Citrus Sinensis ID: 043604

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MRISQQKPIENRECILQQEKVHENPQQEIELEDTNGIFTCEICIEPISANDKFRNKDLCSHHFCQDCIAKYIEAKVQDNNTAKIECPGVHCDQFLDPFSCKLMIPSNLFSKWCDVLFEDYVLGFERSYCPNRNCMALVVNGCEINYGTLKKARCPNCTQWFCFQCKLAWHAGYRCEESGNLRDWNDIAFGKLVERMHWARCPACGSCVERKEGCRVMYCSCHSVTYSRAKHISLRKHSTRGDNKGWRIYKVSGCRSTCRSLENFGVTK
cccccccccccHHHHHHHHHcccccccccccccccccEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHccccHHHHHHHHHHHHHHHHcccccEEcccccccccEEccccccccccccEEccccccccccccccccccccccHHHHcccccHHHHHHHHHHHcccccccccccEEEcccccccEEEccccEEEEccccccccccccccccccccccccccccHHHHHHccccccc
ccEEEEHHcccHHHHHHHcccccccccccccccccccccccEEEcccccccccccHHHcccHHHHHHHHHHHHEEHHcccccEEEcccccccccccHHHHHHHccHHHHHHHHHHHHHHcccccccEccccccccHEEEEEccccccccccEEEEccccEEEEcccccccccccHHHHHHHcccccccHHHHHHHHccccccccccEEEEccccccEEEEcccEEEEEccccccccccccccHHHHHEEEccccHHHHHHHHHccccc
mrisqqkpienrECILQQekvhenpqqeieledtngiftceiciepisandkfrnkdlcshhFCQDCIAKYIEAKvqdnntakiecpgvhcdqfldpfscklmipsnlfskWCDVLFEDYvlgfersycpnrncmaLVVNGceinygtlkkarcpnctqwfCFQCKlawhagyrceesgnlrdwndIAFGKLVERMhwarcpacgscverkegcrvmycschsvtysRAKHISlrkhstrgdnkgwriykvsgcrstcrslenfgvtk
mrisqqkpienrecilqqekvhenpqqeieledtnGIFTCEICIEPISANDKFRNKDLCSHHFCQDCIAKYIEAKVQDNNTAKIECPGVHCDQFLDPFSCKLMIPSNLFSKWCDVLFEDYVLGFERSYCPNRNCMALVVNGCEINYGTLKKARCPNCTQWFCFQCKLAWHAGYRCEESGNLRDWNDIAFGKLVERMHWARCPACGSCVERKEGCRVMYCSCHSVtysrakhislrkhstrgdnkgwriykvsgcrstcrslenfgvtk
MRISQQKPIENRECILQQEKVHENPQQEIELEDTNGIFTCEICIEPISANDKFRNKDLCSHHFCQDCIAKYIEAKVQDNNTAKIECPGVHCDQFLDPFSCKLMIPSNLFSKWCDVLFEDYVLGFERSYCPNRNCMALVVNGCEINYGTLKKARCPNCTQWFCFQCKLAWHAGYRCEESGNLRDWNDIAFGKLVERMHWARCPACGSCVERKEGCRVMYCSCHSVTYSRAKHISLRKHSTRGDNKGWRIYKVSGCRSTCRSLENFGVTK
******************************LEDTNGIFTCEICIEPISANDKFRNKDLCSHHFCQDCIAKYIEAKVQDNNTAKIECPGVHCDQFLDPFSCKLMIPSNLFSKWCDVLFEDYVLGFERSYCPNRNCMALVVNGCEINYGTLKKARCPNCTQWFCFQCKLAWHAGYRCEESGNLRDWNDIAFGKLVERMHWARCPACGSCVERKEGCRVMYCSCHSVTYSRAKHISLRKHSTRGDNKGWRIYKVSGCRSTCRSL*******
***************************************CEICIEPISANDKFRNKDLCSHHFCQDCIAKYIEAKVQDNNTAKIECPGVHCDQFLDPFSCKLMIPSNLFSKWCDVLFEDYVLGFERSYCPNRNCMALVVNGCEINYGTLKKARCPNCTQWFCFQCKLAWHAGYRCEESGNLR******F*KLVERMHWARCPACGSCVERKEGCRVMYCSCHSVTYSRAKHISLRKHSTRGDNKGWRI***************FG***
MRISQQKPIENRECILQQEKVHENPQQEIELEDTNGIFTCEICIEPISANDKFRNKDLCSHHFCQDCIAKYIEAKVQDNNTAKIECPGVHCDQFLDPFSCKLMIPSNLFSKWCDVLFEDYVLGFERSYCPNRNCMALVVNGCEINYGTLKKARCPNCTQWFCFQCKLAWHAGYRCEESGNLRDWNDIAFGKLVERMHWARCPACGSCVERKEGCRVMYCSCHSVTYSRAKHISLRKHSTRGDNKGWRIYKVSGCRSTCRSLENFGVTK
*RISQQKPIENRECILQQEKVHE************GIFTCEICIEPISANDKFRNKDLCSHHFCQDCIAKYIEAKVQDNNTAKIECPGVHCDQFLDPFSCKLMIPSNLFSKWCDVLFEDYVLGFERSYCPNRNCMALVVNGCEINYGTLKKARCPNCTQWFCFQCKLAWHAGYRCEESGNLRDWNDIAFGKLVERMHWARCPACGSCVERKEGCRVMYCSCHSVTYSRAKHISLRKHSTRGDNKGWRIYKVSGCRSTCRSLENFGVTK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRISQQKPIENRECILQQEKVHENPQQEIELEDTNGIFTCEICIEPISANDKFRNKDLCSHHFCQDCIAKYIEAKVQDNNTAKIECPGVHCDQFLDPFSCKLMIPSNLFSKWCDVLFEDYVLGFERSYCPNRNCMALVVNGCEINYGTLKKARCPNCTQWFCFQCKLAWHAGYRCEESGNLRDWNDIAFGKLVERMHWARCPACGSCVERKEGCRVMYCSCHSVTYSRAKHISLRKHSTRGDNKGWRIYKVSGCRSTCRSLENFGVTK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query268 2.2.26 [Sep-21-2011]
P50876292 Probable E3 ubiquitin-pro yes no 0.679 0.623 0.265 3e-11
Q9Z1K6 492 E3 ubiquitin-protein liga yes no 0.738 0.402 0.244 8e-11
Q925F3292 Probable E3 ubiquitin-pro no no 0.679 0.623 0.276 1e-10
O76924 509 Protein ariadne-2 OS=Dros yes no 0.634 0.333 0.283 2e-10
A5PK27304 E3 ubiquitin-protein liga no no 0.671 0.592 0.292 3e-10
O95376 493 E3 ubiquitin-protein liga no no 0.738 0.401 0.235 3e-10
A4IIY1292 Probable E3 ubiquitin-pro no no 0.708 0.650 0.263 3e-10
Q5RFV4293 Probable E3 ubiquitin-pro no no 0.682 0.624 0.25 4e-10
Q7Z419303 E3 ubiquitin-protein liga no no 0.671 0.594 0.292 5e-10
Q4KLT0282 Probable E3 ubiquitin-pro N/A no 0.626 0.595 0.269 5e-10
>sp|P50876|R144A_HUMAN Probable E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens GN=RNF144A PE=1 SV=2 Back     alignment and function desciption
 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 84/192 (43%), Gaps = 10/192 (5%)

Query: 35  NGIFTCEICIEPISANDKFRNKDLCSHHFCQDCIAKYIEAKVQDNNTAKIECPGVHCDQ- 93
           + + +C++C+      ++      C   FC  C+ +Y+E  +++     I CP   C + 
Sbjct: 15  DPLVSCKLCLGEYPV-EQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQ 73

Query: 94  -FLDPFSCKLMIPSNLFSKWCDVLFEDYVLGFE--RSYCPNRNCMALVVNGCEINYGTLK 150
             L     + M+ + +  ++  + FE  VL F+  R++CP   C A V    ++   T +
Sbjct: 74  GHLQENEIECMVAAEIMQRYKKLQFEREVL-FDPCRTWCPASTCQA-VCQLQDVGLQTPQ 131

Query: 151 KARCPNCTQWFCFQCKLAWHAGYRCEESGN---LRDWNDIAFGKLVERMHWARCPACGSC 207
             +C  C   FC  CK +WH G  C E+     L      AF    +     RCP C   
Sbjct: 132 PVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVY 191

Query: 208 VERKEGCRVMYC 219
           +ER EGC  M C
Sbjct: 192 IERDEGCAQMMC 203
E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9Z1K6|ARI2_MOUSE E3 ubiquitin-protein ligase ARIH2 OS=Mus musculus GN=Arih2 PE=2 SV=1 Back     alignment and function description
>sp|Q925F3|R144A_MOUSE Probable E3 ubiquitin-protein ligase RNF144A OS=Mus musculus GN=Rnf144a PE=1 SV=1 Back     alignment and function description
>sp|O76924|ARI2_DROME Protein ariadne-2 OS=Drosophila melanogaster GN=ari-2 PE=2 SV=1 Back     alignment and function description
>sp|A5PK27|R144B_BOVIN E3 ubiquitin-protein ligase RNF144B OS=Bos taurus GN=RNF144B PE=2 SV=1 Back     alignment and function description
>sp|O95376|ARI2_HUMAN E3 ubiquitin-protein ligase ARIH2 OS=Homo sapiens GN=ARIH2 PE=1 SV=1 Back     alignment and function description
>sp|A4IIY1|R144A_XENTR Probable E3 ubiquitin-protein ligase RNF144A OS=Xenopus tropicalis GN=rnf144a PE=2 SV=1 Back     alignment and function description
>sp|Q5RFV4|R1441_DANRE Probable E3 ubiquitin-protein ligase RNF144A-A OS=Danio rerio GN=rnf144aa PE=3 SV=1 Back     alignment and function description
>sp|Q7Z419|R144B_HUMAN E3 ubiquitin-protein ligase RNF144B OS=Homo sapiens GN=RNF144B PE=1 SV=1 Back     alignment and function description
>sp|Q4KLT0|RN217_XENLA Probable E3 ubiquitin-protein ligase RNF217 OS=Xenopus laevis GN=rnf217 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query268
224135813228 predicted protein [Populus trichocarpa] 0.742 0.872 0.531 3e-50
255578926255 zinc finger protein, putative [Ricinus c 0.738 0.776 0.497 2e-49
255578922213 zinc finger protein, putative [Ricinus c 0.675 0.849 0.532 7e-48
359478253212 PREDICTED: LOW QUALITY PROTEIN: probable 0.675 0.853 0.486 2e-47
224146525241 predicted protein [Populus trichocarpa] 0.720 0.800 0.497 3e-46
224068789237 predicted protein [Populus trichocarpa] 0.660 0.746 0.485 4e-40
297738503329 unnamed protein product [Vitis vinifera] 0.731 0.595 0.370 2e-32
225444595358 PREDICTED: probable E3 ubiquitin-protein 0.731 0.547 0.370 2e-32
255550303 400 zinc finger protein, putative [Ricinus c 0.656 0.44 0.390 1e-31
224142755307 predicted protein [Populus trichocarpa] 0.675 0.589 0.384 1e-31
>gi|224135813|ref|XP_002327310.1| predicted protein [Populus trichocarpa] gi|222835680|gb|EEE74115.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 132/205 (64%), Gaps = 6/205 (2%)

Query: 17  QQEKVHENPQQEIELEDTNGIFTCEICIEPISANDKFRNKDLCSHHFCQDCIAKYIEAKV 76
            +E   E P    + ED+N  FTCEIC EP+ A  KF+N  LC H FC DCIAKYIE  V
Sbjct: 8   SEETKVEEPGLLRQEEDSN--FTCEICTEPMLAIRKFKNGSLCKHPFCLDCIAKYIEVTV 65

Query: 77  QDNNTAKIECPGVHCDQFLDPFSCKLMIPSNLFSKWCDVLFEDYVLGFERSYCPNRNCMA 136
           +++ T  IECPG++C Q LDP SC+ +I   +F KWCD L +  VLG E  YCP R+C  
Sbjct: 66  EES-TGCIECPGLNCKQPLDPLSCRRIISKPIFEKWCDHLCDSTVLGSESCYCPYRDCSV 124

Query: 137 LVVNGCEINYGTLKKARCPNCTQWFCFQCKLAWHAGYRCEESGNLRDWNDIAFGKLVERM 196
           LV+N C  N   LKK +CPNC + FCF CK+ WHAGYRC ES +LRD NDI  G+L+E  
Sbjct: 125 LVLNECMDN---LKKIKCPNCKKNFCFLCKIPWHAGYRCNESRHLRDRNDILVGELIEEK 181

Query: 197 HWARCPACGSCVERKEGCRVMYCSC 221
            W RC  CG  VER  GCR + C C
Sbjct: 182 RWTRCYNCGHSVERVSGCRDIKCKC 206

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255578926|ref|XP_002530316.1| zinc finger protein, putative [Ricinus communis] gi|223530172|gb|EEF32083.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255578922|ref|XP_002530314.1| zinc finger protein, putative [Ricinus communis] gi|223530170|gb|EEF32081.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359478253|ref|XP_003632093.1| PREDICTED: LOW QUALITY PROTEIN: probable E3 ubiquitin-protein ligase RNF144A-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224146525|ref|XP_002326038.1| predicted protein [Populus trichocarpa] gi|222862913|gb|EEF00420.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224068789|ref|XP_002326200.1| predicted protein [Populus trichocarpa] gi|222833393|gb|EEE71870.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297738503|emb|CBI27748.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225444595|ref|XP_002277363.1| PREDICTED: probable E3 ubiquitin-protein ligase RNF144A-B-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255550303|ref|XP_002516202.1| zinc finger protein, putative [Ricinus communis] gi|223544688|gb|EEF46204.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224142755|ref|XP_002324718.1| predicted protein [Populus trichocarpa] gi|222866152|gb|EEF03283.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query268
TAIR|locus:2091030303 AT3G14250 [Arabidopsis thalian 0.671 0.594 0.333 1.9e-35
TAIR|locus:2084116320 AT3G53690 [Arabidopsis thalian 0.671 0.562 0.377 4e-35
TAIR|locus:2101074346 AT3G43750 [Arabidopsis thalian 0.675 0.523 0.298 4.2e-24
TAIR|locus:1006230127384 AT2G26135 [Arabidopsis thalian 0.686 0.479 0.310 1.8e-23
TAIR|locus:2085612348 AT3G45540 [Arabidopsis thalian 0.776 0.597 0.282 2.3e-23
TAIR|locus:504955785213 AT3G45555 [Arabidopsis thalian 0.705 0.887 0.31 3.8e-23
TAIR|locus:2057401398 AT2G26130 [Arabidopsis thalian 0.686 0.462 0.278 1.6e-20
TAIR|locus:2085672408 AT3G45580 [Arabidopsis thalian 0.813 0.534 0.275 2.4e-20
TAIR|locus:2143995 655 AT5G60250 [Arabidopsis thalian 0.772 0.316 0.3 3.7e-20
DICTYBASE|DDB_G0286289611 DDB_G0286289 "C3HC4-type zinc 0.746 0.327 0.273 4.1e-20
TAIR|locus:2091030 AT3G14250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 383 (139.9 bits), Expect = 1.9e-35, P = 1.9e-35
 Identities = 63/189 (33%), Positives = 112/189 (59%)

Query:    40 CEICIEPISANDKFRNKDLCSHHFCQDCIAKYIEAKVQDNNTAKIECPGVHCDQFLDPFS 99
             C IC++   ++D FR    C+H +C DC  +Y+  K+++N  ++I+CP V C + ++P++
Sbjct:    95 CMICMDEKPSSDIFRGTTNCTHAYCTDCTVRYVATKIKEN-ASRIKCPDVECTRLIEPYT 153

Query:   100 CKLMIPSNLFSKWCDVLFEDYVLGFERSYCPNRNCMALVVNGCEINYGTLKKARCPNCTQ 159
             C+ +IP ++F +W  +L E  +  +++ YCP ++C A++VN  E     + +  C +C +
Sbjct:   154 CRDLIPKDVFDRWEKILCESLISSWDKFYCPFKDCSAMMVNN-ENGDANVTQTECRSCHR 212

Query:   160 WFCFQCKLAWHAGYRCEES---GNLR----DWNDIAFGKLVERMHWARCPACGSCVERKE 212
              FC QCK+ WHAG  C+E    GN +    D +D    ++ +   W RCP+C   V++ E
Sbjct:   213 LFCVQCKVTWHAGIGCDEFQRFGNTKKKSSDEDDALLIQMAKNKQWRRCPSCKFYVDKVE 272

Query:   213 GCRVMYCSC 221
             GC+ + C C
Sbjct:   273 GCQHIKCRC 281
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2084116 AT3G53690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101074 AT3G43750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1006230127 AT2G26135 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085612 AT3G45540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955785 AT3G45555 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057401 AT2G26130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085672 AT3G45580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143995 AT5G60250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286289 DDB_G0286289 "C3HC4-type zinc finger-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00410007
hypothetical protein (228 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query268
pfam0148563 pfam01485, IBR, IBR domain 2e-04
smart0064764 smart00647, IBR, In Between Ring fingers 0.001
>gnl|CDD|216524 pfam01485, IBR, IBR domain Back     alignment and domain information 
 Score = 38.0 bits (88), Expect = 2e-04
 Identities = 17/51 (33%), Positives = 20/51 (39%), Gaps = 4/51 (7%)

Query: 125 ERSYCPNRNCMALVVNGCEINYGTLKKARCPNCTQWFCFQCKLAWHAGYRC 175
              +CP  +C     N  E   G  +   C  C   FCF CK  WH G  C
Sbjct: 17  NLKWCPTPDCG----NIIEKTDGGSQNVTCSKCGTEFCFSCKEPWHEGLTC 63

The IBR (In Between Ring fingers) domain is often found to occur between pairs of ring fingers (pfam00097). This domain has also been called the C6HC domain and DRIL (for double RING finger linked) domain. Proteins that contain two Ring fingers and an IBR domain (these proteins are also termed RBR family proteins) are thought to exist in all eukaryotic organisms. RBR family members play roles in protein quality control and can indirectly regulate transcription. Evidence suggests that RBR proteins are often parts of cullin-containing ubiquitin ligase complexes. The ubiquitin ligase Parkin is an RBR family protein whose mutations are involved in forms of familial Parkinson's disease. Length = 63
>gnl|CDD|214763 smart00647, IBR, In Between Ring fingers Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 268
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 99.96
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 99.95
smart0064764 IBR In Between Ring fingers. the domains occurs be 99.34
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 99.3
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.51
smart0064764 IBR In Between Ring fingers. the domains occurs be 98.49
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.45
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.43
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.41
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.37
PF1463444 zf-RING_5: zinc-RING finger domain 98.3
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 98.26
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.24
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.17
PHA02926242 zinc finger-like protein; Provisional 98.09
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.04
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.02
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.96
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.77
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.76
PHA02929238 N1R/p28-like protein; Provisional 97.75
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.71
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.66
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.49
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.47
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 97.46
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.33
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.32
KOG1002791 consensus Nucleotide excision repair protein RAD16 97.16
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.02
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.77
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 96.73
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.7
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 96.67
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.38
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.04
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 95.91
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.72
KOG4367 699 consensus Predicted Zn-finger protein [Function un 95.65
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 95.62
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 95.39
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 95.05
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 95.05
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 94.8
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 94.61
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 94.57
PF1371937 zinc_ribbon_5: zinc-ribbon domain 94.53
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 94.45
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 94.44
PF1371736 zinc_ribbon_4: zinc-ribbon domain 94.13
COG5152259 Uncharacterized conserved protein, contains RING a 94.07
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 94.02
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 93.89
COG5175 480 MOT2 Transcriptional repressor [Transcription] 93.86
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 93.71
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 93.61
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 93.45
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 93.36
KOG4445368 consensus Uncharacterized conserved protein, conta 93.25
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 93.18
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 93.03
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 92.77
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 92.43
PF04641260 Rtf2: Rtf2 RING-finger 92.22
KOG2660331 consensus Locus-specific chromosome binding protei 92.0
smart0066152 RPOL9 RNA polymerase subunit 9. 91.86
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 91.72
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 91.51
KOG4739233 consensus Uncharacterized protein involved in syna 91.15
PHA0062659 hypothetical protein 90.58
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 90.55
COG5220314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 90.19
PF1324023 zinc_ribbon_2: zinc-ribbon domain 90.01
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 89.91
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 89.82
PF1324826 zf-ribbon_3: zinc-ribbon domain 89.31
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 88.59
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 88.53
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 88.32
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 88.14
PHA03096284 p28-like protein; Provisional 88.0
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 87.86
smart0066152 RPOL9 RNA polymerase subunit 9. 87.66
PRK0043250 30S ribosomal protein S27ae; Validated 87.6
PF1495244 zf-tcix: Putative treble-clef, zinc-finger, Zn-bin 87.4
KOG2906105 consensus RNA polymerase III subunit C11 [Transcri 86.98
PF0215035 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I 86.91
KOG3039303 consensus Uncharacterized conserved protein [Funct 86.74
PRK14559 645 putative protein serine/threonine phosphatase; Pro 86.66
PLN03086567 PRLI-interacting factor K; Provisional 86.59
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 85.92
KOG3002299 consensus Zn finger protein [General function pred 85.31
KOG0825 1134 consensus PHD Zn-finger protein [General function 85.02
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 84.37
PF1480334 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. 84.29
KOG1940276 consensus Zn-finger protein [General function pred 84.27
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 84.05
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 83.54
PF0667741 Auto_anti-p27: Sjogren's syndrome/scleroderma auto 82.74
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 82.21
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 82.19
COG5236 493 Uncharacterized conserved protein, contains RING Z 81.55
PF14353128 CpXC: CpXC protein 81.15
KOG3053293 consensus Uncharacterized conserved protein [Funct 80.41
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 80.36
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 80.07
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=8.7e-40  Score=279.37  Aligned_cols=210  Identities=25%  Similarity=0.530  Sum_probs=176.4

Q ss_pred             hhhhcCCCcccccccccCCcCCcCccccCCCCChhhHHHHHHHHHHHhhcCCCceeccCCCCCCCCCCHHHHhhcCChhH
Q 043604           29 IELEDTNGIFTCEICIEPISANDKFRNKDLCSHHFCQDCIAKYIEAKVQDNNTAKIECPGVHCDQFLDPFSCKLMIPSNL  108 (268)
Q Consensus        29 ~~~~~~~~~~~C~IC~~~~~~~~~~~~~~~C~H~fC~~Cl~~~~~~~i~~~~~~~i~CP~~~C~~~i~~~~i~~~l~~~~  108 (268)
                      ....+....+.|.|||++......| ..++|+|+||+.|++.|++..|++|.+..++||+++|+...++..++.+|+.++
T Consensus       176 ~~~~F~~slf~C~ICf~e~~G~~c~-~~lpC~Hv~Ck~C~kdY~~~~i~eg~v~~l~Cp~~~C~~~a~~g~vKelvg~EL  254 (445)
T KOG1814|consen  176 TLEKFVNSLFDCCICFEEQMGQHCF-KFLPCSHVFCKSCLKDYFTIQIQEGQVSCLKCPDPKCGSVAPPGQVKELVGDEL  254 (445)
T ss_pred             HHHHHHhhcccceeeehhhcCccee-eecccchHHHHHHHHHHHHHhhhcceeeeecCCCCCCcccCCchHHHHHHHHHH
Confidence            3455678899999999999776766 689999999999999999999999989999999999999999999999999999


Q ss_pred             HHHHHHHHHhhhhcC-CCcccCCccccCceeeeccccccCCcCeeeCcccccccccccccccCCCCCcchhhc-------
Q 043604          109 FSKWCDVLFEDYVLG-FERSYCPNRNCMALVVNGCEINYGTLKKARCPNCTQWFCFQCKLAWHAGYRCEESGN-------  180 (268)
Q Consensus       109 ~~~~~~~~~~~~~~~-~~~~~Cp~~~C~~~~~~~~~~~~~~~~~~~C~~C~~~~C~~C~~~~H~~~tC~~~~~-------  180 (268)
                      +++|++++.+.++.. .+.+|||++.|+.++..++..     ..+.|.+|+..||+.|+..||+...|.--..       
T Consensus       255 ~arYe~l~lqk~l~~msdv~yCPr~~Cq~p~~~d~~~-----~l~~CskCnFaFCtlCk~t~HG~s~Ck~~~~~~~~l~~  329 (445)
T KOG1814|consen  255 FARYEKLMLQKTLELMSDVVYCPRACCQLPVKQDPGR-----ALAICSKCNFAFCTLCKLTWHGVSPCKVKAEKLIELYL  329 (445)
T ss_pred             HHHHHHHHHHHHHHhhcccccCChhhccCccccCchh-----hhhhhccCccHHHHHHHHhhcCCCcccCchHHHHHHHH
Confidence            999999999999985 889999999999998555544     7889999999999999999999999984311       


Q ss_pred             -ccch------------hhHHHHHH--------HHhCCcccCCCCCceeeecCCcCeEEec-CCc-ccccccccccCCCC
Q 043604          181 -LRDW------------NDIAFGKL--------VERMHWARCPACGSCVERKEGCRVMYCS-CHS-VTYSRAKHISLRKH  237 (268)
Q Consensus       181 -~~~~------------~~~~~~~~--------~~~~~~k~CP~C~~~iek~~GCnhm~C~-C~~-FC~~C~~~~~~~~~  237 (268)
                       |...            +...+.++        ....+.|+||+|+++|||++|||+|+|. |++ |||.|+....+.+.
T Consensus       330 ~~~~~d~a~k~ele~Ryg~rvve~~vn~~lsekwl~~N~krCP~C~v~IEr~eGCnKM~C~~c~~~fc~~c~~~l~~~nP  409 (445)
T KOG1814|consen  330 EYLEADEARKRELEKRYGKRVVEELVNDFLSEKWLESNSKRCPKCKVVIERSEGCNKMHCTKCGTYFCWICAELLYPENP  409 (445)
T ss_pred             HHhhcCHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHhcCCCCCcccceeecCCCccceeeccccccceeehhhhcCCCCh
Confidence             1100            10011111        1134569999999999999999999998 999 99999999988777


Q ss_pred             CCCCCCC
Q 043604          238 STRGDNK  244 (268)
Q Consensus       238 ~~~~~~~  244 (268)
                      |-|+.++
T Consensus       410 YkHF~e~  416 (445)
T KOG1814|consen  410 YKHFSEP  416 (445)
T ss_pred             hhhhcCC
Confidence            7776643

>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>PF14952 zf-tcix: Putative treble-clef, zinc-finger, Zn-binding Back     alignment and domain information
>KOG2906 consensus RNA polymerase III subunit C11 [Transcription] Back     alignment and domain information
>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query268
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 1e-11
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 3e-04
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 7e-04
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
 Score = 59.1 bits (143), Expect = 1e-11
 Identities = 17/88 (19%), Positives = 33/88 (37%), Gaps = 3/88 (3%)

Query: 36  GIFTCEICIEPISANDKFRNKDLCSHHFCQDCIAKYIEAKVQDNNTAKIECPGVHC--DQ 93
           G   C++C+              C   FC  C+ +Y+E  +++     I CP   C    
Sbjct: 4   GSSGCKLCLGEYPVEQMTTIAQ-CQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQG 62

Query: 94  FLDPFSCKLMIPSNLFSKWCDVLFEDYV 121
            L     + M+ + +  ++  + FE   
Sbjct: 63  HLQENEIECMVAAEIMQRYKKLQFERSG 90
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Length = 86 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query268
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 99.73
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 99.67
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 99.42
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 99.38
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.97
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.94
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.7
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.65
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.64
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.61
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.56
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.55
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.55
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.52
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.51
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.5
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.5
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.5
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.47
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.46
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.45
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.43
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.4
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.38
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.36
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.36
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.36
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.36
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.35
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.34
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.32
2ect_A78 Ring finger protein 126; metal binding protein, st 98.31
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.31
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.28
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.26
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.25
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.24
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.2
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.19
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.17
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.17
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.15
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.14
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.14
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.1
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.05
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.0
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.96
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.94
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.94
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.84
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.76
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.76
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 97.74
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.74
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.71
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.7
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.64
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.64
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 97.61
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.56
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.53
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.47
2ea5_A68 Cell growth regulator with ring finger domain prot 97.46
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.43
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.38
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 97.37
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.33
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.23
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.1
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 96.98
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 96.83
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 96.28
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 96.03
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 94.97
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 94.73
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 94.72
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 94.41
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 92.14
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 91.74
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 89.63
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 88.62
3nw0_A238 Non-structural maintenance of chromosomes element 87.89
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 87.84
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 86.07
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 85.81
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 85.73
2jne_A101 Hypothetical protein YFGJ; zinc fingers, two zinc, 84.96
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 84.51
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 82.41
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 82.36
1wg2_A64 Zinc finger (AN1-like) family protein; riken struc 81.93
2ysj_A63 Tripartite motif-containing protein 31; ring-type 81.82
1wfh_A64 Zinc finger (AN1-like) family protein; ZF-AN1 doma 81.61
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 81.24
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 80.57
2ysl_A73 Tripartite motif-containing protein 31; ring-type 80.51
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
Probab=99.73  E-value=4.4e-18  Score=121.66  Aligned_cols=88  Identities=19%  Similarity=0.507  Sum_probs=77.0

Q ss_pred             CCcccccccccCCcCCcCccccCCCCChhhHHHHHHHHHHHhhcCCCceeccCCCCCCCC--CCHHHHhhcCChhHHHHH
Q 043604           35 NGIFTCEICIEPISANDKFRNKDLCSHHFCQDCIAKYIEAKVQDNNTAKIECPGVHCDQF--LDPFSCKLMIPSNLFSKW  112 (268)
Q Consensus        35 ~~~~~C~IC~~~~~~~~~~~~~~~C~H~fC~~Cl~~~~~~~i~~~~~~~i~CP~~~C~~~--i~~~~i~~~l~~~~~~~~  112 (268)
                      ...++|+||++++...+.+ .+.+|+|.||.+||+.|++.+|.+|...++.||.++|+..  ++++.++.+|+++++++|
T Consensus         3 ~~~~~C~IC~~~~~~~~~~-~l~~CgH~FC~~Cl~~~~~~~i~~g~~~~i~CP~~~C~~~~~~~~~~i~~ll~~~~~~ky   81 (94)
T 1wim_A            3 SGSSGCKLCLGEYPVEQMT-TIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRY   81 (94)
T ss_dssp             CSBCCCSSSCCCCBGGGEE-EETTTTEEEEHHHHHHHHHHHHHHCSCCCEECSCTTCSSCCEECHHHHHHHSCHHHHHHH
T ss_pred             CCCcCCcccCcccccccce-EcCCCCCcccHHHHHHHHHHHhhcCCcccccCccccCCCCCccCHHHHHHHCCHHHHHHH
Confidence            4578999999998655433 3458999999999999999999886667899999999999  999999999999999999


Q ss_pred             HHHHHhhhhcC
Q 043604          113 CDVLFEDYVLG  123 (268)
Q Consensus       113 ~~~~~~~~~~~  123 (268)
                      .+++++.++..
T Consensus        82 ~~~~~~~~v~~   92 (94)
T 1wim_A           82 KKLQFERSGPS   92 (94)
T ss_dssp             HHHHHHSSCSS
T ss_pred             HHHHHHhhhcc
Confidence            99999887754
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 268
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 1e-08
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: UbcM4-interacting protein 4 (KIAA0161)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 49.7 bits (118), Expect = 1e-08
 Identities = 17/90 (18%), Positives = 36/90 (40%), Gaps = 3/90 (3%)

Query: 34  TNGIFTCEICIEPISANDKFRNKDLCSHHFCQDCIAKYIEAKVQDNNTAKIECPGVHCDQ 93
           ++G   C++C+              C   FC  C+ +Y+E  +++     I CP   C +
Sbjct: 2   SSGSSGCKLCLGEYPVEQMTTIAQ-CQCIFCTLCLKQYVELLIKEGLETAISCPDAACPK 60

Query: 94  --FLDPFSCKLMIPSNLFSKWCDVLFEDYV 121
              L     + M+ + +  ++  + FE   
Sbjct: 61  QGHLQENEIECMVAAEIMQRYKKLQFERSG 90

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query268
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 99.72
d1wd2a_60 Ariadne-1 protein homolog {Human (Homo sapiens) [T 99.67
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 99.27
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 99.17
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.78
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.69
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.5
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.5
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.46
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.44
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.29
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.22
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.18
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.14
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.11
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 97.98
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.92
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.82
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.34
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 96.68
d1wd2a_60 Ariadne-1 protein homolog {Human (Homo sapiens) [T 96.35
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 93.98
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 89.5
d1wfha_64 Zinc finger A20 and AN1 domains containing protein 87.68
d2k4xa155 Ribosomal protein S27ae {Thermoplasma acidophilum 87.24
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 86.27
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 85.92
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 85.6
d1wfla_74 Zinc finger A20 domain containing protein 2 {Mouse 85.39
d1wfpa_74 Zinc finger A20 and AN1 domains containing protein 84.41
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: UbcM4-interacting protein 4 (KIAA0161)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.72  E-value=3.9e-18  Score=120.17  Aligned_cols=87  Identities=20%  Similarity=0.540  Sum_probs=75.8

Q ss_pred             CCcccccccccCCcCCcCccccCCCCChhhHHHHHHHHHHHhhcCCCceeccCCCCCCC--CCCHHHHhhcCChhHHHHH
Q 043604           35 NGIFTCEICIEPISANDKFRNKDLCSHHFCQDCIAKYIEAKVQDNNTAKIECPGVHCDQ--FLDPFSCKLMIPSNLFSKW  112 (268)
Q Consensus        35 ~~~~~C~IC~~~~~~~~~~~~~~~C~H~fC~~Cl~~~~~~~i~~~~~~~i~CP~~~C~~--~i~~~~i~~~l~~~~~~~~  112 (268)
                      ++..+|+||+++++..+ ++.++.|+|.||.+||+.|++++|.++...+|+||..+|..  .+.+.+|+.+|+++++++|
T Consensus         3 ~~~~~C~IC~~~~~~~~-~~~~~~C~H~fC~~Cl~~~~~~~i~~~~~~~i~CP~~~C~~~~~~~~~~i~~ll~~~~~~ky   81 (94)
T d1wima_           3 SGSSGCKLCLGEYPVEQ-MTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRY   81 (94)
T ss_dssp             CSBCCCSSSCCCCBGGG-EEEETTTTEEEEHHHHHHHHHHHHHHCSCCCEECSCTTCSSCCEECHHHHHHHSCHHHHHHH
T ss_pred             CCCCcCccCCCcccCCc-eEEECCCCCEeCCcCHHHHHHHHHhcCCccccCCcCCCCCCCcccCHHHHHHhCCHHHHHHH
Confidence            56789999999996544 44577899999999999999999998778899999988864  5889999999999999999


Q ss_pred             HHHHHhhhhc
Q 043604          113 CDVLFEDYVL  122 (268)
Q Consensus       113 ~~~~~~~~~~  122 (268)
                      ++++++.+..
T Consensus        82 ~~~~l~~~~~   91 (94)
T d1wima_          82 KKLQFERSGP   91 (94)
T ss_dssp             HHHHHHSSCS
T ss_pred             HHHHHHhccc
Confidence            9999987654
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure