
T Consensus       262 VVstE~~S~n~y~g~drs~lv~n~LFgDGAaAvLLs~~~~~~~~~k~~L~~~vrt~~~~dd~~~~~v~~~ed~~g~~g~~  341 (511)
T PLN02192        262 VISMENITLNWYFGNDRSMLVSNCLFRMGGAAILLSNKRSDRRRSKYQLVHTVRTHKGADDKCFACVTQEEDSAGKIGVS  341 (511)
T ss_pred             EEEEEeccccCCCCCCHHHHhccccccccceEEEEeccccccccccceeeeeEEEEecCChhhccceecccccccceeeE
Confidence            9999999998865555555555544211                                                    


Q ss_pred             --------ccceeecccCCCCCccccccccceeeEeechHHHHHHHHhcc------------------------------
Q 043382          200 --------AGEALKTHITALGPLVLPVSEQLLFIATSVGRKIFKMKIKQY------------------------------  241 (329)
Q Consensus       200 --------~g~aL~~di~~~Gp~vlP~se~~~~~~~~~grkv~~~~v~~~------------------------------  241 (329)
                              ++.++++++++.||.++|.+|+.++++++.|+++|+.+++++                              
T Consensus       342 Lskdl~~vag~al~~ni~~l~p~vlp~~e~~~~~~~m~gr~vfk~~~~~~~p~~~~~Idhf~iHqggr~IId~v~k~LgL  421 (511)
T PLN02192        342 LSKDLMAVAGDALKTNITTLGPLVLPMSEQLLFFATLVGKKLFKMKLKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQL  421 (511)
T ss_pred             ecchhhhhhhhhhhhhhhhcccccCccchhhceeEEEcChHHHHHHhhhccHHHHHhhceEeeccCCHHHHHHHHHHcCC
Confidence                    122334445556787889889888889999999988766543                              


Q ss_pred             ------CccccccccCCCCcCcHHHHHHHHHHhCCCCCCCEEEEEeechhhhhhheeeeeeccCCCCCCCCCCCCccccc
Q 043382          242 ------PSRVTLYRFRNTSSSLVWYELAYAEAKRRIPKGDRICQIGFGAGFNCNTVVWPVLKTINLNPALDKNPWIDEID  315 (329)
Q Consensus       242 ------~sr~tl~~~GNtsSaSi~~~La~~~~kgrlk~GDrV~~iafGsGf~~~sav~r~~~~~~~~~~~~~~~w~~~~~  315 (329)
                            +++++|++||||||+|+||+|++++++|++|+||+|||+|||+||+|++++|||+|++++  ..+.|||+||||
T Consensus       422 ~~~~~e~sr~tL~rfGNTSSaSI~~aL~~~eakgrik~GDrVl~iaFGsGf~~~sav~~~~~~~~~--~~~~~~w~~~i~  499 (511)
T PLN02192        422 SDWHMEPSRMTLYRFGNTSSSSLWYELAYSEAKGRIKKGDRTWQIAFGSGFKCNSAVWKALRTVNP--AKEKNPWMDEIH  499 (511)
T ss_pred             CchhhhHHHHHHhHcCChHHhHHHHHHHHHHHcCCCCCCCEEEEEEEcchHhhhhhheeeecccCC--cccCCCchhhHH
Confidence                  345999999999999999999999999999999999999999999999999999999887  331499999999


Q ss_pred             cCCCCCCCCCcC
Q 043382          316 DFPVQLPQFAPI  327 (329)
Q Consensus       316 ~~p~~~~~~~~~  327 (329)
                      +|||++|.+..|
T Consensus       500 ~yp~~~~~~~~~  511 (511)
T PLN02192        500 EFPVDVPKVSTI  511 (511)
T ss_pred             hCCCCCCCCCCC
Confidence            999999988654

>PLN02854 3-ketoacyl-CoA synthase	Back alignment and domain information

>PLN02377 3-ketoacyl-CoA synthase	Back alignment and domain information

>PLN02932 3-ketoacyl-CoA synthase	Back alignment and domain information

>PLN00415 3-ketoacyl-CoA synthase	Back alignment and domain information

>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein]	Back alignment and domain information

>PF08392 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase-like protein; InterPro: IPR013601 This domain is found in proteins that are described as 3-ketoacyl-CoA synthases, type III polyketide synthases, fatty acid elongases and fatty acid condensing enzymes, and are found in both prokaryotic and eukaryotic (mainly plant) species	Back alignment and domain information

>PLN03168 chalcone synthase; Provisional	Back alignment and domain information

>PLN03172 chalcone synthase family protein; Provisional	Back alignment and domain information

>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs	Back alignment and domain information

>PLN03170 chalcone synthase; Provisional	Back alignment and domain information

>PLN03169 chalcone synthase family protein; Provisional	Back alignment and domain information

>PLN03171 chalcone synthase-like protein; Provisional	Back alignment and domain information

>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed	Back alignment and domain information

>PLN03173 chalcone synthase; Provisional	Back alignment and domain information

>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III	Back alignment and domain information

>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional	Back alignment and domain information

>PRK06840 hypothetical protein; Validated	Back alignment and domain information

>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III	Back alignment and domain information

>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems	Back alignment and domain information

>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative	Back alignment and domain information

>PRK04262 hypothetical protein; Provisional	Back alignment and domain information

>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes	Back alignment and domain information

>TIGR01835 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade	Back alignment and domain information

>PF00195 Chal_sti_synt_N: Chalcone and stilbene synthases, N-terminal domain; InterPro: IPR001099 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2	Back alignment and domain information

>PLN02577 hydroxymethylglutaryl-CoA synthase	Back alignment and domain information

>COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism]	Back alignment and domain information

>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction	Back alignment and domain information

>TIGR01833 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade	Back alignment and domain information

>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction	Back alignment and domain information

>PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2	Back alignment and domain information

>PF02797 Chal_sti_synt_C: Chalcone and stilbene synthases, C-terminal domain; InterPro: IPR012328 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2	Back alignment and domain information

>TIGR02845 spore_V_AD stage V sporulation protein AD	Back alignment and domain information

>PF01154 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A synthase N terminal; InterPro: IPR013528 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase	Back alignment and domain information

>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated	Back alignment and domain information

>PRK08304 stage V sporulation protein AD; Validated	Back alignment and domain information

>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine	Back alignment and domain information

>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases	Back alignment and domain information

>PRK07108 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK05656 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK06205 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK08235 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK06059 lipid-transfer protein; Provisional	Back alignment and domain information

>PRK09052 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK08313 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK09051 beta-ketothiolase; Provisional	Back alignment and domain information

>PRK08170 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK12578 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK08242 acetyl-CoA acetyltransferase; Validated	Back alignment and domain information

>cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism	Back alignment and domain information

>cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine	Back alignment and domain information

>PRK06065 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK05790 putative acyltransferase; Provisional	Back alignment and domain information

>PRK06954 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK06064 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK12404 stage V sporulation protein AD; Provisional	Back alignment and domain information

>PF00108 Thiolase_N: Thiolase, N-terminal domain; InterPro: IPR020616 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2	Back alignment and domain information

>PRK07661 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PLN02287 3-ketoacyl-CoA thiolase	Back alignment and domain information

>PRK07851 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK06158 thiolase; Provisional	Back alignment and domain information

>PRK06289 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed	Back alignment and domain information

>PRK06633 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK06445 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK07516 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK13359 beta-ketoadipyl CoA thiolase; Provisional	Back alignment and domain information

>PRK09050 beta-ketoadipyl CoA thiolase; Validated	Back alignment and domain information

>PRK06366 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK07850 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PLN02644 acetyl-CoA C-acetyltransferase	Back alignment and domain information

>PRK08131 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>TIGR02430 pcaF beta-ketoadipyl CoA thiolase	Back alignment and domain information

>PRK06157 acetyl-CoA acetyltransferase; Validated	Back alignment and domain information

>TIGR02446 FadI fatty oxidation complex, beta subunit FadI	Back alignment and domain information

>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II	Back alignment and domain information

>PRK06365 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>smart00825 PKS_KS Beta-ketoacyl synthase	Back alignment and domain information

>PRK08256 lipid-transfer protein; Provisional	Back alignment and domain information

>KOG1393 consensus Hydroxymethylglutaryl-CoA synthase [Lipid transport and metabolism]	Back alignment and domain information

>PRK06504 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed	Back alignment and domain information

>PTZ00455 3-ketoacyl-CoA thiolase; Provisional	Back alignment and domain information

>TIGR02445 fadA fatty oxidation complex, beta subunit FadA	Back alignment and domain information

>PRK08257 acetyl-CoA acetyltransferase; Validated	Back alignment and domain information

>PRK09268 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK07801 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK08142 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK06025 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK07937 lipid-transfer protein; Provisional	Back alignment and domain information

>PRK06066 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations	Back alignment and domain information

>PRK07855 lipid-transfer protein; Provisional	Back alignment and domain information

>PRK06690 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PF08545 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III; InterPro: IPR013751 Fatty acid synthesis (FAS) is a vital aspect of cellular physiology which can occur by two distinct pathways	Back alignment and domain information

>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed	Back alignment and domain information

>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases	Back alignment and domain information

>TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II	Back alignment and domain information

>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed	Back alignment and domain information

>PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed	Back alignment and domain information

>PF08540 HMG_CoA_synt_C: Hydroxymethylglutaryl-coenzyme A synthase C terminal; InterPro: IPR013746 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase	Back alignment and domain information

>COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism]	Back alignment and domain information

>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed	Back alignment and domain information

>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated	Back alignment and domain information

>PF07451 SpoVAD: Stage V sporulation protein AD (SpoVAD); InterPro: IPR010894 This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long	Back alignment and domain information

>PF00109 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal domain; InterPro: IPR014030 Beta-ketoacyl-ACP synthase 2	Back alignment and domain information

>KOG2708 consensus Predicted metalloprotease with chaperone activity (RNAse H/HSP70 fold) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2	Back alignment and domain information

>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed	Back alignment and domain information

>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional	Back alignment and domain information

>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed	Back alignment and domain information

>PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase	Back alignment and domain information

>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems	Back alignment and domain information

>PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed	Back alignment and domain information

>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria	Back alignment and domain information

>KOG1406 consensus Peroxisomal 3-ketoacyl-CoA-thiolase P-44/SCP2 [Lipid transport and metabolism]	Back alignment and domain information

>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed	Back alignment and domain information

>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed	Back alignment and domain information

>PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II	Back alignment and domain information

>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III	Back alignment and domain information

>KOG1390 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism]	Back alignment and domain information

>KOG1391 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism]	Back alignment and domain information

>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed	Back alignment and domain information

>PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional	Back alignment and domain information

>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III	Back alignment and domain information

>PRK06840 hypothetical protein; Validated	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		329
2h84_A		374	Steely1; thiolase-fold, type III polyketide syntha	6e-36
3a5r_A		387	Benzalacetone synthase; chalcone synthase, type II	9e-25
3awk_A		402	Chalcone synthase-like polyketide synthase; type I	1e-24
2p0u_A		413	Stilbenecarboxylate synthase 2; polyketide synthas	3e-21
3v7i_A		413	Putative polyketide synthase; type III polyketide	1e-20
1xes_A		413	Dihydropinosylvin synthase; native structure, tran	2e-19
3oit_A		387	OS07G0271500 protein; type III polyketide synthase	6e-19
3oit_A		387	OS07G0271500 protein; type III polyketide synthase	2e-14
2d3m_A		406	Pentaketide chromone synthase; chalcone synthase,	1e-18
1i88_A		389	CHS2, chalcone synthase 2; polyketide synthase, tr	7e-14
1i88_A		389	CHS2, chalcone synthase 2; polyketide synthase, tr	1e-09
1ee0_A		402	2-pyrone synthase; polyketide synthase, thiolase f	3e-10
1u0m_A		382	Putative polyketide synthase; type III polyketide	5e-08
1ted_A		393	PKS18; thiolase fold, substrate binding tunnel, tr	2e-07
3e1h_A		465	PKSIIINC, putative uncharacterized protein; resorc	4e-06
3e1h_A		465	PKSIIINC, putative uncharacterized protein; resorc	1e-05
3euo_A		379	Type III pentaketide synthase; alpha helix, acyltr	1e-05
3euo_A		379	Type III pentaketide synthase; alpha helix, acyltr	2e-04
3h78_A		359	PQS biosynthetic enzyme; PQSD, anthranilic acid, a	1e-04
3led_A		392	3-oxoacyl-acyl carrier protein synthase III; struc	2e-04

>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Length = 374	Back alignment and structure

 Score =  132 bits (334), Expect = 6e-36
 Identities = 41/322 (12%), Positives = 83/322 (25%), Gaps = 93/322 (28%)

Query: 63  LLKLLERSRIGNMTYGPKSLMDNPAENRH--------MKEAKKETDDVIIGAIDERLAKT 114
           + ++ E+S+I              +              + KK   D+   A    L   
Sbjct: 51  VKRIFEQSQIKTRHLVRDYTKPENSIKFRHLETITDVNNQFKKVVPDLAQQACLRALKDW 110

Query: 115 GFKHKDIGILVVNSSLFNPTPSLSAFIVNHYKLRSNILSYNLG-------------ALQS 161
           G    DI  +V  +S     P ++  +++   L  ++   +L              A   
Sbjct: 111 GGDKGDITHIVSVTSTGIIIPDVNFKLIDLLGLNKDVERVSLNLMGCLAGLSSLRTAASL 170

Query: 162 AQVQPNSYTLVVSTENITLGLYTGNDRS------------------------------IL 191
           A+  P +  LVV TE  +L     +                                 ++
Sbjct: 171 AKASPRNRILVVCTEVCSLHFSNTDGGDQMVASSIFADGSAAYIIGCNPRIEETPLYEVM 230

Query: 192 RTTAYFV--------------------------VAGEALKTHIT-ALGPLVLPVSEQLL- 223
            +                               V G  ++  +   L    L  S  +  
Sbjct: 231 CSINRSFPNTENAMVWDLEKEGWNLGLDASIPIVIGSGIEAFVDTLLDKAKLQTSTAISA 290

Query: 224 ----FIATSVGRKIFK--------MKIKQYPSRVTLYRFRNTSSSLVWYELAYAEAKRRI 271
               F+  + G+ I             +   +    + + N SS+ V + + +A   +  
Sbjct: 291 KDCEFLIHTGGKSILMNIENSLGIDPKQTKNTWDVYHAYGNMSSASVIFVMDHARKSKS- 349

Query: 272 PKGDRICQIGFGAGFNCNTVVW 293
                   + FG G        
Sbjct: 350 -LPTYSISLAFGPGLAFEGCFL 370

PyMOL of 2h84

>3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A Length = 387	Back alignment and structure

>3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} Length = 413	Back alignment and structure

>1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A Length = 413	Back alignment and structure

>3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A Length = 387	Back alignment and structure

>3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A Length = 387	Back alignment and structure

>1i88_A CHS2, chalcone synthase 2; polyketide synthase, transferase; 1.45A {Medicago sativa} SCOP: c.95.1.2 c.95.1.2 PDB: 1i89_A 1i86_A 1i8b_A 1bi5_A 1cml_A* 1d6f_A* 1chw_A* 1cgz_A* 1cgk_A* 1bq6_A* 1jwx_A 1d6i_A 1d6h_A* 1u0v_A 1u0w_A* 1z1e_A* 1z1f_A* Length = 389	Back alignment and structure

>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Length = 382	Back alignment and structure

>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Length = 393	Back alignment and structure

>3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} Length = 465	Back alignment and structure

>3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} Length = 465	Back alignment and structure

>3euo_A Type III pentaketide synthase; alpha helix, acyltransferase, transferase; 1.75A {Neurospora crassa} PDB: 3eut_A* 3euq_A* Length = 379	Back alignment and structure

>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Length = 359	Back alignment and structure

>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} Length = 392	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		329
4ewp_A		350	3-oxoacyl-[acyl-carrier-protein] synthase 3; trans	100.0
3gwa_A		365	3-oxoacyl-(acyl-carrier-protein) synthase III; str	100.0
3il6_A		321	3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH,	100.0
3il3_A		323	3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH,	100.0
4efi_A		354	3-oxoacyl-(acyl-carrier protein) synthase; structu	100.0
3e1h_A		465	PKSIIINC, putative uncharacterized protein; resorc	100.0
4dfe_A		333	3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci	100.0
3s21_A		345	3-oxoacyl-[ACP] synthase III; non-decarboxylative	100.0
3h78_A		359	PQS biosynthetic enzyme; PQSD, anthranilic acid, a	100.0
3led_A		392	3-oxoacyl-acyl carrier protein synthase III; struc	100.0
3ov2_A		393	Curcumin synthase; type III polyketide synthase, t	100.0
3euo_A		379	Type III pentaketide synthase; alpha helix, acyltr	99.98
3oit_A		387	OS07G0271500 protein; type III polyketide synthase	99.97
3s3l_A		357	CERJ; acyltransferase, FABH homologue, KS III homo	99.97
3v7i_A		413	Putative polyketide synthase; type III polyketide	99.97
1i88_A		389	CHS2, chalcone synthase 2; polyketide synthase, tr	99.97
3awk_A		402	Chalcone synthase-like polyketide synthase; type I	99.97
3a5r_A		387	Benzalacetone synthase; chalcone synthase, type II	99.96
2p0u_A		413	Stilbenecarboxylate synthase 2; polyketide synthas	99.96
1ee0_A		402	2-pyrone synthase; polyketide synthase, thiolase f	99.96
1xes_A		413	Dihydropinosylvin synthase; native structure, tran	99.96
1mzj_A		339	Beta-ketoacylsynthase III; beta-ketosynthase, arom	99.96
2x3e_A		331	3-oxoacyl-[acyl-carrier-protein] synthase 3; HED,	99.96
2d3m_A		406	Pentaketide chromone synthase; chalcone synthase,	99.96
1ted_A		393	PKS18; thiolase fold, substrate binding tunnel, tr	99.96
1u0m_A		382	Putative polyketide synthase; type III polyketide	99.96
1hnj_A		317	Beta-ketoacyl-acyl carrier protein synthase III; F	99.95
2h84_A		374	Steely1; thiolase-fold, type III polyketide syntha	99.95
3tsy_A		979	Fusion protein 4-coumarate--COA ligase 1, resvera	99.95
1ub7_A		322	3-oxoacyl-[acyl-carrier protein] synthase; fatty a	99.94
1u6e_A		335	3-oxoacyl-[acyl-carrier-protein] synthase III; tra	99.94
1zow_A		313	3-oxoacyl-[acyl-carrier-protein] synthase III; FAB	99.94
1xpm_A		396	3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s	99.94
3v4n_A		388	HMG-COA synthase; hydroxymethylglutaryl-COA syntha	99.94
3sqz_A		425	Putative hydroxymethylglutaryl-COA synthase; thiol	99.94
2ebd_A		309	3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH,	99.94
2wya_A		460	Hydroxymethylglutaryl-COA synthase, mitochondrial;	99.93
2v4w_A		460	Hydroxymethylglutaryl-COA synthase, mitochondrial;	99.92
2p8u_A		478	Hydroxymethylglutaryl-COA synthase, cytoplasmic; h	99.92
2f82_A		450	HMG-COA synthase; HMGS1, transferase; 2.10A {Brass	99.92
3lma_A		347	Stage V sporulation protein AD (spovad); NESG, str	99.37
4dd5_A		396	Acetyl-COA acetyltransferase; structural genomics,	99.0
4e1l_A		395	Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich,	98.89
3ss6_A		394	Acetyl-COA acetyltransferase; structural genomics,	98.84
3goa_A		387	3-ketoacyl-COA thiolase; metabolism, fatty acid, p	98.71
1ulq_A		401	Putative acetyl-COA acetyltransferase; structural	98.62
3svk_A		407	Acetyl-COA acetyltransferase; ssgcid, NIH, niaid,	98.54
2iik_A		418	3-ketoacyl-COA thiolase, peroxisomal; fatty acid m	98.49
1afw_A		393	3-ketoacetyl-COA thiolase; fatty acid metabolism;	98.38
2wu9_A		442	3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o	98.28
1tqy_A		424	Beta-ketoacyl synthase/acyl transferase; alpha-bet	98.25
2ib8_A		395	Acetyl-COA acetyltransferase; thiolase fold, potas	98.24
1wl4_A		397	Acetyl-coenzyme A acetyltransferase 2; thiolase fo	98.17
2vu1_A		392	Acetyl-COA acetyltransferase; acyltransferase, PHB	98.16
1wdk_C		390	3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame	98.11
3o04_A		413	LMO2201 protein, beta-keto-acyl carrier protein sy	98.09
2gqd_A		437	3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli	97.96
4ddo_A		451	3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci	97.88
3ho9_A		427	3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF,	97.88
1e5m_A		416	KAS II, beta ketoacyl acyl carrier protein synthas	97.87
1tqy_B		415	Actinorhodin polyketide putative beta-ketoacyl SY;	97.86
3kzu_A		428	3-oxoacyl-(acyl-carrier-protein) synthase II; seat	97.84
1ox0_A		430	Beta ketoacyl-acyl carrier protein synthase; trans	97.83
2ix4_A		431	3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke	97.75
2iwz_A		438	3-oxoacyl-[acyl-carrier-protein] synthase; mitocho	97.56
2gp6_A		434	3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol	97.53
3mqd_A		428	Beta-ketoacyl synthase; ssgcid, ALS collaborative	97.45
4ewg_A		412	Beta-ketoacyl synthase; ssgcid, structural genomic	97.43
2qo3_A		915	Eryaii erythromycin polyketide synthase modules 3;	97.33
1j3n_A		408	3-oxoacyl-(acyl-carrier protein) synthase II; cond	97.3
3hhd_A		965	Fatty acid synthase; transferase, multienzyme, meg	97.17
2vba_A		406	3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop	97.05
2wge_A		416	3-oxoacyl-[acyl-carrier-protein] synthase 1; beta	97.01
4egv_A		520	Acetyl-COA acetyltransferase; NEW SUB-family, thio	96.78
2hg4_A		917	DEBS, 6-deoxyerythronolide B synthase; ketosynthas	96.54
3zen_D		3089	Fatty acid synthase; transferase, mycolic acid bio	92.54
2x3e_A		331	3-oxoacyl-[acyl-carrier-protein] synthase 3; HED,	88.3
3il3_A		323	3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH,	87.89
4dfe_A		333	3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci	87.26
3gwa_A		365	3-oxoacyl-(acyl-carrier-protein) synthase III; str	87.14
2pff_A		1688	Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl	86.79
1mzj_A		339	Beta-ketoacylsynthase III; beta-ketosynthase, arom	86.16
1hnj_A		317	Beta-ketoacyl-acyl carrier protein synthase III; F	86.16
3s21_A		345	3-oxoacyl-[ACP] synthase III; non-decarboxylative	86.11
1zow_A		313	3-oxoacyl-[acyl-carrier-protein] synthase III; FAB	85.22
4ewp_A		350	3-oxoacyl-[acyl-carrier-protein] synthase 3; trans	85.09
2vu1_A		392	Acetyl-COA acetyltransferase; acyltransferase, PHB	84.96
3lma_A		347	Stage V sporulation protein AD (spovad); NESG, str	84.79
2ebd_A		309	3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH,	84.16
1ulq_A		401	Putative acetyl-COA acetyltransferase; structural	83.55
1ted_A		393	PKS18; thiolase fold, substrate binding tunnel, tr	82.36
3h78_A		359	PQS biosynthetic enzyme; PQSD, anthranilic acid, a	82.32
3s3l_A		357	CERJ; acyltransferase, FABH homologue, KS III homo	81.57
1wl4_A		397	Acetyl-coenzyme A acetyltransferase 2; thiolase fo	81.52
1ub7_A		322	3-oxoacyl-[acyl-carrier protein] synthase; fatty a	81.31
1u6e_A		335	3-oxoacyl-[acyl-carrier-protein] synthase III; tra	81.0
3svk_A		407	Acetyl-COA acetyltransferase; ssgcid, NIH, niaid,	80.85
4efi_A		354	3-oxoacyl-(acyl-carrier protein) synthase; structu	80.51
4e1l_A		395	Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich,	80.44
4egv_A		520	Acetyl-COA acetyltransferase; NEW SUB-family, thio	80.39

>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665}	Back alignment and structure

Probab=100.00  E-value=7.2e-40  Score=315.18  Aligned_cols=217  Identities=18%  Similarity=0.176  Sum_probs=171.3

Q ss_pred             HHHHHHcCCCceEeccCCCCCCCCCchhHHHHHhhchHHHHHHHHHHHHhcCCCCCCcCEEEEeccC-CCCCCchHHHHH
Q 043382           64 LKLLERSRIGNMTYGPKSLMDNPAENRHMKEAKKETDDVIIGAIDERLAKTGFKHKDIGILVVNSSL-FNPTPSLSAFIV  142 (329)
Q Consensus        64 ~~I~~~sGI~~R~~~~~~~~~~pe~~~~ma~~~~ea~~l~~~Aa~~aL~kagv~p~dId~LVv~ss~-~~~~Ps~aa~I~  142 (329)
                      +||.+|+||++||++.++     |+..+|+          ++|+++||+++|++|+|||+||++|++ +++.|+++++||
T Consensus        42 e~I~~rtGI~~R~~a~~~-----e~~~~la----------~~Aa~~aL~~ag~~~~dId~li~~t~t~~~~~P~~a~~v~  106 (350)
T 4ewp_A           42 EWIRQRTGIVTRQRATAE-----ETVPVMA----------VGAAREALERAGLQGSDLDAVIVSTVTFPHATPSAAALVA  106 (350)
T ss_dssp             HHHHHHHCCSEEECCCSS-----CCHHHHH----------HHHHHHHHHHTTCCGGGCSEEEEECSCCSCSSSCHHHHHH
T ss_pred             HHHHhccCceEEEEcCCC-----CCHHHHH----------HHHHHHHHHHcCCCHHHCCEEEEEeccCCCCCCchHHHHH
Confidence            799999999999999888     6888888          999999999999999999999999888 689999999999


Q ss_pred             HHcCCCCCcceecccch------------HHHhcCCCCeEEEEeecCCCC--C-------ccccCCCccc-ccccc-ccc
Q 043382          143 NHYKLRSNILSYNLGAL------------QSAQVQPNSYTLVVSTENITL--G-------LYTGNDRSIL-RTTAY-FVV  199 (329)
Q Consensus       143 ~~Lglr~~v~~~dl~g~------------~lL~a~~~~~aLVVs~E~~S~--~-------~~~Gd~~sal-l~~~~-~~~  199 (329)
                      ++||++ ++.+||++++            +++++++.++||||++|.+|.  +       ++|||+++++ |+... .++
T Consensus       107 ~~LGl~-~~~a~di~~~C~g~~~aL~~A~~~i~~g~~~~~Lvv~~E~~s~~~d~~~~~~~~lfgDGA~A~vl~~~~~~~~  185 (350)
T 4ewp_A          107 HEIGAT-PAPAYDVSAACAGYCYGVAQADALVRSGTARHVLVVGVERLSDVVDPTDRSISFLLGDGAGAVIVAASDEPGI  185 (350)
T ss_dssp             HHTTCT-TSCEEEEECGGGHHHHHHHHHHHHHHTTSCSEEEEEEEEEGGGGCCTTCTTTGGGBCEEEEEEEEEEESSCCB
T ss_pred             HHhCCC-CceEEEeecchhhHHHHHHHhhhhhhCCCccceeEeeeeeceecccccccccccccccchheeeeecccCCCc
Confidence            999998 6779999766            889999999999999999983  2       4899999987 55422 122


Q ss_pred             ccceeeccc--------CCCCC---------------cccccc-ccceeeEeechHHHHHHHHhcc--------------
Q 043382          200 AGEALKTHI--------TALGP---------------LVLPVS-EQLLFIATSVGRKIFKMKIKQY--------------  241 (329)
Q Consensus       200 ~g~aL~~di--------~~~Gp---------------~vlP~s-e~~~~~~~~~grkv~~~~v~~~--------------  241 (329)
                      ....+.+|-        +..+.               ...... ......++|+|+++|+++++.+              
T Consensus       186 ~~~~~~sdg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~v~~~a~~~~~~~i~~~L~~~gl~  265 (350)
T 4ewp_A          186 SPSVWGSDGERWSTISMTHSQLELRDAVEHARTTGDASAITGAEGMLWPTLRQDGPSVFRWAVWSMAKVAREALDAAGVE  265 (350)
T ss_dssp             CCCEEEECGGGTTSEEESSCHHHHHHHHHHHHHHSCCTTTTTCSSCSSCCEEECHHHHHHHHHHTHHHHHHHHHHHHTCC
T ss_pred             cceeeeecccccceeeecCCccccCcccccccccCCccccccccccccceeEehhHHHHHHHHHhhhHHHHHHHHhhcCC
Confidence            223333320        00000               000000 0112346677777776544322              


Q ss_pred             ---------------------------Ccc---ccccccCCCCcCcHHHHHHHHHHhCCCCCCCEEEEEeechhhhhhhe
Q 043382          242 ---------------------------PSR---VTLYRFRNTSSSLVWYELAYAEAKRRIPKGDRICQIGFGAGFNCNTV  291 (329)
Q Consensus       242 ---------------------------~sr---~tl~~~GNtsSaSi~~~La~~~~kgrlk~GDrV~~iafGsGf~~~sa  291 (329)
                                                 ++|   .++++||||||+|+|+.|++++++|++++||+|+++|||+||+|+++
T Consensus       266 ~~did~~v~Hq~~~~i~~~~~~~Lgl~~~~~~~~~l~~~GNtssasi~~~L~~~~~~g~~~~Gd~vll~~fG~G~t~~~~  345 (350)
T 4ewp_A          266 PEDLAAFIPHQANMRIIDEFAKQLKLPESVVVARDIADAGNTSAASIPLAMHRLLEENPELSGGLALQIGFGAGLVYGAQ  345 (350)
T ss_dssp             GGGEEEEEECCSCHHHHHHHHHHTTCCTTSEECCTHHHHCBCGGGHHHHHHHHHHHHCGGGTTSEEEEEEEETTTEEEEE
T ss_pred             hhHhceEEecCCCHHHHHHHHHHcCcChHhEEecccccccchHHHHHHHHHHHHHHhCCCCCcCEEEEEEEchhhEeEEE
Confidence                                       344   47899999999999999999999999999999999999999999999


Q ss_pred             eeeee
Q 043382          292 VWPVL  296 (329)
Q Consensus       292 v~r~~  296 (329)
                      +|||.
T Consensus       346 vlr~P  350 (350)
T 4ewp_A          346 VVRLP  350 (350)
T ss_dssp             EEECC
T ss_pred             EEEeC
Confidence            99983

PyMOL of 4ewp

>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A	Back alignment and structure

>3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A*	Back alignment and structure

>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae}	Back alignment and structure

>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans}	Back alignment and structure

>3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa}	Back alignment and structure

>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans}	Back alignment and structure

>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A	Back alignment and structure

>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A*	Back alignment and structure

>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris}	Back alignment and structure

>3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A	Back alignment and structure

>3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A	Back alignment and structure

>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B*	Back alignment and structure

>3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor}	Back alignment and structure

>3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A	Back alignment and structure

>1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A	Back alignment and structure

>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2	Back alignment and structure

>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa}	Back alignment and structure

>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A	Back alignment and structure

>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2	Back alignment and structure

>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A*	Back alignment and structure

>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum}	Back alignment and structure

>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana}	Back alignment and structure

>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2	Back alignment and structure

>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A	Back alignment and structure

>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A	Back alignment and structure

>1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A*	Back alignment and structure

>3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A*	Back alignment and structure

>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus}	Back alignment and structure

>2wya_A Hydroxymethylglutaryl-COA synthase, mitochondrial; steroid biosynthesis, cholesterol biosynthesis, mitochondrion, phosphoprotein; HET: HMG; 1.70A {Homo sapiens}	Back alignment and structure

>2p8u_A Hydroxymethylglutaryl-COA synthase, cytoplasmic; hydromethylglutaryl COA, mevalonate pathway, structural GENO structural genomics consortium, SGC; HET: COA; 2.00A {Homo sapiens}	Back alignment and structure

>2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A*	Back alignment and structure

>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A	Back alignment and structure

>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile}	Back alignment and structure

>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile}	Back alignment and structure

>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis}	Back alignment and structure

>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium}	Back alignment and structure

>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1	Back alignment and structure

>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium}	Back alignment and structure

>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens}	Back alignment and structure

>1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A	Back alignment and structure

>2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A	Back alignment and structure

>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1	Back alignment and structure

>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A*	Back alignment and structure

>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A	Back alignment and structure

>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ...	Back alignment and structure

>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C*	Back alignment and structure

>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes}	Back alignment and structure

>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus}	Back alignment and structure

>4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A*	Back alignment and structure

>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A	Back alignment and structure

>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1	Back alignment and structure

>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1	Back alignment and structure

>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A	Back alignment and structure

>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A	Back alignment and structure

>2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A	Back alignment and structure

>2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A	Back alignment and structure

>2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A*	Back alignment and structure

>4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum}	Back alignment and structure

>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea}	Back alignment and structure

>1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1	Back alignment and structure

>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A	Back alignment and structure

>2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ...	Back alignment and structure

>2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A*	Back alignment and structure

>4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis}	Back alignment and structure

>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea}	Back alignment and structure

>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A*	Back alignment and structure

>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa}	Back alignment and structure

>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae}	Back alignment and structure

>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans}	Back alignment and structure

>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A	Back alignment and structure

>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2	Back alignment and structure

>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A*	Back alignment and structure

>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A	Back alignment and structure

>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A	Back alignment and structure

>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665}	Back alignment and structure

>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ...	Back alignment and structure

>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A	Back alignment and structure

>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus}	Back alignment and structure

>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1	Back alignment and structure

>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A	Back alignment and structure

>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A*	Back alignment and structure

>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B*	Back alignment and structure

>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A	Back alignment and structure

>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2	Back alignment and structure

>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A	Back alignment and structure

>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium}	Back alignment and structure

>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans}	Back alignment and structure

>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile}	Back alignment and structure

>4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		329
d1teda_		372	c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacte	5e-10
d1ub7a2		149	c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (Fa	1e-09
d1ee0a2		160	c.95.1.2 (A:236-395) Pyrone synthase (PyS, chalcon	9e-09
d1u0ma2		148	c.95.1.2 (A:202-349) Putative polyketide synthase	1e-08
d1u0ua2		156	c.95.1.2 (A:238-393) Dihydropinosylvin synthase {S	2e-08
d1u6ea2		148	c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (Fa	6e-08
d1bi5a2		154	c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (M	6e-08
d1hnja2		143	c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (Fa	1e-07
d1mzja2		153	c.95.1.2 (A:184-336) Priming beta-ketosynthase fro	1e-06

>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 372	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Chalcone synthase-like
domain: Polyketide synthase PKS18
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score = 57.5 bits (138), Expect = 5e-10
 Identities = 11/60 (18%), Positives = 20/60 (33%), Gaps = 1/60 (1%)

Query: 239 KQYPSRVTLYRFRNTSSSLVWYELAYAEAKRRIPKG-DRICQIGFGAGFNCNTVVWPVLK 297
               S   L RF N  S  + + L     +    K         FG G     +++ +++
Sbjct: 312 LAAQSWDVLARFGNMLSVSLIFVLETMVQQAESAKAISTGVAFAFGPGVTVEGMLFDIIR 371

PyMOL of d1teda_

>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Length = 149	Back information, alignment and structure

>d1ee0a2 c.95.1.2 (A:236-395) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrid cultivar [TaxId: 18101]} Length = 160	Back information, alignment and structure

>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Length = 148	Back information, alignment and structure

>d1u0ua2 c.95.1.2 (A:238-393) Dihydropinosylvin synthase {Scots pine (Pinus sylvestris) [TaxId: 3349]} Length = 156	Back information, alignment and structure

>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 148	Back information, alignment and structure

>d1bi5a2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 154	Back information, alignment and structure

>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Length = 143	Back information, alignment and structure

>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Length = 153	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		329
d1teda_		372	Polyketide synthase PKS18 {Mycobacterium tuberculo	100.0
d1u0ma1		200	Putative polyketide synthase SCO1206 {Streptomyces	99.87
d1hnja1		174	Ketoacyl-ACP synthase III (FabH) {Escherichia coli	99.85
d1ub7a1		172	Ketoacyl-ACP synthase III (FabH) {Thermus thermoph	99.83
d1u6ea1		184	Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu	99.82
d1mzja1		181	Priming beta-ketosynthase from the r1128 polyketid	99.82
d1bi5a1		235	Chalcone synthase {Alfalfa (Medicago sativa) [TaxI	99.79
d1xpma1		166	3-hydroxy-3-methylglutaryl CoA synthase MvaS {Stap	99.72
d1ub7a2		149	Ketoacyl-ACP synthase III (FabH) {Thermus thermoph	99.7
d1hnja2		143	Ketoacyl-ACP synthase III (FabH) {Escherichia coli	99.66
d1mzja2		153	Priming beta-ketosynthase from the r1128 polyketid	99.66
d1u6ea2		148	Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu	99.61
d1u0ma2		148	Putative polyketide synthase SCO1206 {Streptomyces	99.52
d1ee0a2		160	Pyrone synthase (PyS, chalcone synthase 2) {Gerber	99.42
d1u0ua2		156	Dihydropinosylvin synthase {Scots pine (Pinus sylv	99.42
d1bi5a2		154	Chalcone synthase {Alfalfa (Medicago sativa) [TaxI	99.39
d1ulqa1		273	Beta-ketoadipyl CoA thiolase {Thermus thermophilus	98.09
d1m3ka1		268	Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3	97.95
d1wdkc1		262	Fatty oxidation complex beta subunit (3-ketoacyl-C	97.67
d1xpma2		221	3-hydroxy-3-methylglutaryl CoA synthase MvaS {Stap	97.49
d1afwa1		269	Thiolase {Baker's yeast (Saccharomyces cerevisiae)	97.09
d1j3na1		249	Beta-ketoacyl-ACP synthase II {Thermus thermophilu	95.36
d1ub7a2		149	Ketoacyl-ACP synthase III (FabH) {Thermus thermoph	95.09
d1u6ea2		148	Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu	94.94
d2gfva1		250	Beta-ketoacyl-ACP synthase II {Escherichia coli [T	94.2
d1tqya1		216	Actinorhodin polyketide putative beta-ketoacyl syn	93.57
d1mzja2		153	Priming beta-ketosynthase from the r1128 polyketid	93.13
d1ox0a1		256	Beta-ketoacyl-ACP synthase II {Streptococcus pneum	92.94
d1hnja2		143	Ketoacyl-ACP synthase III (FabH) {Escherichia coli	92.82
d1tqyb1		208	Actinorhodin polyketide putative beta-ketoacyl syn	92.19
d1e5ma1		250	Beta-ketoacyl-ACP synthase II {Synechocystis sp. [	88.47
d1ulqa2		125	Beta-ketoadipyl CoA thiolase {Thermus thermophilus	86.83
d1m3ka2		124	Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3	84.4

>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Chalcone synthase-like
domain: Polyketide synthase PKS18
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=4.8e-35  Score=281.84  Aligned_cols=237  Identities=17%  Similarity=0.250  Sum_probs=177.1

Q ss_pred             HHHHHHHHHcCCCceEeccCCCCC-------CC-CCchhHHHHHhhchHHHHHHHHHHHHhcCCCCCCcCEEEEeccCCC
Q 043382           61 TVLLKLLERSRIGNMTYGPKSLMD-------NP-AENRHMKEAKKETDDVIIGAIDERLAKTGFKHKDIGILVVNSSLFN  132 (329)
Q Consensus        61 ~~~~~I~~~sGI~~R~~~~~~~~~-------~p-e~~~~ma~~~~ea~~l~~~Aa~~aL~kagv~p~dId~LVv~ss~~~  132 (329)
                      +.+.||.+++||++||++.+....       .| .....++.+.|++.+|+.+|+++||+++|++|+|||+||++|++++
T Consensus        46 ~~~~ri~~~tGI~~R~~~~~~~~~~~~~~~~~~~~~~~r~~~~~e~~~~la~~Aa~~aL~~ag~~~~dId~lI~~t~t~~  125 (372)
T d1teda_          46 ERIPRVYQKSRITTRRMAVDPLDAKFDVFRREPATIRDRMHLFYEHAVPLAVDVSKRALAGLPYRAAEIGLLVLATSTGF  125 (372)
T ss_dssp             THHHHHHHTSCCSEEECSSCTTSTTHHHHTTCSSCHHHHHHHHHHHHHHHHHHHHHHHHTTCCCCGGGEEEEEEEESSCC
T ss_pred             HHHHHHHHccCCcccceeccccccchhhhhhcCCCHHHHHHHHHhHHHHHHHHHHHHHHHHcCCCHHHCCEEEEeccCCC
Confidence            446889999999999998543210       11 0112355667889999999999999999999999999999998999


Q ss_pred             CCCchHHHHHHHcCCCCCcceecccch-------------HHHhcCCCCeEEEEeecCCCCC-------------ccccC
Q 043382          133 PTPSLSAFIVNHYKLRSNILSYNLGAL-------------QSAQVQPNSYTLVVSTENITLG-------------LYTGN  186 (329)
Q Consensus       133 ~~Ps~aa~I~~~Lglr~~v~~~dl~g~-------------~lL~a~~~~~aLVVs~E~~S~~-------------~~~Gd  186 (329)
                      ..|+++++|+++||+++++..++++++             +++++++.++||||++|.+|..             ++|||
T Consensus       126 ~~P~~a~~v~~~LGl~~~~~~~~~~~~gC~g~~~aL~~A~~~l~sg~~~~~LVV~~E~~s~~~~~~d~~~~~~~~~lfGD  205 (372)
T d1teda_         126 IAPGVDVAIVKELGLSPSISRVVVNFMGCAAAMNALGTATNYVRAHPAMKALVVCIELCSVNAVFADDINDVVIHSLFGD  205 (372)
T ss_dssp             CSSCHHHHHHHHHTCCTTCEEEEEESCGGGHHHHHHHHHHHHHHHSTTCEEEEEEEEECGGGCCCCSSHHHHHHHHHBCE
T ss_pred             CCchHHHHHHhhhccCCceeEeeccccCccHHHHHHHHHHHHHhcCCCccceeeeehhhcccccCCCcchhhhhhhhhcc
Confidence            999999999999999988888988643             8999999999999999988732             27999


Q ss_pred             CCccc-cccccc--ccc-c-----ceeecccC-----------CC------CCcc-------cc-----------cc-cc
Q 043382          187 DRSIL-RTTAYF--VVA-G-----EALKTHIT-----------AL------GPLV-------LP-----------VS-EQ  221 (329)
Q Consensus       187 ~~sal-l~~~~~--~~~-g-----~aL~~di~-----------~~------Gp~v-------lP-----------~s-e~  221 (329)
                      +++++ |++...  ... +     ..+...++           ..      ++.+       .+           ++ ++
T Consensus       206 GAaA~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~L~~~gl~~~d  285 (372)
T d1teda_         206 GCAALVIGASQVQEKLEPGKVVVRSSFSQLLDNTEDGIVLGVNHNGITCELSENLPGYIFSGVAPVVTEMLWDNGLQISD  285 (372)
T ss_dssp             EEEEEEEEEECTTSCCCTTCEEEEEEEEEECTTCTTSEEEEEETTEEEEEECTTHHHHHHHHHHHHHHHHHHHTTCCGGG
T ss_pred             cceeEEeccCCcccccCCceeEEecccccccCCCccccccCCCCCcceeechHHHHHHHHHHHHHHHHHHHHhcCCCHHH
Confidence            99988 654320  000 0     00000000           00      0000       00           00 01


Q ss_pred             c-eeeEeechHHHHHHHHhcc---Ccc-----ccccccCCCCcCcHHHHHHHHHHhCCCCCC-CEEEEEeechhhhhhhe
Q 043382          222 L-LFIATSVGRKIFKMKIKQY---PSR-----VTLYRFRNTSSSLVWYELAYAEAKRRIPKG-DRICQIGFGAGFNCNTV  291 (329)
Q Consensus       222 ~-~~~~~~~grkv~~~~v~~~---~sr-----~tl~~~GNtsSaSi~~~La~~~~kgrlk~G-DrV~~iafGsGf~~~sa  291 (329)
                      . .+++|+.++++++...+.+   ++|     .++.+||||||+|+|+.|++++++|++++| |+++++|||+||+|+++
T Consensus       286 id~~i~Hq~~~~i~~~i~~~Lgl~~ek~~~s~~~l~~~GN~~sasip~~L~~~l~~g~~~~g~d~vll~~fG~G~s~~~~  365 (372)
T d1teda_         286 IDLWAIHPGGPKIIEQSVRSLGISAELAAQSWDVLARFGNMLSVSLIFVLETMVQQAESAKAISTGVAFAFGPGVTVEGM  365 (372)
T ss_dssp             CSCEEECCSCHHHHHHHHHHHTCCGGGGHHHHHHHHHHCBCTHHHHHHHHHHHHHSCSSSSSSEEEEEEEEETTTEEEEE
T ss_pred             hhhhhccCccHHHHHHHHHHcCCCHHHhhhhHHHHhccCCcHHHHHHHHHHHHHHhCCCCCCCCEEEEEEEcHHHhHHHH
Confidence            1 2456788888877766665   333     458899999999999999999999998776 89999999999999999


Q ss_pred             eeeeec
Q 043382          292 VWPVLK  297 (329)
Q Consensus       292 v~r~~~  297 (329)
                      +||+++
T Consensus       366 ll~~~~  371 (372)
T d1teda_         366 LFDIIR  371 (372)
T ss_dssp             EEEECC
T ss_pred             hheeec
Confidence            999976

PyMOL of d1teda_

>d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1hnja1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1mzja1 c.95.1.2 (A:3-183) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]}	Back information, alignment and structure

>d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d1xpma1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]}	Back information, alignment and structure

>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1ee0a2 c.95.1.2 (A:236-395) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrid cultivar [TaxId: 18101]}	Back information, alignment and structure

>d1u0ua2 c.95.1.2 (A:238-393) Dihydropinosylvin synthase {Scots pine (Pinus sylvestris) [TaxId: 3349]}	Back information, alignment and structure

>d1bi5a2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}	Back information, alignment and structure

>d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]}	Back information, alignment and structure

>d1xpma2 c.95.1.2 (A:168-388) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tqya1 c.95.1.1 (A:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]}	Back information, alignment and structure

>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]}	Back information, alignment and structure

>d1ulqa2 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}	Back information, alignment and structure