Citrus Sinensis ID: 043447

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60-----
NRRRRSSYGSPRRSALKKAVTRVELWLGRMIGSQPLIFDHAAQFFMPNDSRFRKLVDCWLERGLV
ccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEccccccccccHHHHHHHHHHHHcccc
cccccccccccHHHHHHHHHHHHHHHHHHcccccccEEccHHHHcccccHHHHHHHHHHHHcccc
nrrrrssygsprrSALKKAVTRVELWLGrmigsqplifdhaaqffmpndsrFRKLVDCWLERGLV
nrrrrssygsprrsalkKAVTRVELWLGRMIGSQPLIFDHAAQFFMPNDSRFRKLVDCWLERGLV
NrrrrssygsprrsALKKAVTRVELWLGRMIGSQPLIFDHAAQFFMPNDSRFRKLVDCWLERGLV
*****************KAVTRVELWLGRMIGSQPLIFDHAAQFFMPNDSRFRKLVDCWLE****
*******************VTR*ELWLGRMIGSQPLIFDHAAQFFMPNDSRFRKLVDCWLERGLV
******************AVTRVELWLGRMIGSQPLIFDHAAQFFMPNDSRFRKLVDCWLERGLV
*********SPRRSALKKAVTRVELWLGRMIGSQPLIFDHAAQFFMPNDSRFRKLVDCWLERGL*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NRRRRSSYGSPRRSALKKAVTRVELWLGRMIGSQPLIFDHAAQFFMPNDSRFRKLVDCWLERGLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query65
224130614 496 predicted protein [Populus trichocarpa] 0.569 0.074 0.702 3e-07
18396966 486 FAD/NAD(P)-binding oxidoreductase domain 0.569 0.076 0.729 4e-07
297828968 485 oxidoreductase [Arabidopsis lyrata subsp 0.569 0.076 0.729 4e-07
255580905 467 conserved hypothetical protein [Ricinus 0.969 0.134 0.324 9e-07
225463946 467 PREDICTED: uncharacterized protein LOC10 0.569 0.079 0.702 1e-06
296087896 518 unnamed protein product [Vitis vinifera] 0.569 0.071 0.702 1e-06
147823105 463 hypothetical protein VITISV_000600 [Viti 0.569 0.079 0.702 2e-06
242086110 507 hypothetical protein SORBIDRAFT_08g02023 0.861 0.110 0.420 2e-05
449483109 536 PREDICTED: uncharacterized protein LOC10 0.969 0.117 0.315 6e-05
449443231 545 PREDICTED: uncharacterized protein LOC10 0.969 0.115 0.315 8e-05
>gi|224130614|ref|XP_002328333.1| predicted protein [Populus trichocarpa] gi|222838048|gb|EEE76413.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%)

Query: 29  RMIGSQPLIFDHAAQFFMPNDSRFRKLVDCWLERGLV 65
           R+I  QPLIFDHAAQFF  +D RF +LVD WLE+GLV
Sbjct: 140 RVIDPQPLIFDHAAQFFTVSDPRFSELVDDWLEKGLV 176

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|18396966|ref|NP_566235.1| FAD/NAD(P)-binding oxidoreductase domain-containing protein [Arabidopsis thaliana] gi|6175169|gb|AAF04895.1|AC011437_10 unknown protein [Arabidopsis thaliana] gi|15215628|gb|AAK91359.1| AT3g04650/F7O18_13 [Arabidopsis thaliana] gi|28416461|gb|AAO42761.1| At3g04650/F7O18_13 [Arabidopsis thaliana] gi|332640593|gb|AEE74114.1| FAD/NAD(P)-binding oxidoreductase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297828968|ref|XP_002882366.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297328206|gb|EFH58625.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255580905|ref|XP_002531271.1| conserved hypothetical protein [Ricinus communis] gi|223529104|gb|EEF31084.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|225463946|ref|XP_002268010.1| PREDICTED: uncharacterized protein LOC100241002 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087896|emb|CBI35179.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147823105|emb|CAN66332.1| hypothetical protein VITISV_000600 [Vitis vinifera] Back     alignment and taxonomy information
>gi|242086110|ref|XP_002443480.1| hypothetical protein SORBIDRAFT_08g020230 [Sorghum bicolor] gi|241944173|gb|EES17318.1| hypothetical protein SORBIDRAFT_08g020230 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|449483109|ref|XP_004156495.1| PREDICTED: uncharacterized protein LOC101226129 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449443231|ref|XP_004139383.1| PREDICTED: uncharacterized protein LOC101219713 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query65
TAIR|locus:2084903 486 AT3G04650 [Arabidopsis thalian 0.6 0.080 0.725 5.4e-08
TAIR|locus:2084903 AT3G04650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 133 (51.9 bits), Expect = 5.4e-08, P = 5.4e-08
 Identities = 29/40 (72%), Positives = 32/40 (80%)

Query:    27 LG-RMIGSQPLIFDHAAQFFMPNDSRFRKLVDCWLERGLV 65
             LG R+I  Q LIFDHAAQFF  +DSRF KLVD WLE+GLV
Sbjct:   132 LGTRIIEPQGLIFDHAAQFFTADDSRFIKLVDGWLEKGLV 171


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.330   0.142   0.465    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       65        52   0.00091  102 3  11 22  0.35    27
                                                     29  0.47    26


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  518 (55 KB)
  Total size of DFA:  90 KB (2066 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  5.41u 0.14s 5.55t   Elapsed:  00:00:00
  Total cpu time:  5.41u 0.14s 5.55t   Elapsed:  00:00:00
  Start:  Fri May 10 03:44:54 2013   End:  Fri May 10 03:44:54 2013
GO:0005739 "mitochondrion" evidence=ISM
GO:0009507 "chloroplast" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query65
COG3380 331 COG3380, COG3380, Predicted NAD/FAD-dependent oxid 4e-05
>gnl|CDD|225915 COG3380, COG3380, Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information 
 Score = 38.6 bits (90), Expect = 4e-05
 Identities = 13/28 (46%), Positives = 17/28 (60%)

Query: 38 FDHAAQFFMPNDSRFRKLVDCWLERGLV 65
          FDH AQ+F P D  F + V+   + GLV
Sbjct: 50 FDHGAQYFKPRDELFLRAVEALRDDGLV 77

Length = 331

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 65
COG3380 331 Predicted NAD/FAD-dependent oxidoreductase [Genera 99.61
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.46
PF01593 450 Amino_oxidase: Flavin containing amine oxidoreduct 98.27
PRK11883 451 protoporphyrinogen oxidase; Reviewed 97.84
PLN02268 435 probable polyamine oxidase 97.82
TIGR00562 462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.77
PLN02576 496 protoporphyrinogen oxidase 97.7
PRK07208 479 hypothetical protein; Provisional 97.68
TIGR03467 419 HpnE squalene-associated FAD-dependent desaturase. 97.64
TIGR02731 453 phytoene_desat phytoene desaturase. Plants and cya 97.51
PRK12416 463 protoporphyrinogen oxidase; Provisional 97.39
PRK07233 434 hypothetical protein; Provisional 97.35
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 97.31
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.25
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 97.18
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 96.94
PLN02612 567 phytoene desaturase 96.85
PLN02568 539 polyamine oxidase 96.78
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 96.68
PLN02676 487 polyamine oxidase 96.4
PLN02487 569 zeta-carotene desaturase 96.0
PLN02529 738 lysine-specific histone demethylase 1 95.84
COG1231 450 Monoamine oxidase [Amino acid transport and metabo 95.76
PLN02328 808 lysine-specific histone demethylase 1 homolog 95.68
COG1232 444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 95.36
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 94.88
PLN03000 881 amine oxidase 94.42
COG3349 485 Uncharacterized conserved protein [Function unknow 94.11
KOG0685 498 consensus Flavin-containing amine oxidase [Coenzym 92.65
TIGR00031 377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 91.96
PLN02976 1713 amine oxidase 89.94
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 87.86
PRK12779 944 putative bifunctional glutamate synthase subunit b 87.67
PRK13977 576 myosin-cross-reactive antigen; Provisional 81.86
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 80.03
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information 
Probab=99.61  E-value=5.5e-16  Score=115.73  Aligned_cols=58  Identities=34%  Similarity=0.537  Sum_probs=54.2

Q ss_pred             CCchHHHHHhhcCceeEEe-----e-eccc--CCCCcccccccceeeecChhHHHHHHHHHHCCCC
Q 043447            8 YGSPRRSALKKAVTRVELW-----L-GRMI--GSQPLIFDHAAQFFMPNDSRFRKLVDCWLERGLV   65 (65)
Q Consensus         8 ~~~~~A~~L~~~g~~v~vf-----~-GRma--~~~~~~fDHGAQYFTar~~~F~~~v~~w~~~G~v   65 (65)
                      -|+++|+.|+++|..||||     + |||+  .-++..||||||||+++++.|.++|+.|.++|+|
T Consensus        12 AGl~aA~~L~~aG~~vtV~eKg~GvGGRlAtRRl~~g~~DhGAqYfk~~~~~F~~~Ve~~~~~glV   77 (331)
T COG3380          12 AGLAAAYALREAGREVTVFEKGRGVGGRLATRRLDGGRFDHGAQYFKPRDELFLRAVEALRDDGLV   77 (331)
T ss_pred             HHHHHHHHHHhcCcEEEEEEcCCCcccchheeccCCccccccceeecCCchHHHHHHHHHHhCCce
Confidence            4899999999999999999     7 8999  5667779999999999999999999999999986

>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query65
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 98.95
3qj4_A 342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.47
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 98.03
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 97.89
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.85
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 97.72
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 97.55
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.53
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.42
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.42
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.41
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.36
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.15
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 97.11
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 97.02
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 97.01
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 97.0
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 96.84
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 96.75
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 96.6
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 96.59
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 96.54
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 96.48
2e1m_A 376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 96.36
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 96.1
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 95.93
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 95.41
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 94.76
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 93.63
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 93.43
1d5t_A 433 Guanine nucleotide dissociation inhibitor; ultra-h 93.39
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 92.23
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 86.99
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 85.68
4hb9_A 412 Similarities with probable monooxygenase; flavin, 83.66
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
Probab=98.95  E-value=4.7e-10  Score=67.27  Aligned_cols=55  Identities=36%  Similarity=0.549  Sum_probs=48.8

Q ss_pred             CchHHHHHhhcCceeEEe-----e-eccc--CCCCcccccccceeeecChhHHHHHHHHHHCC
Q 043447            9 GSPRRSALKKAVTRVELW-----L-GRMI--GSQPLIFDHAAQFFMPNDSRFRKLVDCWLERG   63 (65)
Q Consensus         9 ~~~~A~~L~~~g~~v~vf-----~-GRma--~~~~~~fDHGAQYFTar~~~F~~~v~~w~~~G   63 (65)
                      |+++|..|.++|++|+||     + ||+.  ...+..+|||+|||++++++|...+..|...+
T Consensus        14 GL~aA~~La~~G~~V~v~Ek~~~~GG~~~~~~~~~~~~d~g~~~~~~~~~~~~~~~~~~~~~~   76 (336)
T 3kkj_A           14 GLSAAQALTAAGHQVHLFDKSRGSGGRMSSKRSDAGALDMGAQYFTARDRRFATAVKQWQAQG   76 (336)
T ss_dssp             HHHHHHHHHHTTCCEEEECSSSSSCGGGCEEEETTEEEECSCCCBCCCSHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCcccccccCCceeecCccccccCcHHHHHHHHHHHhcc
Confidence            789999999999999999     6 8887  45566799999999999999999999887654
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query65
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.73
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 98.7
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.55
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.47
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.45
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.44
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.27
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.99
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 96.07
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 95.32
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 92.77
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 91.25
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 90.0
d1cjca2 230 Adrenodoxin reductase of mitochondrial p450 system 88.71
d1gtea4 196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 88.42
d1lqta2 239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 87.19
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 84.45
d1djqa3 233 Trimethylamine dehydrogenase, middle domain {Methy 83.62
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Protoporphyrinogen oxidase
species: Tobacco (Nicotiana tabacum) [TaxId: 4097]

Probab=98.73  E-value=2.2e-09  Score=64.77  Aligned_cols=51  Identities=22%  Similarity=0.318  Sum_probs=45.6

Q ss_pred             CchHHHHHhhcCceeEEe-----e-eccc--CCCCcccccccceeeecChhHHHHHHHH
Q 043447            9 GSPRRSALKKAVTRVELW-----L-GRMI--GSQPLIFDHAAQFFMPNDSRFRKLVDCW   59 (65)
Q Consensus         9 ~~~~A~~L~~~g~~v~vf-----~-GRma--~~~~~~fDHGAQYFTar~~~F~~~v~~w   59 (65)
                      |+++|..|+++|++|+||     + ||+.  ..++..+|+|+++|+..++.+..+++++
T Consensus        13 GL~aA~~La~~G~~V~vlE~~~~~GG~~~t~~~~g~~~d~G~~~~~~~~~~~~~~~~~~   71 (373)
T d1seza1          13 GLAAAYKLKIHGLNVTVFEAEGKAGGKLRSVSQDGLIWDEGANTMTESEGDVTFLIDSL   71 (373)
T ss_dssp             HHHHHHHHHTTSCEEEEECSSSSSCSSCCEEEETTEEEESSCCCBCCCSHHHHHHHHHT
T ss_pred             HHHHHHHHHhCCCCEEEEeCCCCCcCceEEeccCCEEEecCceEEeCCCHHHHHHHHHh
Confidence            789999999999999999     7 8987  4556789999999999999999988764
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure