Citrus Sinensis ID: 043587


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----
MSSLLLSYNDLPSKLKRCYLSAEEDEEMETIGEEYFGILAPRSFFQEFEKSYDNRIIKCKMHDMVHDFAQFVSENECLSLEINGSEELDVTNSLDEKVRHLMLIIGEGAIFPVSTRRIKRMRSLLIDGGRSDHSSLNGEILEELFRELTSLRALDFCESYHSRSSLTPEIPRNIEKLVHLRYLSLSFQHIEKLPETLCELYNLETLDISGCFDLEELPKGIGKLVNMKHLLNSRTSSVRYMPVGIGRLTGLRTLGEFTKACRLESLKNLEHLQICGIRRLGYVSD
cccEEccccccccccccccccccccccHHHHHHHHHHHHHHccccccEEccccccccEEEEcHHHHHHHHHHHHHcEEEEEEcccccccccccccccEEEEEEEEccccccccccccccccEEEEEcccccccccccHHHHHHHHccccEEEEEEcccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccEEEcHccccHHHHHHHHEEcccccHHHHHHHHHHHHHHHHcccccccccccccEEEEHHHHHHHHHHHHccccEEEEEccccccccccccccccEEEEEEEEccccccHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHccEEEEEcccccccccccHHHccccHHHHHHEEEEEcccccHHcccHHHHHHHHHHHEEHcccHHHHHccHHHHHcccccEEEccccccHHcccccccccHHHcccccEEccccHHHHHHHHHHccEEEcccccccc
msslllsyndlpsklkrcylsaeedEEMETIGEEyfgilaprsFFQEFEKSYDNRIIKCKMHDMVHDFAQFVseneclsleingseeldvtnsLDEKVRHLMLIIGEGAIFPVSTRRIKRMRSLLidggrsdhsslnGEILEELFRELTSLRALDfcesyhsrssltpeiprNIEKLVHLRYLSLSFQHIEKLPETLCELynletldisgcfdleelpkGIGKLVNMKHllnsrtssvrympvgigrltglrtlgEFTKACRLESLKNLEHLQICGirrlgyvsd
msslllsyndlpsklkRCYLSAEEDEEMETIGEEYFGILAPRSFFQEFEKSYDNRIIKCKMHDMVHDFAQFVSENECLSLEINGSEELDVTNSLDEKVRHLMLiigegaifpvstrRIKRMRSllidggrsdhsslnGEILEELFRELTSLRALDFCESyhsrssltpeiprNIEKLVHLRYLSLSFQHIEKLPETLCELYNLETLDISGCFDLEELPKGIGKLVNMKHLLnsrtssvrympVGIGRLTGLRTLGEFTKACRLEslknlehlqicgirrlgyvsd
MSSLLLSYNDLPSKLKRCYLSAeedeemetigeeYFGILAPRSFFQEFEKSYDNRIIKCKMHDMVHDFAQFVSENECLSLEINGSEELDVTNSLDEKVRHLMLIIGEGAIFPVSTRRIKRMRSLLIDGGRSDHSSLNGEILEELFRELTSLRALDFCESYHSRSSLTPEIPRNIEKLVHLRYLSLSFQHIEKLPETLCELYNLETLDISGCFDLEELPKGIGKLVNMKHLLNSRTSSVRYMPVGIgrltglrtlgEFTKACRLESLKNLEHLQICGIRRLGYVSD
**************LKRCYLS******METIGEEYFGILAPRSFFQEFEKSYDNRIIKCKMHDMVHDFAQFVSENECLSLEINGSEELDVTNSLDEKVRHLMLIIGEGAIFPVSTRRIKRMRSLLIDGG*****SLNGEILEELFRELTSLRALDFCESYHSRSSLTPEIPRNIEKLVHLRYLSLSFQHIEKLPETLCELYNLETLDISGCFDLEELPKGIGKLVNMKHLLNSRTSSVRYMPVGIGRLTGLRTLGEFTKACRLESLKNLEHLQICGIRRLGYV**
MSSLLLSYNDLPSKLKRCYLSAEEDEEMETIGEEYFGILAPRSFFQEFEKSYDNRIIKCKMHDMVHDFAQFVSENECLSLEINGSEEL*V*NSLDEKVRHLMLIIGEGAIFPVSTRRIKRMRSLLIDGGRSDHSSLNGEILEELFRELTSLRALDFCESYHSRSSLTPEIPRNIEKLVHLRYLSLSFQHIEKLPETLCELYNLETLDISGCFDLEELPKGIGKLVNMKHLLNSRTSSVRYMPVGIGRLTGLRTLGEFTKACRLESLKNLEHLQICGIRRLGYVS*
MSSLLLSYNDLPSKLKRCYLSAEEDEEMETIGEEYFGILAPRSFFQEFEKSYDNRIIKCKMHDMVHDFAQFVSENECLSLEINGSEELDVTNSLDEKVRHLMLIIGEGAIFPVSTRRIKRMRSLLIDGGRSDHSSLNGEILEELFRELTSLRALDFCESYHSRSSLTPEIPRNIEKLVHLRYLSLSFQHIEKLPETLCELYNLETLDISGCFDLEELPKGIGKLVNMKHLLNSRTSSVRYMPVGIGRLTGLRTLGEFTKACRLESLKNLEHLQICGIRRLGYVSD
MSSLLLSYNDLPSKLKRCYLSAEEDEEMETIGEEYFGILAPRSFFQEFEKSYDNRIIKCKMHDMVHDFAQFVSENECLSLEINGSEELDVTNSLDEKVRHLMLIIGEGAIFPVSTRRIKRMRSLLIDGGRSDHSSLNGEILEELFRELTSLRALDFCESYHSRSSLTPEIPRNIEKLVHLRYLSLSFQHIEKLPETLCELYNLETLDISGCFDLEELPKGIGKLVNMKHLLNSRTSSVRYMPVGIGRLTGLRTLGEFTKACRLESLKNLEHLQICGIRRLGY***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSLLLSYNDLPSKLKRCYLSAEEDEEMETIGEEYFGILAPRSFFQEFEKSYDNRIIKCKMHDMVHDFAQFVSENECLSLEINGSEELDVTNSLDEKVRHLMLIIGEGAIFPVSTRRIKRMRSLLIDGGRSDHSSLNGEILEELFRELTSLRALDFCESYHSRSSLTPEIPRNIEKLVHLRYLSLSFQHIEKLPETLCELYNLETLDISGCFDLEELPKGIGKLVNMKHLLNSRTSSVRYMPVGIGRLTGLRTLGEFTKACRLESLKNLEHLQICGIRRLGYVSD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query285 2.2.26 [Sep-21-2011]
Q9LRR5 1424 Putative disease resistan yes no 0.884 0.176 0.303 1e-21
Q9LRR4 1054 Putative disease resistan no no 0.912 0.246 0.302 1e-20
Q7XA39 988 Putative disease resistan N/A no 0.796 0.229 0.298 2e-20
Q7XBQ9 970 Disease resistance protei N/A no 0.778 0.228 0.290 1e-18
Q7XA40 992 Putative disease resistan N/A no 0.824 0.236 0.304 2e-18
Q38834 852 Disease resistance RPP13- no no 0.894 0.299 0.287 3e-16
Q7XA42 979 Putative disease resistan N/A no 0.824 0.240 0.295 3e-15
Q9STE7 847 Putative disease resistan no no 0.785 0.264 0.276 4e-11
Q39214 926 Disease resistance protei no no 0.750 0.231 0.275 2e-09
Q9LZ25811 Probable disease resistan no no 0.364 0.128 0.345 3e-07
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function desciption
 Score =  103 bits (258), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 93/306 (30%), Positives = 143/306 (46%), Gaps = 54/306 (17%)

Query: 4   LLLSYNDLPSKLKRCYL---------------------------SAEEDEEMETIGEEYF 36
           L LSY+ LP +LKRC+                                   +E IG +Y 
Sbjct: 407 LKLSYDSLPPQLKRCFALCSIFPKGHVFDREELVLLWMAIDLLYQPRSSRRLEDIGNDYL 466

Query: 37  GILAPRSFFQEFEKSYDNRIIKCKMHDMVHDFAQFVSENECLSLEINGSEELDVTNSLDE 96
           G L  +SFFQ  + +  + +    MHD+++D A+ VS + C  LE +   E+  T     
Sbjct: 467 GDLVAQSFFQRLDITMTSFV----MHDLMNDLAKAVSGDFCFRLEDDNIPEIPST----- 517

Query: 97  KVRHLMLIIGEGAIFPVSTRRI---KRMRSLLIDGGRSDHSSLN--GEILEELFRELTSL 151
             RH      +     V+ R I   + +R++L     +   SL    ++L  L   L+ L
Sbjct: 518 -TRHFSFSRSQCDA-SVAFRSICGAEFLRTILPFNSPTSLESLQLTEKVLNPLLNALSGL 575

Query: 152 RALDFCESYHSRSSLTPEIPRNIEKLVHLRYLSLSFQHIEKLPETLCELYNLETLDISGC 211
           R L    S++  ++L    P++++ L  LRYL LS   I++LPE +C L NL+TL +S C
Sbjct: 576 RILSL--SHYQITNL----PKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLLSNC 629

Query: 212 FDLEELPKGIGKLVNMKHLLNSRTSSVRYMPVGIGRLTGLRTLGEFT----KACRLESLK 267
            DL  LPK I +L+N++ LL+   + +  MP GI +L  L+ L  F         L  LK
Sbjct: 630 RDLTSLPKSIAELINLR-LLDLVGTPLVEMPPGIKKLRSLQKLSNFVIGRLSGAGLHELK 688

Query: 268 NLEHLQ 273
            L HL+
Sbjct: 689 ELSHLR 694




Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q9STE7|R13L3_ARATH Putative disease resistance RPP13-like protein 3 OS=Arabidopsis thaliana GN=RPP13L3 PE=3 SV=1 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LZ25|DRL30_ARATH Probable disease resistance protein At5g04720 OS=Arabidopsis thaliana GN=At5g04720 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query285
359482794 880 PREDICTED: putative disease resistance p 0.943 0.305 0.419 9e-57
147825450 927 hypothetical protein VITISV_000086 [Viti 0.954 0.293 0.409 1e-54
224122696 906 cc-nbs-lrr resistance protein [Populus t 0.936 0.294 0.424 3e-52
359482784 919 PREDICTED: putative disease resistance p 0.891 0.276 0.407 9e-52
224114824 941 cc-nbs-lrr resistance protein [Populus t 0.898 0.272 0.406 1e-51
147843549 970 hypothetical protein VITISV_000507 [Viti 0.905 0.265 0.414 5e-51
297743527 613 unnamed protein product [Vitis vinifera] 0.961 0.446 0.394 5e-51
359482769 904 PREDICTED: putative disease resistance p 0.891 0.280 0.394 3e-50
359482788 903 PREDICTED: putative disease resistance p 0.915 0.289 0.401 6e-50
359482790 923 PREDICTED: putative disease resistance p 0.894 0.276 0.390 6e-50
>gi|359482794|ref|XP_002268547.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  226 bits (576), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 132/315 (41%), Positives = 192/315 (60%), Gaps = 46/315 (14%)

Query: 3   SLLLSYNDLPSKLKRC--------------------------YLSAEEDEEMETIGEEYF 36
           +LLLSY DLP  +KRC                          YL+++  +EME +G EYF
Sbjct: 394 ALLLSYYDLPPAIKRCFSFCAVFPKDSVIKIDELIRLWMAQNYLNSDASKEMEMVGREYF 453

Query: 37  GILAPRSFFQEFEKSYDNRIIKCKMHDMVHDFAQFVSENECLSLEINGSEELDVTNSLDE 96
             LA RSFFQ+FEK  D+ II+CKMHD+VHDFAQF+++NEC  + +  +EE     S  +
Sbjct: 454 EYLAARSFFQDFEKDGDDDIIRCKMHDIVHDFAQFLTKNECFIMNVENAEEGRTKTSF-Q 512

Query: 97  KVRHLMLIIGEGAIFPVSTRRIKRMRSLLIDGGRSDHSSLNGEILEELFRELTSLRALDF 156
           K+RH  LI  +     VST ++K + +LL+   +   SS + E L  LF+ LT LRAL+ 
Sbjct: 513 KIRHATLIGQQRYPNFVSTYKMKNLHTLLL---KFTFSSTSDEALPNLFQHLTCLRALNL 569

Query: 157 CESYHSRSSLTPEIPRNIEKLVHLRYLSLSFQH-IEKLPETLCELYNLETLDISGCFDLE 215
                +R+ L  E+P+ + KL+HL+YLSLS  H + +LPET+C+LYNL+TL+IS CF L 
Sbjct: 570 -----ARNPLIMELPKAVGKLIHLKYLSLSDCHKLRELPETICDLYNLQTLNISRCFSLV 624

Query: 216 ELPKGIGKLVNMKHLLNSRTSSVRYMPVGIGRLTGLRTLGEFTKA------CRLESLKNL 269
           ELP+ +GKL+N++HL N     ++ +P GI RL  L+TL EF  +      C++  L+NL
Sbjct: 625 ELPQAMGKLINLRHLQNCGALDLKGLPKGIARLNSLQTLEEFVVSSDGDAECKIGDLRNL 684

Query: 270 EH----LQICGIRRL 280
            +    L+I G+R++
Sbjct: 685 NNLRGELEIRGLRKV 699




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147825450|emb|CAN71072.1| hypothetical protein VITISV_000086 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224122696|ref|XP_002318903.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859576|gb|EEE97123.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482784|ref|XP_002269044.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224114824|ref|XP_002332291.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222832453|gb|EEE70930.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147843549|emb|CAN79463.1| hypothetical protein VITISV_000507 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743527|emb|CBI36394.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482769|ref|XP_003632834.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482788|ref|XP_003632840.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482790|ref|XP_002268671.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query285
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.659 0.178 0.333 5.1e-18
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.775 0.155 0.314 1.2e-16
TAIR|locus:2078012 852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.666 0.223 0.296 9.9e-14
TAIR|locus:504956483 847 AT3G46730 [Arabidopsis thalian 0.778 0.262 0.262 1.6e-08
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.638 0.100 0.261 1.9e-08
TAIR|locus:2077572 926 RPM1 "RESISTANCE TO P. SYRINGA 0.554 0.170 0.302 4.4e-08
ZFIN|ZDB-GENE-030131-6062 601 lrrc40 "leucine rich repeat co 0.414 0.196 0.333 5.7e-07
ZFIN|ZDB-GENE-080917-20 994 mfhas1 "malignant fibrous hist 0.410 0.117 0.356 1.9e-06
ZFIN|ZDB-GENE-050417-279 343 lrrc39 "leucine rich repeat co 0.431 0.358 0.320 4.1e-06
TAIR|locus:2102857 847 AT3G46710 [Arabidopsis thalian 0.589 0.198 0.308 5.8e-06
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 212 (79.7 bits), Expect = 5.1e-18, Sum P(2) = 5.1e-18
 Identities = 71/213 (33%), Positives = 110/213 (51%)

Query:    35 YFGILAPRSFFQEFEKSYDNRIIKCKMHDMVHDFAQFVSENECLSLEINGSEELDVTNSL 94
             YF  L  RS  Q+ +  Y        MHD +++ AQF S       E +G + L V+   
Sbjct:   473 YFSELESRSLLQKTKTRYI-------MHDFINELAQFASGEFSSKFE-DGCK-LQVS--- 520

Query:    95 DEKVRHLMLI---IGEGAIFPVSTRRIKRMRSLL-IDGGRSDHSS-LNGEILEELFRELT 149
              E+ R+L  +     E   F  + R +K +R+ L +    S  S  L+  + E+L   LT
Sbjct:   521 -ERTRYLSYLRDNYAEPMEFE-ALREVKFLRTFLPLSLTNSSRSCCLDQMVSEKLLPTLT 578

Query:   150 SLRALDFCESYHSRSSLTPEIPRNIEKLVHLRYLSLSFQHIEKLPETLCELYNLETLDIS 209
              LR L    S++  + L P+  +NI    H R+L LS   +EKLP++LC +YNL+TL +S
Sbjct:   579 RLRVLSL--SHYKIARLPPDFFKNIS---HARFLDLSRTELEKLPKSLCYMYNLQTLLLS 633

Query:   210 GCFDLEELPKGIGKLVNMKHLLNSRTSSVRYMP 242
              C  L+ELP  I  L+N+++L +   + +R MP
Sbjct:   634 YCSSLKELPTDISNLINLRYL-DLIGTKLRQMP 665


GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6062 lrrc40 "leucine rich repeat containing 40" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080917-20 mfhas1 "malignant fibrous histiocytoma amplified sequence 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-279 lrrc39 "leucine rich repeat containing 39" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2102857 AT3G46710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00003244001
SubName- Full=Chromosome undetermined scaffold_141, whole genome shotgun sequence; (897 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query285
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.002
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.003
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 40.7 bits (95), Expect = 5e-04
 Identities = 38/118 (32%), Positives = 55/118 (46%), Gaps = 3/118 (2%)

Query: 139 EILEELFRELTSLRALDFCESYHSRSSLTPEIPRNIEKLV-HLRYLSLSFQHIEKLPETL 197
             L  L   ++ L  L    S    ++   +IP  I  L  +L+ L LS   IE LP  L
Sbjct: 100 LNLNRLRSNISELLELTNLTSLDLDNNNITDIPPLIGLLKSNLKELDLSDNKIESLPSPL 159

Query: 198 CELYNLETLDISGCFDLEELPKGIGKLVNMKHLLNSRTSSVRYMPVGIGRLTGLRTLG 255
             L NL+ LD+S   DL +LPK +  L N+ +L  S  + +  +P  I  L+ L  L 
Sbjct: 160 RNLPNLKNLDLSFN-DLSDLPKLLSNLSNLNNLDLSG-NKISDLPPEIELLSALEELD 215


Length = 394

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 285
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 99.95
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.74
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.6
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.59
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.57
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.57
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.56
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.5
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.34
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.27
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.23
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.23
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.15
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.15
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.13
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 99.12
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.1
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.08
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.06
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.02
PLN03150623 hypothetical protein; Provisional 99.02
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.0
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.98
PLN03150623 hypothetical protein; Provisional 98.91
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.91
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.84
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.83
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.8
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.78
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.7
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.7
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.56
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.43
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.32
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.31
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.3
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.21
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.16
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.14
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.14
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.11
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.1
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.08
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.06
PRK15386 426 type III secretion protein GogB; Provisional 97.89
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.88
PRK15386 426 type III secretion protein GogB; Provisional 97.87
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.86
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.82
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.6
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.43
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.42
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.35
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.31
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.01
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.81
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.72
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.6
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 96.28
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.1
KOG0473 326 consensus Leucine-rich repeat protein [Function un 95.96
KOG4341483 consensus F-box protein containing LRR [General fu 95.86
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.84
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.44
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.39
KOG1947 482 consensus Leucine rich repeat proteins, some prote 95.07
KOG4341483 consensus F-box protein containing LRR [General fu 94.68
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.52
smart0037026 LRR Leucine-rich repeats, outliers. 93.71
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.71
KOG1947 482 consensus Leucine rich repeat proteins, some prote 92.39
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.94
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.5
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 88.3
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.05
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 85.21
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.95  E-value=6.4e-28  Score=227.76  Aligned_cols=270  Identities=29%  Similarity=0.393  Sum_probs=205.7

Q ss_pred             CCceeccccCCchhhhccc--------------------------ccc-CCCCCHHHHHHHHHHHHhhCCCCccccccCC
Q 043587            1 MSSLLLSYNDLPSKLKRCY--------------------------LSA-EEDEEMETIGEEYFGILAPRSFFQEFEKSYD   53 (285)
Q Consensus         1 ~~~L~lSy~~L~~~lk~cf--------------------------~~~-~~~~~~~~~~~~~~~~Li~~~li~~~~~~~~   53 (285)
                      ++||++||+.||.++|.||                          +.+ .+++++++.|.+|+.+|+++++++..+..  
T Consensus       398 ~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~--  475 (889)
T KOG4658|consen  398 LPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDE--  475 (889)
T ss_pred             HHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccc--
Confidence            4799999999999999999                          333 23678899999999999999999987765  


Q ss_pred             CceeeEecChHHHHHHHHhhc-----cceeEeeeC-CcccccccCCCCCceeEEEEEecCCcccccchhccccccEEeec
Q 043587           54 NRIIKCKMHDMVHDFAQFVSE-----NECLSLEIN-GSEELDVTNSLDEKVRHLMLIIGEGAIFPVSTRRIKRMRSLLID  127 (285)
Q Consensus        54 ~~~~~~~~hd~~~~~~~~~~~-----~~~~~~~~~-~~~~~~~~~~~~~~l~~L~l~~~~~~~~~~~~~~l~~L~~L~l~  127 (285)
                      ++..+|+|||+++++|.+++.     .+......+ +.....-. ..+..+|++++..+.....+... ..++|++|.+.
T Consensus       476 ~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~-~~~~~~rr~s~~~~~~~~~~~~~-~~~~L~tLll~  553 (889)
T KOG4658|consen  476 GRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQV-KSWNSVRRMSLMNNKIEHIAGSS-ENPKLRTLLLQ  553 (889)
T ss_pred             cceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccc-cchhheeEEEEeccchhhccCCC-CCCccceEEEe
Confidence            667799999999999999998     555444433 22211111 45678999999999887655543 44589999999


Q ss_pred             CCCCCCCCchhhHHHHHHhcCCccceeeecccccccccCCCcccccccccCCCceEecccccccccchhhhcCCCccEEe
Q 043587          128 GGRSDHSSLNGEILEELFRELTSLRALDFCESYHSRSSLTPEIPRNIEKLVHLRYLSLSFQHIEKLPETLCELYNLETLD  207 (285)
Q Consensus       128 ~~~~~~~~l~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~~p~~i~~l~~L~~L~l~~~~l~~lp~~i~~l~~L~~L~  207 (285)
                      .+..    ....+....|..++.|++|||+     +|.-.+.+|..|+.+.+||||+++++.++.+|.++++|..|.+|+
T Consensus       554 ~n~~----~l~~is~~ff~~m~~LrVLDLs-----~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Ln  624 (889)
T KOG4658|consen  554 RNSD----WLLEISGEFFRSLPLLRVLDLS-----GNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLN  624 (889)
T ss_pred             ecch----hhhhcCHHHHhhCcceEEEECC-----CCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheec
Confidence            9852    1455567778999999999999     888678899999999999999999999999999999999999999


Q ss_pred             cCCCCCcCcCcccccccCCCceeecCCCCCCc--ccCCCCCCCCcCCcccccc---------------------------
Q 043587          208 ISGCFDLEELPKGIGKLVNMKHLLNSRTSSVR--YMPVGIGRLTGLRTLGEFT---------------------------  258 (285)
Q Consensus       208 l~~~~~~~~lp~~l~~l~~L~~L~l~~~~~~~--~~p~~~~~l~~L~~L~l~~---------------------------  258 (285)
                      +..+......|..+..|.+|++|.+.......  ..-..+..+.+|+.+....                           
T Consensus       625 l~~~~~l~~~~~i~~~L~~Lr~L~l~~s~~~~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~~~~L~~~~~~l~~~~~  704 (889)
T KOG4658|consen  625 LEVTGRLESIPGILLELQSLRVLRLPRSALSNDKLLLKELENLEHLENLSITISSVLLLEDLLGMTRLRSLLQSLSIEGC  704 (889)
T ss_pred             cccccccccccchhhhcccccEEEeeccccccchhhHHhhhcccchhhheeecchhHhHhhhhhhHHHHHHhHhhhhccc
Confidence            99988677776666679999999997653111  1112234444444443332                           


Q ss_pred             -ccCCccccccCCcCCCceecccCCC
Q 043587          259 -KACRLESLKNLEHLQICGIRRLGYV  283 (285)
Q Consensus       259 -~~~~~~~l~~l~~L~~L~i~~~~~~  283 (285)
                       ....+..+..+.+|+.|.|.+|...
T Consensus       705 ~~~~~~~~~~~l~~L~~L~i~~~~~~  730 (889)
T KOG4658|consen  705 SKRTLISSLGSLGNLEELSILDCGIS  730 (889)
T ss_pred             ccceeecccccccCcceEEEEcCCCc
Confidence             1234455677778888888877653



>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query285
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-15
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-04
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 6e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-11
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 7e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-06
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-04
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 4e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 83.5 bits (207), Expect = 1e-18
 Identities = 30/121 (24%), Positives = 50/121 (41%), Gaps = 6/121 (4%)

Query: 134 SSLNGEILEELFRELTSLRALDFCESYHSRSSLTPEIPRNIEKLVHLRYLSLSFQHIEKL 193
             L         + L +L++L         + +   +P +I  L +L+ L +    +  L
Sbjct: 168 EPLASTDASGEHQGLVNLQSLRL-----EWTGIR-SLPASIANLQNLKSLKIRNSPLSAL 221

Query: 194 PETLCELYNLETLDISGCFDLEELPKGIGKLVNMKHLLNSRTSSVRYMPVGIGRLTGLRT 253
              +  L  LE LD+ GC  L   P   G    +K L+    S++  +P+ I RLT L  
Sbjct: 222 GPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEK 281

Query: 254 L 254
           L
Sbjct: 282 L 282


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query285
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.8
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.8
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.79
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.77
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.77
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.76
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.76
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.76
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.76
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.74
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.74
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.74
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.74
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.74
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.73
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.73
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.73
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.73
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.72
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.72
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.72
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.72
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.72
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.72
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.71
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.71
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.71
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.71
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.71
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.7
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.7
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.7
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.7
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.7
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.7
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.7
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.69
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.69
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.69
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.69
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.69
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.69
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.68
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.68
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.68
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.68
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.67
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.67
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.67
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.67
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.67
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.67
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.67
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.66
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.66
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.66
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.66
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 99.65
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.65
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.65
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.64
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.64
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.64
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.64
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.64
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.63
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.62
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.62
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.62
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.62
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.61
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.61
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.6
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.6
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.6
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.59
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.59
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.58
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.57
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.57
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.53
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.53
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.53
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.52
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.51
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.45
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.44
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.44
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.43
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.42
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.41
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.4
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.39
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.37
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.37
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.37
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.32
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.3
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.26
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.25
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.24
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.24
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.21
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.15
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.01
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.01
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.97
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.96
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.95
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.95
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.89
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.65
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.5
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.42
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.39
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 98.36
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.35
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.32
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.32
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.29
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.29
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.13
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.13
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.11
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.9
4fs7_A 394 Uncharacterized protein; leucine-rich repeats, pro 96.77
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.61
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.48
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.33
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.21
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 96.15
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.07
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.65
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 95.63
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.51
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.88  E-value=2e-22  Score=172.96  Aligned_cols=177  Identities=20%  Similarity=0.245  Sum_probs=152.6

Q ss_pred             CCCceeEEEEEecCCcccccchhccccccEEeecCCCCCCCCchhhHHHHHHhcCCccceeeecccccccccCCCccccc
Q 043587           94 LDEKVRHLMLIIGEGAIFPVSTRRIKRMRSLLIDGGRSDHSSLNGEILEELFRELTSLRALDFCESYHSRSSLTPEIPRN  173 (285)
Q Consensus        94 ~~~~l~~L~l~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~l~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~~p~~  173 (285)
                      ...+++.|.+..+.+..++..+..+++|++|++++|.      ...+ |..+..+++|++|+++     +|++.+.+|..
T Consensus       102 ~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n~------l~~l-p~~l~~l~~L~~L~L~-----~n~~~~~~p~~  169 (328)
T 4fcg_A          102 RLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNP------LRAL-PASIASLNRLRELSIR-----ACPELTELPEP  169 (328)
T ss_dssp             GGTTCSEEEEESSCCCCCCSCGGGGTTCSEEEEESCC------CCCC-CGGGGGCTTCCEEEEE-----EETTCCCCCSC
T ss_pred             hCCCCCEEECCCCCccchhHHHhccCCCCEEECCCCc------cccC-cHHHhcCcCCCEEECC-----CCCCccccChh
Confidence            3568999999999988888889999999999999998      3354 5558999999999999     87778888877


Q ss_pred             ccc---------cCCCceEecccccccccchhhhcCCCccEEecCCCCCcCcCcccccccCCCceeecCCCCCCcccCCC
Q 043587          174 IEK---------LVHLRYLSLSFQHIEKLPETLCELYNLETLDISGCFDLEELPKGIGKLVNMKHLLNSRTSSVRYMPVG  244 (285)
Q Consensus       174 i~~---------l~~L~~L~l~~~~l~~lp~~i~~l~~L~~L~l~~~~~~~~lp~~l~~l~~L~~L~l~~~~~~~~~p~~  244 (285)
                      ++.         +++|++|++++|.++.+|..++++++|++|++++|. +..+|..++.+++|++|++++|++.+.+|..
T Consensus       170 ~~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~N~-l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~  248 (328)
T 4fcg_A          170 LASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSP-LSALGPAIHHLPKLEELDLRGCTALRNYPPI  248 (328)
T ss_dssp             SEEEC-CCCEEESTTCCEEEEEEECCCCCCGGGGGCTTCCEEEEESSC-CCCCCGGGGGCTTCCEEECTTCTTCCBCCCC
T ss_pred             HhhccchhhhccCCCCCEEECcCCCcCcchHhhcCCCCCCEEEccCCC-CCcCchhhccCCCCCEEECcCCcchhhhHHH
Confidence            654         899999999999998999889999999999999998 6678888999999999999999888889999


Q ss_pred             CCCCCcCCcccccc---ccCCccccccCCcCCCceecccCCC
Q 043587          245 IGRLTGLRTLGEFT---KACRLESLKNLEHLQICGIRRLGYV  283 (285)
Q Consensus       245 ~~~l~~L~~L~l~~---~~~~~~~l~~l~~L~~L~i~~~~~~  283 (285)
                      ++.+++|++|++++   ....+..+..+++|+.|+++++..+
T Consensus       249 ~~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~  290 (328)
T 4fcg_A          249 FGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNL  290 (328)
T ss_dssp             TTCCCCCCEEECTTCTTCCBCCTTGGGCTTCCEEECTTCTTC
T ss_pred             hcCCCCCCEEECCCCCchhhcchhhhcCCCCCEEeCCCCCch
Confidence            99999999999887   5667777889999999999887654



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 285
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]
 Score = 42.5 bits (98), Expect = 3e-05
 Identities = 22/89 (24%), Positives = 34/89 (38%), Gaps = 15/89 (16%)

Query: 145 FRELTSLRALDFCESYHSRSSLTPEIPRNIEKLVHLRYLSLSFQHIEKLPETLCELYNLE 204
                SL  L+   S +    L    PR       L  L  SF H+ ++PE      NL+
Sbjct: 280 CDLPPSLEELNV--SNNKLIELPALPPR-------LERLIASFNHLAEVPELPQ---NLK 327

Query: 205 TLDISGCFDLEELPKGIGKLVNMKHLLNS 233
            L +     L E P     + +++  +NS
Sbjct: 328 QLHVEYN-PLREFPDIPESVEDLR--MNS 353


>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query285
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.71
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.68
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.67
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.66
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.6
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.53
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.52
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.46
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.46
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.45
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.44
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.42
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.42
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.4
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.37
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.11
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.08
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.03
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.78
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.76
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.67
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.58
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.48
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.34
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.31
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.27
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.64
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.52
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.08
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.04
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.71  E-value=4.2e-17  Score=133.66  Aligned_cols=173  Identities=19%  Similarity=0.147  Sum_probs=140.8

Q ss_pred             CCCCceeEEEEEecCCcccc-cchhccccccEEeecCCCCCCCCchhhHHHHHHhcCCccceeeecccccccccCCCccc
Q 043587           93 SLDEKVRHLMLIIGEGAIFP-VSTRRIKRMRSLLIDGGRSDHSSLNGEILEELFRELTSLRALDFCESYHSRSSLTPEIP  171 (285)
Q Consensus        93 ~~~~~l~~L~l~~~~~~~~~-~~~~~l~~L~~L~l~~~~~~~~~l~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~~p  171 (285)
                      ..+.+++.|.+..+.+..++ ..+.++++|++|++++|.      ...+ +. +..+++|++|+++     +|+ ....+
T Consensus        28 ~lp~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~------l~~l-~~-~~~l~~L~~L~Ls-----~N~-l~~~~   93 (266)
T d1p9ag_          28 DLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAE------LTKL-QV-DGTLPVLGTLDLS-----HNQ-LQSLP   93 (266)
T ss_dssp             CCCTTCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTSC------CCEE-EC-CSCCTTCCEEECC-----SSC-CSSCC
T ss_pred             CcCcCCCEEECcCCcCCCcCHHHhhcccccccccccccc------cccc-cc-ccccccccccccc-----ccc-ccccc
Confidence            46678999999999988755 568899999999999998      4443 32 5789999999999     888 55567


Q ss_pred             ccccccCCCceEecccccccccch-hhhcCCCccEEecCCCCCcCcCcc-cccccCCCceeecCCCCCCcccCCCCCCCC
Q 043587          172 RNIEKLVHLRYLSLSFQHIEKLPE-TLCELYNLETLDISGCFDLEELPK-GIGKLVNMKHLLNSRTSSVRYMPVGIGRLT  249 (285)
Q Consensus       172 ~~i~~l~~L~~L~l~~~~l~~lp~-~i~~l~~L~~L~l~~~~~~~~lp~-~l~~l~~L~~L~l~~~~~~~~~p~~~~~l~  249 (285)
                      ..+..++.|++|+++++.+..++. .+..+.++++|++++|. +..+|. .+..+++|+.+++++|++.+..+..++.++
T Consensus        94 ~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~l~~n~-l~~l~~~~~~~l~~l~~l~l~~N~l~~~~~~~~~~l~  172 (266)
T d1p9ag_          94 LLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNE-LKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLE  172 (266)
T ss_dssp             CCTTTCTTCCEEECCSSCCCCCCSSTTTTCTTCCEEECTTSC-CCCCCTTTTTTCTTCCEEECTTSCCSCCCTTTTTTCT
T ss_pred             cccccccccccccccccccceeeccccccccccccccccccc-cceeccccccccccchhcccccccccccCcccccccc
Confidence            788889999999999999887654 55688899999999998 556554 457788999999999988866667789999


Q ss_pred             cCCcccccc--ccCCccccccCCcCCCceeccc
Q 043587          250 GLRTLGEFT--KACRLESLKNLEHLQICGIRRL  280 (285)
Q Consensus       250 ~L~~L~l~~--~~~~~~~l~~l~~L~~L~i~~~  280 (285)
                      +|++|++++  -...+..+..+++|+.|++.+.
T Consensus       173 ~L~~L~Ls~N~L~~lp~~~~~~~~L~~L~L~~N  205 (266)
T d1p9ag_         173 NLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGN  205 (266)
T ss_dssp             TCCEEECCSSCCCCCCTTTTTTCCCSEEECCSC
T ss_pred             ccceeecccCCCcccChhHCCCCCCCEEEecCC
Confidence            999999988  3456677788888999888764



>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure